Diaphorina citri psyllid: psy11084

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------
MAPNTSSAPTGVLFEGDSTHTDTMGPIHQQASEDLAEACAKETPEKEYRIVPVWRNIVLFAYLHLAALYGAYLIFTSAKLQTTIFAILMYQAGATGITAGAHRLWAHRAYKAKTPLKLILLLFNTLAFQNHVYEWARDHRVHHKYSETNADPHNAKRGFFFSHVGWLMCRKHPDVIAKGQGIDLSDLKADKLVMFQKKHYMKLMPVICFVLPTVIPMVAWSESFLNAWFVATMFRYTLTLNVTWLVNSAAHMWGQRPYDKFISPAENLGVAIFAMGE
ccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHccccccccccccccccccHHHHHHHHHcccccHHHHHcccccccccccccccEEHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHcccc
**********************************************EYRIVPVWRNIVLFAYLHLAALYGAYLIFTSAKLQTTIFAILMYQAGATGITAGAHRLWAHRAYKAKTPLKLILLLFNTLAFQNHVYEWARDHRVHHKYSETNADPHNAKRGFFFSHVGWLMCRKHPDVIAKGQGIDLSDLKADKLVMFQKKHYMKLMPVICFVLPTVIPMVAWSESFLNAWFVATMFRYTLTLNVTWLVNSAAHMWGQRPYDKFISPAENLGVAIFAMGE
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAPNTSSAPTGVLFEGDSTHTDTMGPIHQQASEDLAEACAKETPEKEYRIVPVWRNIVLFAYLHLAALYGAYLIFTSAKLQTTIFAILMYQAGATGITAGAHRLWAHRAYKAKTPLKLILLLFNTLAFQNHVYEWARDHRVHHKYSETNADPHNAKRGFFFSHVGWLMCRKHPDVIAKGQGIDLSDLKADKLVMFQKKHYMKLMPVICFVLPTVIPMVAWSESFLNAWFVATMFRYTLTLNVTWLVNSAAHMWGQRPYDKFISPAENLGVAIFAMGE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Acyl-CoA desaturase Terminal component of the liver microsomal stearyl-CoA desaturase system, that utilizes O(2) and electrons from reduced cytochrome b5 to catalyze the insertion of a double bond into a spectrum of fatty acyl-CoA substrates including palmitoyl-CoA and stearoyl-CoA.confidentO00767
Acyl-CoA desaturase 1 Terminal component of the liver microsomal stearyl-CoA desaturase system, that utilizes O(2) and electrons from reduced cytochrome b5 to catalyze the insertion of a double bond into a spectrum of fatty acyl-CoA substrates including palmitoyl-CoA and stearoyl-CoA.confidentP13516
Acyl-CoA desaturase 2 Terminal component of the liver microsomal stearyl-CoA desaturase system, that utilizes O(2) and electrons from reduced cytochrome b5 to catalyze the insertion of a double bond into a spectrum of fatty acyl-CoA substrates including palmitoyl-CoA and stearoyl-CoA.confidentQ6P7B9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043231 [CC]intracellular membrane-bounded organelleconfidentGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0050872 [BP]white fat cell differentiationprobableGO:0032502, GO:0009987, GO:0048869, GO:0030154, GO:0008150, GO:0044763, GO:0045444, GO:0044699
GO:0050873 [BP]brown fat cell differentiationprobableGO:0032502, GO:0009987, GO:0048869, GO:0030154, GO:0008150, GO:0044763, GO:0045444, GO:0044699
GO:0048047 [BP]mating behavior, sex discriminationprobableGO:0044703, GO:0000003, GO:0007618, GO:0019098, GO:0007617, GO:0050896, GO:0007610, GO:0022414, GO:0008150, GO:0051705, GO:0051704
GO:0005811 [CC]lipid particleprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0055114 [BP]oxidation-reduction processprobableGO:0044710, GO:0008150, GO:0008152
GO:0004768 [MF]stearoyl-CoA 9-desaturase activityprobableGO:0016215, GO:0016717, GO:0016705, GO:0003824, GO:0003674, GO:0016491
GO:0031410 [CC]cytoplasmic vesicleprobableGO:0005737, GO:0031982, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043226
GO:0050830 [BP]defense response to Gram-positive bacteriumprobableGO:0009607, GO:0050896, GO:0009617, GO:0006952, GO:0006950, GO:0008150, GO:0042742, GO:0051707, GO:0051704
GO:0030176 [CC]integral to endoplasmic reticulum membraneprobableGO:0005783, GO:0005789, GO:0042175, GO:0043229, GO:0031301, GO:0031300, GO:0043227, GO:0031227, GO:0031224, GO:0005737, GO:0044446, GO:0031090, GO:0016021, GO:0016020, GO:0043226, GO:0044432, GO:0012505, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044425, GO:0044422
GO:0044130 [BP]negative regulation of growth of symbiont in hostprobableGO:0045926, GO:0040008, GO:0050789, GO:0008150, GO:0043903, GO:0043900, GO:0043901, GO:0065007, GO:0048519, GO:0044126, GO:0044146, GO:0044144
GO:0005506 [MF]iron ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0040018 [BP]positive regulation of multicellular organism growthprobableGO:0040014, GO:0051240, GO:0050789, GO:0065007, GO:0051239, GO:0048518, GO:0008150, GO:0040008, GO:0045927
GO:0007619 [BP]courtship behaviorprobableGO:0044703, GO:0000003, GO:0007618, GO:0019098, GO:0007617, GO:0050896, GO:0007610, GO:0022414, GO:0008150, GO:0051705, GO:0051704
GO:0006633 [BP]fatty acid biosynthetic processprobableGO:0006631, GO:0019752, GO:0044249, GO:0044281, GO:0044283, GO:0072330, GO:1901576, GO:0044710, GO:0044711, GO:0071704, GO:0006629, GO:0009987, GO:0032787, GO:0009058, GO:0008150, GO:0008152, GO:0043436, GO:0044255, GO:0008610, GO:0044238, GO:0006082, GO:0046394, GO:0016053, GO:0044237
GO:0040010 [BP]positive regulation of growth rateprobableGO:0045927, GO:0040008, GO:0040009, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0006723 [BP]cuticle hydrocarbon biosynthetic processprobableGO:0032502, GO:0042335, GO:0044707, GO:0048856, GO:0044767, GO:0009058, GO:0032501, GO:0008150, GO:0008152, GO:0007275, GO:0044699
GO:0034435 [BP]cholesterol esterificationprobableGO:0044238, GO:0044710, GO:0006629, GO:0009987, GO:0044237, GO:0071704, GO:0034433, GO:0034434, GO:0008202, GO:0008152, GO:0008150, GO:0044255, GO:0030258, GO:1901360
GO:0010506 [BP]regulation of autophagyprobableGO:0009894, GO:0031329, GO:0019222, GO:0031323, GO:0050794, GO:0065007, GO:0008150, GO:0050789
GO:0006911 [BP]phagocytosis, engulfmentprobableGO:0009987, GO:0006909, GO:0016192, GO:0016044, GO:0071840, GO:0006810, GO:0010324, GO:0008150, GO:0061024, GO:0044765, GO:0044763, GO:0016043, GO:0006897, GO:0051234, GO:0051179, GO:0044699
GO:0010873 [BP]positive regulation of cholesterol esterificationprobableGO:0009893, GO:0019222, GO:0019216, GO:0019218, GO:0031325, GO:0031323, GO:0050794, GO:0045940, GO:0048518, GO:0045834, GO:0008150, GO:0010872, GO:0065007, GO:0050789, GO:0080090, GO:0048522
GO:0000910 [BP]cytokinesisprobableGO:0009987, GO:0008150, GO:0044763, GO:0007049, GO:0051301, GO:0022402, GO:0044699
GO:0060179 [BP]male mating behaviorprobableGO:0044703, GO:0032501, GO:0032504, GO:0048609, GO:0007618, GO:0044706, GO:0007617, GO:0050896, GO:0019098, GO:0007610, GO:0022414, GO:0008150, GO:0033057, GO:0000003, GO:0051705, GO:0051704
GO:0042811 [BP]pheromone biosynthetic processprobableGO:0042445, GO:0042446, GO:0044711, GO:0044550, GO:0019748, GO:0044710, GO:0044237, GO:0010817, GO:0044249, GO:0009058, GO:0042810, GO:0008150, GO:0008152, GO:0065007, GO:0009987, GO:0065008

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.14.-.-Acting on paired donors, with incorporation or reduction of molecular oxygen.probable
1.14.19.-With oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water.probable
1.14.19.1Stearoyl-CoA 9-desaturase.probable

Spatial Structural Prediction

No confident structure templates for the query are predicted