Query         psy111
Match_columns 85
No_of_seqs    114 out of 659
Neff          6.2 
Searched_HMMs 46136
Date          Fri Aug 16 17:57:16 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy111.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/111hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3340|consensus              100.0   2E-32 4.2E-37  206.6   5.3   84    1-84    245-328 (454)
  2 smart00812 Alpha_L_fucos Alpha  99.9 1.2E-25 2.6E-30  171.2   7.7   81    1-83    228-308 (384)
  3 PF01120 Alpha_L_fucos:  Alpha-  99.8 3.3E-21 7.2E-26  144.5   3.5   78    1-83    238-315 (346)
  4 COG3669 Alpha-L-fucosidase [Ca  98.7 2.5E-08 5.4E-13   77.2   5.2   49   31-83    239-290 (430)
  5 PRK09925 leu operon leader pep  70.7    0.74 1.6E-05   23.0  -1.0   17   69-85      2-18  (28)
  6 PHA03364 hypothetical protein;  56.9     5.7 0.00012   29.7   1.1   13   73-85    144-156 (264)
  7 PF02522 Antibiotic_NAT:  Amino  55.2      15 0.00034   26.1   3.1   21   60-80     15-35  (229)
  8 PF01805 Surp:  Surp module;  I  53.2      11 0.00023   21.0   1.6   16   62-77      2-17  (55)
  9 PF03049 Herpes_UL79:  UL79 fam  52.6     7.3 0.00016   28.9   1.1   14   72-85    141-154 (253)
 10 PF14468 DUF4427:  Protein of u  51.3      11 0.00025   25.3   1.7   36   40-83     33-72  (132)
 11 PF10104 Brr6_like_C_C:  Di-sul  49.6     2.5 5.4E-05   28.2  -1.7   37   34-73     73-109 (135)
 12 PF09907 DUF2136:  Uncharacteri  47.9      21 0.00045   21.7   2.4   28   56-84     16-45  (76)
 13 KOG3493|consensus               47.9     6.4 0.00014   23.9   0.1   12    1-12      3-14  (73)
 14 TIGR02469 CbiT precorrin-6Y C5  45.9      30 0.00065   20.8   3.0   23   60-82    100-122 (124)
 15 COG2242 CobL Precorrin-6B meth  45.1      29 0.00063   24.6   3.1   25   59-83    112-136 (187)
 16 PF14258 DUF4350:  Domain of un  42.9      25 0.00054   20.0   2.1   19   62-80     50-68  (70)
 17 KOG1136|consensus               42.0      40 0.00086   26.8   3.6   63   14-83    174-240 (501)
 18 smart00648 SWAP Suppressor-of-  41.9      14 0.00031   20.4   0.9   15   63-77      2-16  (54)
 19 TIGR03675 arCOG00543 arCOG0054  39.1      55  0.0012   27.0   4.2   40   45-84    372-411 (630)
 20 PF12847 Methyltransf_18:  Meth  37.9      25 0.00055   20.9   1.7   22   60-81     89-110 (112)
 21 KOG3439|consensus               37.7      39 0.00085   22.3   2.6   35   45-82     75-109 (116)
 22 COG4013 Uncharacterized protei  37.5      37  0.0008   21.5   2.4   29   57-85      6-34  (91)
 23 PF08241 Methyltransf_11:  Meth  35.1      28 0.00061   19.6   1.5   22   59-80     74-95  (95)
 24 PRK08317 hypothetical protein;  34.1      56  0.0012   21.8   3.1   25   57-81     99-123 (241)
 25 TIGR00452 methyltransferase, p  31.3      58  0.0013   24.5   3.0   25   57-81    200-224 (314)
 26 cd02440 AdoMet_MTases S-adenos  30.3      69  0.0015   17.5   2.7   22   59-80     81-102 (107)
 27 PF08532 Glyco_hydro_42M:  Beta  29.8      59  0.0013   22.5   2.7   33   49-81     58-90  (207)
 28 PF01555 N6_N4_Mtase:  DNA meth  29.7      39 0.00084   22.5   1.7   24   61-84     35-58  (231)
 29 COG1236 YSH1 Predicted exonucl  29.3      67  0.0015   25.1   3.2   66   15-84    160-225 (427)
 30 TIGR00417 speE spermidine synt  26.8      81  0.0018   22.7   3.0   24   61-84    165-188 (270)
 31 KOG1270|consensus               26.7      53  0.0011   24.9   2.1   25   56-80    169-193 (282)
 32 COG0296 GlgB 1,4-alpha-glucan   26.5 1.2E+02  0.0027   25.3   4.3   38   45-82    194-234 (628)
 33 cd03143 A4_beta-galactosidase_  26.0      74  0.0016   20.6   2.5   34   48-81     53-86  (154)
 34 PF14250 AbrB-like:  AbrB-like   25.6      34 0.00075   20.8   0.8   11   71-81     34-44  (71)
 35 TIGR00438 rrmJ cell division p  25.2      95  0.0021   20.8   3.0   22   61-82    125-146 (188)
 36 PF13489 Methyltransf_23:  Meth  25.0      30 0.00065   21.7   0.5   25   58-82     91-115 (161)
 37 PRK15068 tRNA mo(5)U34 methylt  24.7      92   0.002   23.2   3.1   25   57-81    201-225 (322)
 38 TIGR02764 spore_ybaN_pdaB poly  24.2 1.2E+02  0.0027   20.3   3.4   34   48-81    125-158 (191)
 39 PLN02232 ubiquinone biosynthes  24.1   1E+02  0.0022   20.3   2.9   23   58-80     57-79  (160)
 40 PF09173 eIF2_C:  Initiation fa  24.0      44 0.00095   20.9   1.0   16   69-84     24-39  (88)
 41 KOG1709|consensus               24.0      75  0.0016   23.8   2.4   22   63-84     89-110 (271)
 42 PLN02396 hexaprenyldihydroxybe  23.9      89  0.0019   23.6   2.9   27   56-82    209-235 (322)
 43 COG2227 UbiG 2-polyprenyl-3-me  23.9      95  0.0021   23.0   2.9   25   56-80    135-159 (243)
 44 PF08003 Methyltransf_9:  Prote  23.6   1E+02  0.0022   23.7   3.1   38   34-81    181-218 (315)
 45 PRK14103 trans-aconitate 2-met  23.5 1.1E+02  0.0023   21.6   3.1   24   59-82    103-126 (255)
 46 TIGR01934 MenG_MenH_UbiE ubiqu  23.4 1.2E+02  0.0026   20.1   3.2   23   58-80    119-141 (223)
 47 TIGR01515 branching_enzym alph  22.9 1.7E+02  0.0038   23.9   4.5   38   45-82    186-226 (613)
 48 PRK01683 trans-aconitate 2-met  22.9 1.3E+02  0.0028   21.0   3.4   24   59-82    107-130 (258)
 49 PF05372 Delta_lysin:  Delta ly  22.7      50  0.0011   16.0   0.9   15   60-74      8-22  (25)
 50 TIGR03073 release_rtcB release  22.2      31 0.00068   26.6   0.2   20   51-70    325-344 (356)
 51 smart00828 PKS_MT Methyltransf  21.9 1.1E+02  0.0025   20.7   2.9   24   58-81     80-103 (224)
 52 COG1782 Predicted metal-depend  21.6 1.1E+02  0.0025   25.5   3.2   41   45-85    378-418 (637)
 53 PLN02233 ubiquinone biosynthes  21.4 1.3E+02  0.0028   21.5   3.2   23   58-80    158-180 (261)
 54 KOG1331|consensus               20.4 1.1E+02  0.0023   23.4   2.7   22   61-82    122-143 (293)
 55 PRK11036 putative S-adenosyl-L  20.2 1.1E+02  0.0023   21.6   2.5   22   59-80    126-147 (255)
 56 TIGR02752 MenG_heptapren 2-hep  20.2 1.4E+02   0.003   20.4   3.0   23   58-80    127-149 (231)
 57 PF11334 DUF3136:  Protein of u  20.2      87  0.0019   18.6   1.7   15   55-69     47-61  (64)
 58 PF06026 Rib_5-P_isom_A:  Ribos  20.2      57  0.0012   22.6   1.1   12   71-82    119-130 (173)
 59 PRK07402 precorrin-6B methylas  20.1 1.5E+02  0.0032   20.0   3.1   25   60-84    120-144 (196)
 60 PLN02244 tocopherol O-methyltr  20.1 1.3E+02  0.0028   22.5   3.1   24   57-80    198-221 (340)
 61 PRK04457 spermidine synthase;   20.1 1.2E+02  0.0026   21.9   2.8   25   59-83    154-178 (262)

No 1  
>KOG3340|consensus
Probab=99.97  E-value=2e-32  Score=206.57  Aligned_cols=84  Identities=49%  Similarity=0.949  Sum_probs=82.2

Q ss_pred             CEEEcCCCCCCCCcccCCccCCCCcCCCCCCCCCCccccccCCCCCcccccCCCCCCCCCHHHHHHHHHHhhcCCCcEEE
Q psy111            1 SVVVNDRWCNTCLCKHGGYLTCEDKYNPGKFQSRKFENCFTLDKYSWGYRRDANIDDILNMTEVLQTMMNTVSFGDKTLS   80 (85)
Q Consensus         1 ~vvvNdR~g~~~~~~~gdy~t~e~~~~p~~~~~~pWE~c~ti~~~sWGY~~~~~~~~~ks~~~li~~Lv~~vskgGNlLL   80 (85)
                      +||+|||||.++.|+||+|+||+|++.|+...+++||+|+||+++||||+|++...++.++.|||+.|+++||+||||||
T Consensus       245 ~VV~NDRWG~gt~c~HGgfy~csD~~~Pg~L~~hKWEnc~tlDk~SWG~Rrd~~~Sd~~t~~Eii~qlv~Tvsc~GN~Ll  324 (454)
T KOG3340|consen  245 TVVVNDRWGTGTMCKHGGFYTCSDRYNPGKLLEHKWENCMTLDKHSWGYRRDMKLSDVNTAYEIIKQLVRTVSCNGNLLL  324 (454)
T ss_pred             eEEecccccCCcccccCCeeeccccCCCcccchhhhhhceeeeccccchhcccchhhhhhHHHHHHHHHHhEeeCCeEEE
Confidence            69999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eccC
Q psy111           81 ILFS   84 (85)
Q Consensus        81 NIG~   84 (85)
                      |||-
T Consensus       325 NvGP  328 (454)
T KOG3340|consen  325 NVGP  328 (454)
T ss_pred             eecC
Confidence            9994


No 2  
>smart00812 Alpha_L_fucos Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site PUBMED:. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
Probab=99.92  E-value=1.2e-25  Score=171.24  Aligned_cols=81  Identities=40%  Similarity=0.712  Sum_probs=71.2

Q ss_pred             CEEEcCCCCCCCCcccCCccCCCCcCCCCCCCCCCccccccCCCCCcccccCCCCCCCCCHHHHHHHHHHhhcCCCcEEE
Q psy111            1 SVVVNDRWCNTCLCKHGGYLTCEDKYNPGKFQSRKFENCFTLDKYSWGYRRDANIDDILNMTEVLQTMMNTVSFGDKTLS   80 (85)
Q Consensus         1 ~vvvNdR~g~~~~~~~gdy~t~e~~~~p~~~~~~pWE~c~ti~~~sWGY~~~~~~~~~ks~~~li~~Lv~~vskgGNlLL   80 (85)
                      +||||+||+ .....+|+|.+++++..|......|||+|+||+ .||||++++.+++|||+++||++|+++|||||||||
T Consensus       228 ~vvvn~R~~-~~~~~~g~~~~~~e~~~p~~~~~~pwE~~~ti~-~sWgy~~~~~~~~~ks~~~li~~l~~~Vsk~GnlLL  305 (384)
T smart00812      228 TVVVNDRWG-GTGCKHGGFYTDEERGAPGKLLPHPWETCTTIG-KSWGYRRNESDSDYKSPKELIRDLVDIVSKGGNLLL  305 (384)
T ss_pred             eEEEEcccc-ccCCCCCCcccCcccCCCCCCCCCCcccccccC-CCCCcCCCCCcccCCCHHHHHHHHhhhcCCCceEEE
Confidence            479999997 223347888877777888888899999999999 899999987667899999999999999999999999


Q ss_pred             ecc
Q psy111           81 ILF   83 (85)
Q Consensus        81 NIG   83 (85)
                      |||
T Consensus       306 NVg  308 (384)
T smart00812      306 NVG  308 (384)
T ss_pred             ccC
Confidence            998


No 3  
>PF01120 Alpha_L_fucos:  Alpha-L-fucosidase;  InterPro: IPR000933 O-Glycosyl hydrolases 3.2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Family 29 (GH29 from CAZY) encompasses alpha-L-fucosidases (3.2.1.51 from EC) [], which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Alpha-L-fucosidase is responsible for hydrolysing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Fucosylated glycoconjugates are involved in numerous biological events, making alpha-l-fucosidases, the enzymes responsible for their processing, critically important. Deficiency in alpha-l-fucosidase activity is associated with fucosidosis, a lysosomal storage disorder characterised by rapid neurodegeneration, resulting in severe mental and motor deterioration []. The enzyme is a hexamer and displays a two-domain fold, composed of a catalytic (beta/alpha)(8)-like domain and a C-terminal beta-sandwich domain [].  Drosophila melanogaster spermatozoa contains an alpha-l-fucosidase that might be involved in fertilisation by interacting with alpha-l-fucose residues on the micropyle of the eggshell []. In human sperm, membrane-associated alpha-l-fucosidase is stable for extended periods of time, which is made possible by membrane domains and compartmentalisation. These help preserve protein integrity []. ; GO: 0004560 alpha-L-fucosidase activity, 0005975 carbohydrate metabolic process; PDB: 3EYP_B 2ZX6_A 2ZWY_B 2ZX8_B 2WSP_A 2ZXA_A 2ZWZ_B 1ODU_B 1HL9_A 2ZX5_B ....
Probab=99.82  E-value=3.3e-21  Score=144.49  Aligned_cols=78  Identities=29%  Similarity=0.528  Sum_probs=62.3

Q ss_pred             CEEEcCCCCCCCCcccCCccCCCCcCCCCCCCCCCccccccCCCCCcccccCCCCCCCCCHHHHHHHHHHhhcCCCcEEE
Q psy111            1 SVVVNDRWCNTCLCKHGGYLTCEDKYNPGKFQSRKFENCFTLDKYSWGYRRDANIDDILNMTEVLQTMMNTVSFGDKTLS   80 (85)
Q Consensus         1 ~vvvNdR~g~~~~~~~gdy~t~e~~~~p~~~~~~pWE~c~ti~~~sWGY~~~~~~~~~ks~~~li~~Lv~~vskgGNlLL   80 (85)
                      +||||+|++... ....||.|+|+ ..|......|||+|+||+ .+|||  ...+..+||+++||++|+++|||||||||
T Consensus       238 ~~ii~~r~~~~~-~~~~d~~~~E~-~~~~~~~~~pwE~~~ti~-~~W~y--~~~~~~~ks~~~li~~l~~~vs~ngnlLL  312 (346)
T PF01120_consen  238 DVIINNRWGGNE-QGDGDYNTPER-GIPGEIQGRPWETCTTIG-PSWGY--NTPDEKYKSADELIDILVDSVSRNGNLLL  312 (346)
T ss_dssp             TSEEECCCSSCS-SCCBSCCEECT-TBTTTEEESEEEEEEESS-SSSS---CGGGCGS--HHHHHHHHHHHHTBTEEEEE
T ss_pred             eEEEecccCCCC-Cccccccchhc-cCCCCCCCCCccccCcCC-CCCcc--cCCCCCcCCHHHHHHHHHHHhccCceEEE
Confidence            489999998762 11229999986 567778899999999997 89999  22345899999999999999999999999


Q ss_pred             ecc
Q psy111           81 ILF   83 (85)
Q Consensus        81 NIG   83 (85)
                      |||
T Consensus       313 Nig  315 (346)
T PF01120_consen  313 NIG  315 (346)
T ss_dssp             EE-
T ss_pred             ecC
Confidence            998


No 4  
>COG3669 Alpha-L-fucosidase [Carbohydrate transport and metabolism]
Probab=98.69  E-value=2.5e-08  Score=77.21  Aligned_cols=49  Identities=14%  Similarity=0.082  Sum_probs=38.9

Q ss_pred             CCCCCccccccCCC---CCcccccCCCCCCCCCHHHHHHHHHHhhcCCCcEEEecc
Q psy111           31 FQSRKFENCFTLDK---YSWGYRRDANIDDILNMTEVLQTMMNTVSFGDKTLSILF   83 (85)
Q Consensus        31 ~~~~pWE~c~ti~~---~sWGY~~~~~~~~~ks~~~li~~Lv~~vskgGNlLLNIG   83 (85)
                      ..+.+|.+|...++   ..|+|.    +.+|||.+||+..|+++|||||+|||||+
T Consensus       239 ~g~n~~~~~~~~~p~h~~~~~~~----d~~~Ks~~elv~~l~dvVskgg~llLnIp  290 (430)
T COG3669         239 HGDNSWTIFTCGGPDHSLRPGHE----DQDYKSVEELVSILFDVVSKGGPLLLNIP  290 (430)
T ss_pred             cccCCCcceeccCCccccccccc----ccccccHHHHhhhhhhhhccCCceEeccC
Confidence            34578998876652   234443    35799999999999999999999999997


No 5  
>PRK09925 leu operon leader peptide; Provisional
Probab=70.73  E-value=0.74  Score=22.96  Aligned_cols=17  Identities=24%  Similarity=0.032  Sum_probs=13.7

Q ss_pred             HHhhcCCCcEEEeccCC
Q psy111           69 MNTVSFGDKTLSILFSV   85 (85)
Q Consensus        69 v~~vskgGNlLLNIG~~   85 (85)
                      ..+|..+|=||||..||
T Consensus         2 ~hivrf~gllllna~s~   18 (28)
T PRK09925          2 THIVRFIGLLLLNASSL   18 (28)
T ss_pred             ceEEEEeeeeeeehhhh
Confidence            35678899999998875


No 6  
>PHA03364 hypothetical protein; Provisional
Probab=56.86  E-value=5.7  Score=29.69  Aligned_cols=13  Identities=31%  Similarity=-0.051  Sum_probs=11.6

Q ss_pred             cCCCcEEEeccCC
Q psy111           73 SFGDKTLSILFSV   85 (85)
Q Consensus        73 skgGNlLLNIG~~   85 (85)
                      -.+||+|.|.|||
T Consensus       144 l~DGN~LFnLGSV  156 (264)
T PHA03364        144 LRDGNILFNLGSV  156 (264)
T ss_pred             ccccceEEEccch
Confidence            4689999999997


No 7  
>PF02522 Antibiotic_NAT:  Aminoglycoside 3-N-acetyltransferase;  InterPro: IPR003679 This family consists of bacterial aminoglycoside 3-N-acetyltransferases (2.3.1.81 from EC) that catalyse the reaction []: Acetyl-Co + a 2-deoxystreptamine antibiotic = CoA + N3'-acetyl-2-deoxystreptamine antibiotic The enzyme can use a range of antibiotics with 2-deoxystreptamine rings as acceptor for its acetyltransferase activity, this inactivates and confers resistance to gentamicin, kanamycin, tobramycin, neomycin and apramycin amongst others. For the kanamycin group antibiotics acetylation occurred at the 3"-amino group in arbekacin and amikacin, and at the 3-amino group in dibekacin as in the case of kanamycin reflecting the effect of the (S)-4-amino-2-hydroxybutyryl side chain which is present in arbekacin and amikacin, but absent in dibekacin and kanamycin [].; GO: 0046353 aminoglycoside 3-N-acetyltransferase activity, 0046677 response to antibiotic; PDB: 3SMA_D 3N0M_B 3IJW_B 3N0S_D 3SLB_C 3SLF_A 3KZL_D 3E4F_B 2NYG_E.
Probab=55.18  E-value=15  Score=26.10  Aligned_cols=21  Identities=10%  Similarity=0.196  Sum_probs=19.5

Q ss_pred             CHHHHHHHHHHhhcCCCcEEE
Q psy111           60 NMTEVLQTMMNTVSFGDKTLS   80 (85)
Q Consensus        60 s~~~li~~Lv~~vskgGNlLL   80 (85)
                      .++.+|+.|.++|...|.|++
T Consensus        15 g~~~vi~aL~~~vg~~GTlvm   35 (229)
T PF02522_consen   15 GAETVIDALLEVVGPEGTLVM   35 (229)
T ss_dssp             HHHHHHHHHHHHHTTTSEEEE
T ss_pred             cHHHHHHHHHHHhccCCeEEE
Confidence            588999999999999999986


No 8  
>PF01805 Surp:  Surp module;  InterPro: IPR000061 SWAP is derived from the Suppressor-of-White-APricot splicing regulator from Drosophila melanogaster. The domain is found in regulators responsible for pervasive, nonsex-specific alternative pre-mRNA splicing characteristics and has been found in splicing regulatory proteins []. These ancient, conserved SWAP proteins share a colinearly arrayed series of novel sequence motifs [].; GO: 0003723 RNA binding, 0006396 RNA processing; PDB: 2E5Z_A 2DT7_B 2DT6_A 1UG0_A 1X4P_A 2E60_A 1X4O_A 4DGW_B.
Probab=53.19  E-value=11  Score=21.05  Aligned_cols=16  Identities=13%  Similarity=0.185  Sum_probs=14.1

Q ss_pred             HHHHHHHHHhhcCCCc
Q psy111           62 TEVLQTMMNTVSFGDK   77 (85)
Q Consensus        62 ~~li~~Lv~~vskgGN   77 (85)
                      .++|+.++..|+++|.
T Consensus         2 ~~~I~~tA~~Va~~G~   17 (55)
T PF01805_consen    2 REIIDKTAEFVAKNGP   17 (55)
T ss_dssp             HHHHHHHHHHHHHCSH
T ss_pred             hHHHHHHHHHHHhcCH
Confidence            4789999999999994


No 9  
>PF03049 Herpes_UL79:  UL79 family;  InterPro: IPR004290 Members of the herpesvirus UL79 family also contain proteins annotated as U52; these are functionally uncharacterised.
Probab=52.62  E-value=7.3  Score=28.94  Aligned_cols=14  Identities=29%  Similarity=-0.100  Sum_probs=12.0

Q ss_pred             hcCCCcEEEeccCC
Q psy111           72 VSFGDKTLSILFSV   85 (85)
Q Consensus        72 vskgGNlLLNIG~~   85 (85)
                      .-.+||+|.|.|||
T Consensus       141 ~l~DGN~LFnLGsv  154 (253)
T PF03049_consen  141 NLRDGNILFNLGSV  154 (253)
T ss_pred             hccccceEEEccch
Confidence            34699999999997


No 10 
>PF14468 DUF4427:  Protein of unknown function (DUF4427)
Probab=51.33  E-value=11  Score=25.35  Aligned_cols=36  Identities=19%  Similarity=0.308  Sum_probs=27.8

Q ss_pred             ccCCCCCcccccCCCCCCCCCHHHHHHHHHHh----hcCCCcEEEecc
Q psy111           40 FTLDKYSWGYRRDANIDDILNMTEVLQTMMNT----VSFGDKTLSILF   83 (85)
Q Consensus        40 ~ti~~~sWGY~~~~~~~~~ks~~~li~~Lv~~----vskgGNlLLNIG   83 (85)
                      +..+ ++|=|..+.       ..++++.|+..    |+|-|.+||.|-
T Consensus        33 ~e~G-~~wvWi~DN-------~~~~vRALl~~grV~v~~eGRYLl~l~   72 (132)
T PF14468_consen   33 REFG-NAWVWIHDN-------QSEVVRALLQAGRVKVNKEGRYLLDLD   72 (132)
T ss_pred             hhcC-ceEEEEecC-------cCHHHHHHHHcCceeeccCceeeeecc
Confidence            3456 788888654       56888888874    899999999873


No 11 
>PF10104 Brr6_like_C_C:  Di-sulfide bridge nucleocytoplasmic transport domain;  InterPro: IPR018767 This entry represents the highly conserved C-terminal region of Brr6-like proteins, including Brl1, which are found in fungi. Brr6 from Saccharomyces cerevisiae (Baker's yeast) is an essential nuclear envelope integral membrane protein that is required for mRNA nuclear export []. Brr6 is involved in the nuclear pore complex (NPC) distribution and nuclear envelope morphology. Brr6 interacts with Brl1, which is also involved in mRNA and protein export from the nucleus [].  The conserved C-terminal region carries four highly conserved cysteine residues. It is suggested that members of the family interact with each other via di-sulphide bridges to form a complex that is involved in nucleocytoplasmic transport.; GO: 0015031 protein transport, 0051028 mRNA transport, 0016021 integral to membrane
Probab=49.62  E-value=2.5  Score=28.18  Aligned_cols=37  Identities=19%  Similarity=0.400  Sum_probs=26.2

Q ss_pred             CCccccccCCCCCcccccCCCCCCCCCHHHHHHHHHHhhc
Q psy111           34 RKFENCFTLDKYSWGYRRDANIDDILNMTEVLQTMMNTVS   73 (85)
Q Consensus        34 ~pWE~c~ti~~~sWGY~~~~~~~~~ks~~~li~~Lv~~vs   73 (85)
                      ..||.||.-|+.+.|..+--   ..++..|+|..+++..|
T Consensus        73 ~~We~CMn~Dp~~~~~~~~l---~ae~laeiiN~Fie~is  109 (135)
T PF10104_consen   73 DEWEKCMNRDPDSIGRSSIL---SAETLAEIINSFIEPIS  109 (135)
T ss_pred             HHHHHHHcCChHHhhHHHHH---HHHHHHHHHHHHHhHhH
Confidence            56999999987777765421   24567778888777655


No 12 
>PF09907 DUF2136:  Uncharacterized protein conserved in bacteria (DUF2136);  InterPro: IPR018669  HigB (YgjN) is the toxin of the HigB-HigA toxin-antitoxin system, acting as a translation-dependent mRNA interferase. HigB inhibits protein synthesis by cleaving translated mRNAs within the coding region []. ; GO: 0016788 hydrolase activity, acting on ester bonds
Probab=47.94  E-value=21  Score=21.65  Aligned_cols=28  Identities=18%  Similarity=0.133  Sum_probs=23.0

Q ss_pred             CCCCCHHHHHHHHHH--hhcCCCcEEEeccC
Q psy111           56 DDILNMTEVLQTMMN--TVSFGDKTLSILFS   84 (85)
Q Consensus        56 ~~~ks~~~li~~Lv~--~vskgGNlLLNIG~   84 (85)
                      .+|+++.||.+.+-+  .|. ++.+..|||.
T Consensus        16 a~w~~~~elk~~f~~ad~v~-~~~~vFnI~G   45 (76)
T PF09907_consen   16 ADWKNPAELKQQFPSADIVK-NNRVVFNIGG   45 (76)
T ss_pred             ccCCCHHHHHHHCcchhhhc-CCEEEEEcCC
Confidence            479999999999855  555 9999999974


No 13 
>KOG3493|consensus
Probab=47.85  E-value=6.4  Score=23.86  Aligned_cols=12  Identities=42%  Similarity=0.562  Sum_probs=9.9

Q ss_pred             CEEEcCCCCCCC
Q psy111            1 SVVVNDRWCNTC   12 (85)
Q Consensus         1 ~vvvNdR~g~~~   12 (85)
                      +|++|||+|...
T Consensus         3 ev~~nDrLGKKV   14 (73)
T KOG3493|consen    3 EVVLNDRLGKKV   14 (73)
T ss_pred             eehhhhhcCceE
Confidence            588999999764


No 14 
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit. This model recognizes the CbiT methylase which is responsible, in part (along with CbiE), for methylating precorrin-6y (or cobalt-precorrin-6y) at both the 5 and 15 positions as well as the concomitant decarbozylation at C-12. In many organisms, this protein is fused to the CbiE subunit. The fused protein, when found in organisms catalyzing the oxidative version of the cobalamin biosynthesis pathway, is called CobL.
Probab=45.93  E-value=30  Score=20.77  Aligned_cols=23  Identities=13%  Similarity=0.244  Sum_probs=20.5

Q ss_pred             CHHHHHHHHHHhhcCCCcEEEec
Q psy111           60 NMTEVLQTMMNTVSFGDKTLSIL   82 (85)
Q Consensus        60 s~~~li~~Lv~~vskgGNlLLNI   82 (85)
                      ...++++.+.+.+.+||.+++++
T Consensus       100 ~~~~~l~~~~~~Lk~gG~li~~~  122 (124)
T TIGR02469       100 LLQEILEAIWRRLRPGGRIVLNA  122 (124)
T ss_pred             hHHHHHHHHHHHcCCCCEEEEEe
Confidence            35689999999999999999986


No 15 
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism]
Probab=45.09  E-value=29  Score=24.63  Aligned_cols=25  Identities=16%  Similarity=0.267  Sum_probs=22.5

Q ss_pred             CCHHHHHHHHHHhhcCCCcEEEecc
Q psy111           59 LNMTEVLQTMMNTVSFGDKTLSILF   83 (85)
Q Consensus        59 ks~~~li~~Lv~~vskgGNlLLNIG   83 (85)
                      ++.++|++...+.+.+||.+++|.-
T Consensus       112 ~~i~~ile~~~~~l~~ggrlV~nai  136 (187)
T COG2242         112 GNIEEILEAAWERLKPGGRLVANAI  136 (187)
T ss_pred             CCHHHHHHHHHHHcCcCCeEEEEee
Confidence            4578999999999999999999973


No 16 
>PF14258 DUF4350:  Domain of unknown function (DUF4350)
Probab=42.89  E-value=25  Score=19.98  Aligned_cols=19  Identities=16%  Similarity=0.256  Sum_probs=15.8

Q ss_pred             HHHHHHHHHhhcCCCcEEE
Q psy111           62 TEVLQTMMNTVSFGDKTLS   80 (85)
Q Consensus        62 ~~li~~Lv~~vskgGNlLL   80 (85)
                      .+=++.|.+-|.+||.|+|
T Consensus        50 ~~~~~~l~~~v~~G~~lvl   68 (70)
T PF14258_consen   50 PEEAEALLEWVEAGNTLVL   68 (70)
T ss_pred             hHHHHHHHHHHHcCCEEEE
Confidence            3667789999999999886


No 17 
>KOG1136|consensus
Probab=41.97  E-value=40  Score=26.83  Aligned_cols=63  Identities=14%  Similarity=0.184  Sum_probs=38.2

Q ss_pred             cccCCccCCCCcCCCCCCCCCCcccc----ccCCCCCcccccCCCCCCCCCHHHHHHHHHHhhcCCCcEEEecc
Q psy111           14 CKHGGYLTCEDKYNPGKFQSRKFENC----FTLDKYSWGYRRDANIDDILNMTEVLQTMMNTVSFGDKTLSILF   83 (85)
Q Consensus        14 ~~~gdy~t~e~~~~p~~~~~~pWE~c----~ti~~~sWGY~~~~~~~~~ks~~~li~~Lv~~vskgGNlLLNIG   83 (85)
                      -..|||....|+..-     ..|-.|    .-|.+..++-  ...+..+--..+.++..-++|++||..|+=|-
T Consensus       174 vYTGDYnmTpDrHLG-----aA~id~~rpdlLIsESTYat--tiRdskr~rERdFLk~VhecVa~GGkvlIPvF  240 (501)
T KOG1136|consen  174 VYTGDYNMTPDRHLG-----AAWIDKCRPDLLISESTYAT--TIRDSKRCRERDFLKKVHECVARGGKVLIPVF  240 (501)
T ss_pred             EEecCccCCcccccc-----hhhhccccCceEEeecccee--eeccccchhHHHHHHHHHHHHhcCCeEEEEee
Confidence            345777666655432     123222    1233233332  23334556678999999999999999998664


No 18 
>smart00648 SWAP Suppressor-of-White-APricot splicing regulator. domain present in regulators which are responsible for pre-mRNA splicing processes
Probab=41.87  E-value=14  Score=20.37  Aligned_cols=15  Identities=7%  Similarity=0.180  Sum_probs=13.1

Q ss_pred             HHHHHHHHhhcCCCc
Q psy111           63 EVLQTMMNTVSFGDK   77 (85)
Q Consensus        63 ~li~~Lv~~vskgGN   77 (85)
                      ++|+.++.-|+++|-
T Consensus         2 ~iI~~tA~~Va~~G~   16 (54)
T smart00648        2 DIIDKTAQFVARNGP   16 (54)
T ss_pred             cHHHHHHHHHHHhhH
Confidence            689999999999983


No 19 
>TIGR03675 arCOG00543 arCOG00543 universal archaeal KH-domain/beta-lactamase-domain protein. This family of proteins is universal in the archaea and consistsof an N-terminal type-1 KH-domain (pfam00013) a central beta-lactamase-domain (pfam00753) with a C-terminal motif associated with RNA metabolism (pfam07521). KH-domains are associated with RNA-binding, so taken together, this protein is a likely metal-dependent RNAase. This family was defined in as arCOG01782.
Probab=39.10  E-value=55  Score=27.04  Aligned_cols=40  Identities=23%  Similarity=0.299  Sum_probs=25.3

Q ss_pred             CCcccccCCCCCCCCCHHHHHHHHHHhhcCCCcEEEeccC
Q psy111           45 YSWGYRRDANIDDILNMTEVLQTMMNTVSFGDKTLSILFS   84 (85)
Q Consensus        45 ~sWGY~~~~~~~~~ks~~~li~~Lv~~vskgGNlLLNIG~   84 (85)
                      .++|-..+..+..-....++++.+.+++.+||++|+=+.+
T Consensus       372 STYg~~~~~~~~r~~~e~~l~~~I~~tl~~gG~VLIP~fa  411 (630)
T TIGR03675       372 STYGGRDDYQPSREEAEKELIKVVNETIKRGGKVLIPVFA  411 (630)
T ss_pred             CccCCCCCCCCCHHHHHHHHHHHHHHHHhCCCEEEEEech
Confidence            5666432111222234566788888889999999986654


No 20 
>PF12847 Methyltransf_18:  Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A ....
Probab=37.90  E-value=25  Score=20.94  Aligned_cols=22  Identities=14%  Similarity=0.176  Sum_probs=19.7

Q ss_pred             CHHHHHHHHHHhhcCCCcEEEe
Q psy111           60 NMTEVLQTMMNTVSFGDKTLSI   81 (85)
Q Consensus        60 s~~~li~~Lv~~vskgGNlLLN   81 (85)
                      ...++++.+.+.+.+||-|+++
T Consensus        89 ~~~~~l~~~~~~L~pgG~lvi~  110 (112)
T PF12847_consen   89 ERRRVLERIRRLLKPGGRLVIN  110 (112)
T ss_dssp             HHHHHHHHHHHHEEEEEEEEEE
T ss_pred             HHHHHHHHHHHhcCCCcEEEEE
Confidence            4678899999999999999986


No 21 
>KOG3439|consensus
Probab=37.67  E-value=39  Score=22.35  Aligned_cols=35  Identities=6%  Similarity=0.020  Sum_probs=27.7

Q ss_pred             CCcccccCCCCCCCCCHHHHHHHHHHhhcCCCcEEEec
Q psy111           45 YSWGYRRDANIDDILNMTEVLQTMMNTVSFGDKTLSIL   82 (85)
Q Consensus        45 ~sWGY~~~~~~~~~ks~~~li~~Lv~~vskgGNlLLNI   82 (85)
                      .-|-|.-+.   ---||+|+|..|-++-+-+|-|+||-
T Consensus        75 slflYVN~s---FAPsPDq~v~~Ly~cf~~d~~Lvl~Y  109 (116)
T KOG3439|consen   75 SLFLYVNNS---FAPSPDQIVGNLYECFGTDGKLVLNY  109 (116)
T ss_pred             eEEEEEcCc---cCCCchhHHHHHHHhcCCCCEEEEEE
Confidence            456776332   34589999999999999999999983


No 22 
>COG4013 Uncharacterized protein conserved in archaea [Function unknown]
Probab=37.49  E-value=37  Score=21.46  Aligned_cols=29  Identities=24%  Similarity=0.277  Sum_probs=25.8

Q ss_pred             CCCCHHHHHHHHHHhhcCCCcEEEeccCC
Q psy111           57 DILNMTEVLQTMMNTVSFGDKTLSILFSV   85 (85)
Q Consensus        57 ~~ks~~~li~~Lv~~vskgGNlLLNIG~~   85 (85)
                      +.||++|+++.|-+-|..|-.+=||.|-|
T Consensus         6 ~~~~peEl~eY~~eeV~~gd~vel~~grV   34 (91)
T COG4013           6 DVKNPEELIEYLNEEVDVGDYVELYFGRV   34 (91)
T ss_pred             hhcCHHHHHHHHHhcCCCCCEEEEEEEEE
Confidence            68999999999999999999998888754


No 23 
>PF08241 Methyltransf_11:  Methyltransferase domain;  InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals. The reaction is catalyzed by methyltransferases (Mtases) and modifies DNA, RNA, proteins and small molecules, such as catechol for regulatory purposes. The various aspects of the role of DNA methylation in prokaryotic restriction-modification systems and in a number of cellular processes in eukaryotes including gene regulation and differentiation is well documented. This entry represents a methyltransferase domain found in a large variety of SAM-dependent methyltransferases including, but not limited to:  Arsenite methyltransferase (2.1.1.137 from EC) which converts arsenical compounds to their methylated forms [] Biotin synthesis protein bioC, which is involved in the early stages of biotin biosyntheis [] Arginine N-methyltransferase 1, an arginine-methylating enzyme which acts on residues present in a glycine and argine-rich domain and can methylate histones [] Hexaprenyldihydroxybenzoate methyltransferase (2.1.1.114 from EC), a mitochodrial enzyme involved in ubiquinone biosynthesis []  A probable cobalt-precorrin-6Y C(15)-methyltransferase thought to be involved in adenosylcobalamin biosynthesis [] Sterol 24-C-methyltransferase (2.1.1.41 from EC), shown to participate in ergosterol biosynthesis [] 3-demethylubiquinone-9 3-methyltransferase (2.1.1.64 from EC) involved in ubiquinone biosynthesis []  Structural studies show that this domain forms the Rossman-like alpha-beta fold typical of SAM-dependent methyltransferases [, , ]. ; GO: 0008168 methyltransferase activity, 0008152 metabolic process; PDB: 3CGG_B 3CCF_B 3BKW_B 2PXX_A 3I9F_A 2YQZ_B 2YR0_A 3BUS_A 3EGE_A 3G5L_B ....
Probab=35.08  E-value=28  Score=19.63  Aligned_cols=22  Identities=9%  Similarity=0.172  Sum_probs=19.5

Q ss_pred             CCHHHHHHHHHHhhcCCCcEEE
Q psy111           59 LNMTEVLQTMMNTVSFGDKTLS   80 (85)
Q Consensus        59 ks~~~li~~Lv~~vskgGNlLL   80 (85)
                      .....+++.+.+++.+||-+.+
T Consensus        74 ~~~~~~l~e~~rvLk~gG~l~~   95 (95)
T PF08241_consen   74 EDPEAALREIYRVLKPGGRLVI   95 (95)
T ss_dssp             SHHHHHHHHHHHHEEEEEEEEE
T ss_pred             cCHHHHHHHHHHHcCcCeEEeC
Confidence            4689999999999999998864


No 24 
>PRK08317 hypothetical protein; Provisional
Probab=34.06  E-value=56  Score=21.83  Aligned_cols=25  Identities=8%  Similarity=0.240  Sum_probs=21.3

Q ss_pred             CCCCHHHHHHHHHHhhcCCCcEEEe
Q psy111           57 DILNMTEVLQTMMNTVSFGDKTLSI   81 (85)
Q Consensus        57 ~~ks~~~li~~Lv~~vskgGNlLLN   81 (85)
                      ....+..+++.+.+++..||.+++-
T Consensus        99 ~~~~~~~~l~~~~~~L~~gG~l~~~  123 (241)
T PRK08317         99 HLEDPARALAEIARVLRPGGRVVVL  123 (241)
T ss_pred             ccCCHHHHHHHHHHHhcCCcEEEEE
Confidence            3456899999999999999999863


No 25 
>TIGR00452 methyltransferase, putative. Known examples to date are restricted to the proteobacteria.
Probab=31.31  E-value=58  Score=24.49  Aligned_cols=25  Identities=8%  Similarity=0.009  Sum_probs=22.3

Q ss_pred             CCCCHHHHHHHHHHhhcCCCcEEEe
Q psy111           57 DILNMTEVLQTMMNTVSFGDKTLSI   81 (85)
Q Consensus        57 ~~ks~~~li~~Lv~~vskgGNlLLN   81 (85)
                      ++.++.+.++.+.+++.+||-|+|-
T Consensus       200 H~~dp~~~L~el~r~LkpGG~Lvle  224 (314)
T TIGR00452       200 HRKSPLEHLKQLKHQLVIKGELVLE  224 (314)
T ss_pred             ccCCHHHHHHHHHHhcCCCCEEEEE
Confidence            4567899999999999999999984


No 26 
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy). There are at least five structurally distinct families of AdoMet-MTases, class I being the largest and most diverse. Within this class enzymes can be classified by different substrate specificities (small molecules, lipids, nucleic acids, etc.) and different target atoms for methylation (nitrogen, oxygen, carbon, sulfur, etc.).
Probab=30.35  E-value=69  Score=17.47  Aligned_cols=22  Identities=9%  Similarity=0.108  Sum_probs=18.9

Q ss_pred             CCHHHHHHHHHHhhcCCCcEEE
Q psy111           59 LNMTEVLQTMMNTVSFGDKTLS   80 (85)
Q Consensus        59 ks~~~li~~Lv~~vskgGNlLL   80 (85)
                      .....+++.+.+.+..||-+++
T Consensus        81 ~~~~~~l~~~~~~l~~~g~~~~  102 (107)
T cd02440          81 EDLARFLEEARRLLKPGGVLVL  102 (107)
T ss_pred             hHHHHHHHHHHHHcCCCCEEEE
Confidence            3578999999999999998875


No 27 
>PF08532 Glyco_hydro_42M:  Beta-galactosidase trimerisation domain;  InterPro: IPR013738 O-Glycosyl hydrolases 3.2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. This is non catalytic domain B of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. This domain is related to glutamine amidotransferase enzymes, but the catalytic residues are replaced by non functional amino acids. This domain is involved in trimerisation. ; GO: 0004565 beta-galactosidase activity, 0005975 carbohydrate metabolic process; PDB: 1KWK_A 1KWG_A.
Probab=29.83  E-value=59  Score=22.46  Aligned_cols=33  Identities=12%  Similarity=0.024  Sum_probs=17.5

Q ss_pred             cccCCCCCCCCCHHHHHHHHHHhhcCCCcEEEe
Q psy111           49 YRRDANIDDILNMTEVLQTMMNTVSFGDKTLSI   81 (85)
Q Consensus        49 Y~~~~~~~~~ks~~~li~~Lv~~vskgGNlLLN   81 (85)
                      |.---.+..+.-..+..+.|.+-|..||.|++-
T Consensus        58 Ykllv~P~~~~l~~~~~~~L~~yV~~GG~li~~   90 (207)
T PF08532_consen   58 YKLLVLPSLYILSPEFAERLRAYVENGGTLILT   90 (207)
T ss_dssp             -SEEEES--SC--HHH---HHHHHT-SS-EEE-
T ss_pred             CcEEEEeeEEEEChHHHHHHHHHHHCCCEEEEE
Confidence            554344455778899999999999999999974


No 28 
>PF01555 N6_N4_Mtase:  DNA methylase;  InterPro: IPR002941 This domain is found in DNA methylases. In prokaryotes, the major role of DNA methylation is to protect host DNA against degradation by restriction enzymes. This family contains both N-4 cytosine-specific DNA methylases and N-6 Adenine-specific DNA methylases. N-4 cytosine-specific DNA methylases (2.1.1.113 from EC) [] are enzymes that specifically methylate the amino group at the C-4 position of cytosines in DNA. Such enzymes are found as components of type II restriction-modification systems in prokaryotes. Such enzymes recognise a specific sequence in DNA and methylate a cytosine in that sequence. By this action they protect DNA from cleavage by type II restriction enzymes that recognise the same sequence. N-6 adenine-specific DNA methylases (2.1.1.72 from EC) (A-Mtase) are enzymes that specifically methylate the amino group at the C-6 position of adenines in DNA. Such enzymes are found in the three existing types of bacterial restriction-modification systems (in type I system the A-Mtase is the product of the hsdM gene, and in type III it is the product of the mod gene). All of these enzymes recognise a specific sequence in DNA and methylate an adenine in that sequence.; GO: 0003677 DNA binding, 0008170 N-methyltransferase activity, 0006306 DNA methylation; PDB: 2ZIF_A 2ZIE_A 2ZIG_A 1NW6_A 1NW8_A 1NW7_A 1NW5_A 1EG2_A 1BOO_A 1G60_B ....
Probab=29.67  E-value=39  Score=22.47  Aligned_cols=24  Identities=17%  Similarity=0.198  Sum_probs=20.8

Q ss_pred             HHHHHHHHHHhhcCCCcEEEeccC
Q psy111           61 MTEVLQTMMNTVSFGDKTLSILFS   84 (85)
Q Consensus        61 ~~~li~~Lv~~vskgGNlLLNIG~   84 (85)
                      ..+++..+.+++..||.+.++|+.
T Consensus        35 ~~~~~~~~~rvLk~~g~~~i~~~~   58 (231)
T PF01555_consen   35 MEEWLKECYRVLKPGGSIFIFIDD   58 (231)
T ss_dssp             HHHHHHHHHHHEEEEEEEEEEE-C
T ss_pred             HHHHHHHHHhhcCCCeeEEEEecc
Confidence            678889999999999999999874


No 29 
>COG1236 YSH1 Predicted exonuclease of the beta-lactamase fold involved in RNA processing [Translation, ribosomal structure and biogenesis]
Probab=29.30  E-value=67  Score=25.09  Aligned_cols=66  Identities=14%  Similarity=0.098  Sum_probs=37.9

Q ss_pred             ccCCccCCCCcCCCCCCCCCCccccccCCCCCcccccCCCCCCCCCHHHHHHHHHHhhcCCCcEEEeccC
Q psy111           15 KHGGYLTCEDKYNPGKFQSRKFENCFTLDKYSWGYRRDANIDDILNMTEVLQTMMNTVSFGDKTLSILFS   84 (85)
Q Consensus        15 ~~gdy~t~e~~~~p~~~~~~pWE~c~ti~~~sWGY~~~~~~~~~ks~~~li~~Lv~~vskgGNlLLNIG~   84 (85)
                      .-|||.+-+++...+......  .+.=|-+..+|=.... +.+. .-+++++.+.+++++||.+|+=+.+
T Consensus       160 ytGD~~~~~~~l~~~a~~~~~--~DvLI~EsTYg~~~~~-~r~~-~e~~f~~~v~~~l~~GG~vlipafa  225 (427)
T COG1236         160 YTGDVKRRKDRLLNGAELPPC--IDVLIVESTYGDRLHP-NRDE-VERRFIESVKAALERGGTVLIPAFA  225 (427)
T ss_pred             EEeccCCCcCCCCCccccCCC--CcEEEEecccCCccCC-CHHH-HHHHHHHHHHHHHhCCCEEEEeccc
Confidence            458888877655433222222  2222223566754322 1111 2334789999999999999986654


No 30 
>TIGR00417 speE spermidine synthase. the SpeE subunit of spermidine synthase catalysesthe reaction (putrescine + S-adenosylmethioninamine = spermidine + 5'-methylthioadenosine) and is involved in polyamine biosynthesis and in the biosynthesis of spermidine from arganine. The region between residues 77 and 120 of the seed alignment is thought to be involved in binding to decarboxylated SAM.
Probab=26.77  E-value=81  Score=22.68  Aligned_cols=24  Identities=8%  Similarity=-0.021  Sum_probs=21.3

Q ss_pred             HHHHHHHHHHhhcCCCcEEEeccC
Q psy111           61 MTEVLQTMMNTVSFGDKTLSILFS   84 (85)
Q Consensus        61 ~~~li~~Lv~~vskgGNlLLNIG~   84 (85)
                      ..+.++.+.+.++.||-++++.++
T Consensus       165 ~~ef~~~~~~~L~pgG~lv~~~~~  188 (270)
T TIGR00417       165 TKEFYELLKKALNEDGIFVAQSES  188 (270)
T ss_pred             HHHHHHHHHHHhCCCcEEEEcCCC
Confidence            478889999999999999998765


No 31 
>KOG1270|consensus
Probab=26.73  E-value=53  Score=24.89  Aligned_cols=25  Identities=8%  Similarity=0.159  Sum_probs=23.1

Q ss_pred             CCCCCHHHHHHHHHHhhcCCCcEEE
Q psy111           56 DDILNMTEVLQTMMNTVSFGDKTLS   80 (85)
Q Consensus        56 ~~~ks~~~li~~Lv~~vskgGNlLL   80 (85)
                      ++++.+.++++.|+..+..||.|.|
T Consensus       169 eHV~dp~~~l~~l~~~lkP~G~lfi  193 (282)
T KOG1270|consen  169 EHVKDPQEFLNCLSALLKPNGRLFI  193 (282)
T ss_pred             HHHhCHHHHHHHHHHHhCCCCceEe
Confidence            5789999999999999999999987


No 32 
>COG0296 GlgB 1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism]
Probab=26.47  E-value=1.2e+02  Score=25.34  Aligned_cols=38  Identities=16%  Similarity=0.137  Sum_probs=27.7

Q ss_pred             CCcccccC---CCCCCCCCHHHHHHHHHHhhcCCCcEEEec
Q psy111           45 YSWGYRRD---ANIDDILNMTEVLQTMMNTVSFGDKTLSIL   82 (85)
Q Consensus        45 ~sWGY~~~---~~~~~~ks~~~li~~Lv~~vskgGNlLLNI   82 (85)
                      .||||..-   ...+.|-|++++.+.+-.+-+.|=..+|++
T Consensus       194 ~sWGYq~~g~yAp~sryGtPedfk~fVD~aH~~GIgViLD~  234 (628)
T COG0296         194 RSWGYQGTGYYAPTSRYGTPEDFKALVDAAHQAGIGVILDW  234 (628)
T ss_pred             CCCCCCcceeccccccCCCHHHHHHHHHHHHHcCCEEEEEe
Confidence            69999842   223579999999887777777776666654


No 33 
>cd03143 A4_beta-galactosidase_middle_domain A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. This group includes proteins similar to beta-galactosidase from Thermus thermophilus. Beta-Galactosidase hydrolyzes the beta-1,4-D-galactosidic linkage of lactose, as well as those of related chromogens, o-nitrophenyl-beta-D-galactopyranoside (ONP-Gal) and 5-bromo-4-chloro-3-indolyl-beta-D-galactoside (X-gal).  This A4 beta-galactosidase middle domain lacks the catalytic triad of typical GATase1 domains. The reactive Cys residue found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow in typical GATase1 domains is not conserved in this group.
Probab=26.05  E-value=74  Score=20.56  Aligned_cols=34  Identities=18%  Similarity=0.087  Sum_probs=24.3

Q ss_pred             ccccCCCCCCCCCHHHHHHHHHHhhcCCCcEEEe
Q psy111           48 GYRRDANIDDILNMTEVLQTMMNTVSFGDKTLSI   81 (85)
Q Consensus        48 GY~~~~~~~~~ks~~~li~~Lv~~vskgGNlLLN   81 (85)
                      +|.----+.-+.-..+..+.|.+-|..||.+++-
T Consensus        53 ~y~~vi~P~~~~~~~~~~~~l~~~v~~GG~li~~   86 (154)
T cd03143          53 GYKLVVLPDLYLLSDATAAALRAYVENGGTLVAG   86 (154)
T ss_pred             cCCEEEECchhcCCHHHHHHHHHHHHCCCEEEEe
Confidence            4553333344555678899999999999988763


No 34 
>PF14250 AbrB-like:  AbrB-like transcriptional regulator
Probab=25.60  E-value=34  Score=20.77  Aligned_cols=11  Identities=18%  Similarity=-0.070  Sum_probs=8.3

Q ss_pred             hhcCCCcEEEe
Q psy111           71 TVSFGDKTLSI   81 (85)
Q Consensus        71 ~vskgGNlLLN   81 (85)
                      .|-+|||||+.
T Consensus        34 ~Vq~NGnLLIG   44 (71)
T PF14250_consen   34 SVQGNGNLLIG   44 (71)
T ss_pred             EEecCCCEEEc
Confidence            36789999863


No 35 
>TIGR00438 rrmJ cell division protein FtsJ.
Probab=25.16  E-value=95  Score=20.75  Aligned_cols=22  Identities=5%  Similarity=-0.026  Sum_probs=18.9

Q ss_pred             HHHHHHHHHHhhcCCCcEEEec
Q psy111           61 MTEVLQTMMNTVSFGDKTLSIL   82 (85)
Q Consensus        61 ~~~li~~Lv~~vskgGNlLLNI   82 (85)
                      ...+++.+.+++++||.+++.+
T Consensus       125 ~~~~l~~~~~~LkpgG~lvi~~  146 (188)
T TIGR00438       125 VELALDIAKEVLKPKGNFVVKV  146 (188)
T ss_pred             HHHHHHHHHHHccCCCEEEEEE
Confidence            3678999999999999999854


No 36 
>PF13489 Methyltransf_23:  Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C ....
Probab=25.04  E-value=30  Score=21.73  Aligned_cols=25  Identities=12%  Similarity=0.073  Sum_probs=21.8

Q ss_pred             CCCHHHHHHHHHHhhcCCCcEEEec
Q psy111           58 ILNMTEVLQTMMNTVSFGDKTLSIL   82 (85)
Q Consensus        58 ~ks~~~li~~Lv~~vskgGNlLLNI   82 (85)
                      ...+.++++.|.+++..||-+++-+
T Consensus        91 ~~d~~~~l~~l~~~LkpgG~l~~~~  115 (161)
T PF13489_consen   91 LPDPEEFLKELSRLLKPGGYLVISD  115 (161)
T ss_dssp             SSHHHHHHHHHHHCEEEEEEEEEEE
T ss_pred             cccHHHHHHHHHHhcCCCCEEEEEE
Confidence            3459999999999999999998864


No 37 
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional
Probab=24.66  E-value=92  Score=23.24  Aligned_cols=25  Identities=8%  Similarity=0.048  Sum_probs=21.9

Q ss_pred             CCCCHHHHHHHHHHhhcCCCcEEEe
Q psy111           57 DILNMTEVLQTMMNTVSFGDKTLSI   81 (85)
Q Consensus        57 ~~ks~~~li~~Lv~~vskgGNlLLN   81 (85)
                      +..++.++++.+.+++.+||-+++.
T Consensus       201 H~~dp~~~L~~l~~~LkpGG~lvl~  225 (322)
T PRK15068        201 HRRSPLDHLKQLKDQLVPGGELVLE  225 (322)
T ss_pred             ccCCHHHHHHHHHHhcCCCcEEEEE
Confidence            3457899999999999999999875


No 38 
>TIGR02764 spore_ybaN_pdaB polysaccharide deacetylase family sporulation protein PdaB. This model describes the YbaN protein family, also called PdaB and SpoVIE, of Gram-positive bacteria. Although ybaN null mutants have only a mild sporulation defect, ybaN/ytrI double mutants show drastically reducted sporulation efficiencies. This synthetic defect suggests the role of this sigmaE-controlled gene in sporulation had been masked by functional redundancy. Members of this family are homologous to a characterized polysaccharide deacetylase; the exact function this protein family is unknown.
Probab=24.24  E-value=1.2e+02  Score=20.25  Aligned_cols=34  Identities=12%  Similarity=0.098  Sum_probs=23.2

Q ss_pred             ccccCCCCCCCCCHHHHHHHHHHhhcCCCcEEEe
Q psy111           48 GYRRDANIDDILNMTEVLQTMMNTVSFGDKTLSI   81 (85)
Q Consensus        48 GY~~~~~~~~~ks~~~li~~Lv~~vskgGNlLLN   81 (85)
                      .|+.+..+-...+++++++.+++.+..|.-+||-
T Consensus       125 ~w~~~~~D~~~~~~~~i~~~~~~~~~~g~Iil~H  158 (191)
T TIGR02764       125 HWSVDSRDWKNPGVESIVDRVVKNTKPGDIILLH  158 (191)
T ss_pred             EecCCCCccCCCCHHHHHHHHHhcCCCCCEEEEe
Confidence            3443343333468899999999998877667765


No 39 
>PLN02232 ubiquinone biosynthesis methyltransferase
Probab=24.10  E-value=1e+02  Score=20.30  Aligned_cols=23  Identities=9%  Similarity=0.251  Sum_probs=20.0

Q ss_pred             CCCHHHHHHHHHHhhcCCCcEEE
Q psy111           58 ILNMTEVLQTMMNTVSFGDKTLS   80 (85)
Q Consensus        58 ~ks~~~li~~Lv~~vskgGNlLL   80 (85)
                      +....++++.+.+++..||.+++
T Consensus        57 ~~d~~~~l~ei~rvLkpGG~l~i   79 (160)
T PLN02232         57 VVDRLRAMKEMYRVLKPGSRVSI   79 (160)
T ss_pred             CCCHHHHHHHHHHHcCcCeEEEE
Confidence            34688999999999999999974


No 40 
>PF09173 eIF2_C:  Initiation factor eIF2 gamma, C terminal;  InterPro: IPR015256 This entry represents a domain which is found in the initiation factors eIF2 and EF-Tu, adopting a beta barrel structure with Greek key topology. It is required for formation of the ternary complex with GTP and initiator tRNA []. ; PDB: 1S0U_A 1KK1_A 1KK0_A 1KK2_A 1KJZ_A 1KK3_A 2D74_A 2DCU_A 3P3M_A 3V11_A ....
Probab=24.02  E-value=44  Score=20.89  Aligned_cols=16  Identities=13%  Similarity=0.137  Sum_probs=10.1

Q ss_pred             HHhhcCCCcEEEeccC
Q psy111           69 MNTVSFGDKTLSILFS   84 (85)
Q Consensus        69 v~~vskgGNlLLNIG~   84 (85)
                      ++-..+|=.|+|||||
T Consensus        24 v~~i~~~E~LmlnIGs   39 (88)
T PF09173_consen   24 VEPIKKGEVLMLNIGS   39 (88)
T ss_dssp             -----TTEEEEEEETT
T ss_pred             cccCCCCCEEEEEEcc
Confidence            4456788899999997


No 41 
>KOG1709|consensus
Probab=23.95  E-value=75  Score=23.77  Aligned_cols=22  Identities=5%  Similarity=0.037  Sum_probs=18.9

Q ss_pred             HHHHHHHHhhcCCCcEEEeccC
Q psy111           63 EVLQTMMNTVSFGDKTLSILFS   84 (85)
Q Consensus        63 ~li~~Lv~~vskgGNlLLNIG~   84 (85)
                      -+.+.+++++|-+|-=+||||-
T Consensus        89 piMha~A~ai~tkggrvLnVGF  110 (271)
T KOG1709|consen   89 PIMHALAEAISTKGGRVLNVGF  110 (271)
T ss_pred             HHHHHHHHHHhhCCceEEEecc
Confidence            4778899999999999999984


No 42 
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase
Probab=23.95  E-value=89  Score=23.56  Aligned_cols=27  Identities=11%  Similarity=0.071  Sum_probs=23.2

Q ss_pred             CCCCCHHHHHHHHHHhhcCCCcEEEec
Q psy111           56 DDILNMTEVLQTMMNTVSFGDKTLSIL   82 (85)
Q Consensus        56 ~~~ks~~~li~~Lv~~vskgGNlLLNI   82 (85)
                      ++...+.++++.+.+++..||-+++..
T Consensus       209 eHv~d~~~~L~~l~r~LkPGG~liist  235 (322)
T PLN02396        209 EHVANPAEFCKSLSALTIPNGATVLST  235 (322)
T ss_pred             HhcCCHHHHHHHHHHHcCCCcEEEEEE
Confidence            356678999999999999999999763


No 43 
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism]
Probab=23.92  E-value=95  Score=22.98  Aligned_cols=25  Identities=12%  Similarity=0.146  Sum_probs=22.9

Q ss_pred             CCCCCHHHHHHHHHHhhcCCCcEEE
Q psy111           56 DDILNMTEVLQTMMNTVSFGDKTLS   80 (85)
Q Consensus        56 ~~~ks~~~li~~Lv~~vskgGNlLL   80 (85)
                      +++-.++.+++.+...|+.||-+++
T Consensus       135 EHv~dp~~~~~~c~~lvkP~G~lf~  159 (243)
T COG2227         135 EHVPDPESFLRACAKLVKPGGILFL  159 (243)
T ss_pred             HccCCHHHHHHHHHHHcCCCcEEEE
Confidence            5788899999999999999999886


No 44 
>PF08003 Methyltransf_9:  Protein of unknown function (DUF1698);  InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals. The reaction is catalysed by methyltransferases (Mtases) and modifies DNA, RNA, proteins and small molecules, such as catechol for regulatory purposes. The various aspects of the role of DNA methylation in prokaryotic restriction-modification systems and in a number of cellular processes in eukaryotes including gene regulation and differentiation is well documented. Three classes of DNA Mtases transfer the methyl group from AdoMet to the target base to form either N-6-methyladenine, or N-4-methylcytosine, or C-5- methylcytosine. In C-5-cytosine Mtases, ten conserved motifs are arranged in the same order []. Motif I (a glycine-rich or closely related consensus sequence; FAGxGG in M.HhaI []), shared by other AdoMet-Mtases [], is part of the cofactor binding site and motif IV (PCQ) is part of the catalytic site. In contrast, sequence comparison among N-6-adenine and N-4-cytosine Mtases indicated two of the conserved segments [], although more conserved segments may be present. One of them corresponds to motif I in C-5-cytosine Mtases, and the other is named (D/N/S)PP(Y/F). Crystal structures are known for a number of Mtases [, , , ]. The cofactor binding sites are almost identical and the essential catalytic amino acids coincide. The comparable protein folding and the existence of equivalent amino acids in similar secondary and tertiary positions indicate that many (if not all) AdoMet-Mtases have a common catalytic domain structure. This permits tertiary structure prediction of other DNA, RNA, protein, and small-molecule AdoMet-Mtases from their amino acid sequences []. This entry represents a set of bacterial AdoMet-dependent tRNA (mo5U34)-methyltransferases. These enzymes catalyse the conversion of 5-hydroxyuridine (ho5U) to 5-methoxyuridine (mo5U) at the wobble position (34) of tRNA []. The 5-methoxyuridine is subsequently converted to uridine-5-oxyacetic acid, a modified nucleoside that is apparently necessary for the efficient decoding of G-ending Pro, Ala, and Val codons in these organisms [].; GO: 0016300 tRNA (uracil) methyltransferase activity, 0002098 tRNA wobble uridine modification
Probab=23.62  E-value=1e+02  Score=23.70  Aligned_cols=38  Identities=13%  Similarity=0.238  Sum_probs=29.1

Q ss_pred             CCccccccCCCCCcccccCCCCCCCCCHHHHHHHHHHhhcCCCcEEEe
Q psy111           34 RKFENCFTLDKYSWGYRRDANIDDILNMTEVLQTMMNTVSFGDKTLSI   81 (85)
Q Consensus        34 ~pWE~c~ti~~~sWGY~~~~~~~~~ks~~~li~~Lv~~vskgGNlLLN   81 (85)
                      ..+-++..||   ==|+       -++|-+.++.|-+.+.+||-|+|-
T Consensus       181 ~~FDtVF~MG---VLYH-------rr~Pl~~L~~Lk~~L~~gGeLvLE  218 (315)
T PF08003_consen  181 GAFDTVFSMG---VLYH-------RRSPLDHLKQLKDSLRPGGELVLE  218 (315)
T ss_pred             CCcCEEEEee---ehhc-------cCCHHHHHHHHHHhhCCCCEEEEE
Confidence            4466666665   2354       467999999999999999999984


No 45 
>PRK14103 trans-aconitate 2-methyltransferase; Provisional
Probab=23.48  E-value=1.1e+02  Score=21.57  Aligned_cols=24  Identities=8%  Similarity=0.102  Sum_probs=21.1

Q ss_pred             CCHHHHHHHHHHhhcCCCcEEEec
Q psy111           59 LNMTEVLQTMMNTVSFGDKTLSIL   82 (85)
Q Consensus        59 ks~~~li~~Lv~~vskgGNlLLNI   82 (85)
                      .....+++.+.+++..||-+++.+
T Consensus       103 ~d~~~~l~~~~~~LkpgG~l~~~~  126 (255)
T PRK14103        103 PEHADLLVRWVDELAPGSWIAVQV  126 (255)
T ss_pred             CCHHHHHHHHHHhCCCCcEEEEEc
Confidence            357889999999999999999865


No 46 
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases. Note that a number of non-orthologous genes which are members of pfam03737 have been erroneously annotated as MenG methyltransferases.
Probab=23.35  E-value=1.2e+02  Score=20.11  Aligned_cols=23  Identities=13%  Similarity=0.346  Sum_probs=20.2

Q ss_pred             CCCHHHHHHHHHHhhcCCCcEEE
Q psy111           58 ILNMTEVLQTMMNTVSFGDKTLS   80 (85)
Q Consensus        58 ~ks~~~li~~Lv~~vskgGNlLL   80 (85)
                      ...+.++++.+...++.||-+++
T Consensus       119 ~~~~~~~l~~~~~~L~~gG~l~~  141 (223)
T TIGR01934       119 VTDIQKALREMYRVLKPGGRLVI  141 (223)
T ss_pred             cccHHHHHHHHHHHcCCCcEEEE
Confidence            45688999999999999999876


No 47 
>TIGR01515 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase. A sequence from Arabidopsis thaliana, GP|9294564, scores just above trusted, but appears either to contain corrupt sequence or, more likely, to be a pseudogene as some of the conserved catalytic residues common to the alpha amylase family are not conserved here.
Probab=22.91  E-value=1.7e+02  Score=23.85  Aligned_cols=38  Identities=13%  Similarity=0.121  Sum_probs=28.8

Q ss_pred             CCcccccCC---CCCCCCCHHHHHHHHHHhhcCCCcEEEec
Q psy111           45 YSWGYRRDA---NIDDILNMTEVLQTMMNTVSFGDKTLSIL   82 (85)
Q Consensus        45 ~sWGY~~~~---~~~~~ks~~~li~~Lv~~vskgGNlLLNI   82 (85)
                      .+|||....   .+..|-+++++.+++-.+-.+|=.++|++
T Consensus       186 ~~wGY~~~~y~~~~~~~Gt~~dlk~lV~~~H~~Gi~VilD~  226 (613)
T TIGR01515       186 GSWGYQVTGYYAPTSRFGTPDDFMYFVDACHQAGIGVILDW  226 (613)
T ss_pred             CCCCCCcccCcccccccCCHHHHHHHHHHHHHCCCEEEEEe
Confidence            579997432   23468889998888888888888888875


No 48 
>PRK01683 trans-aconitate 2-methyltransferase; Provisional
Probab=22.86  E-value=1.3e+02  Score=21.03  Aligned_cols=24  Identities=8%  Similarity=0.138  Sum_probs=21.0

Q ss_pred             CCHHHHHHHHHHhhcCCCcEEEec
Q psy111           59 LNMTEVLQTMMNTVSFGDKTLSIL   82 (85)
Q Consensus        59 ks~~~li~~Lv~~vskgGNlLLNI   82 (85)
                      +....+++.+.+++.+||-+++.+
T Consensus       107 ~d~~~~l~~~~~~LkpgG~~~~~~  130 (258)
T PRK01683        107 PDHLELFPRLVSLLAPGGVLAVQM  130 (258)
T ss_pred             CCHHHHHHHHHHhcCCCcEEEEEC
Confidence            346889999999999999999865


No 49 
>PF05372 Delta_lysin:  Delta lysin family;  InterPro: IPR008034 Delta-lysin is a 26 amino acid, hemolytic peptide toxin secreted by Staphylococcus aureus. It is thought that delta-toxin forms an amphipathic helix upon binding to lipid bilayers []. The precise mode of action of delta-lysis is unclear.; GO: 0019836 hemolysis by symbiont of host erythrocytes, 0005576 extracellular region; PDB: 2KAM_A 2DTB_A 1DTC_A.
Probab=22.66  E-value=50  Score=16.01  Aligned_cols=15  Identities=13%  Similarity=0.341  Sum_probs=10.3

Q ss_pred             CHHHHHHHHHHhhcC
Q psy111           60 NMTEVLQTMMNTVSF   74 (85)
Q Consensus        60 s~~~li~~Lv~~vsk   74 (85)
                      +..++++.++++|.|
T Consensus         8 TIgdfvKlI~~TV~K   22 (25)
T PF05372_consen    8 TIGDFVKLIIETVKK   22 (25)
T ss_dssp             HHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHH
Confidence            345777788887754


No 50 
>TIGR03073 release_rtcB release factor H-coupled RctB family protein. Members of this family are related to RctB. RctB a protein of known structure but unknown function that often is encoded near RNA cyclase and therefore is suggested to be a tRNA or mRNA processing enzyme. This family of RctB-like proteins in encoded upstream of, and apparently is translationally coupled to, the putative peptide chain release factor RF-H (TIGR03072), product of the prfH gene. Note that a large deletion at the junction between this gene and the prfH gene in Escherichia coli K-12 marks both as probable pseudogenes.
Probab=22.17  E-value=31  Score=26.56  Aligned_cols=20  Identities=5%  Similarity=0.207  Sum_probs=16.9

Q ss_pred             cCCCCCCCCCHHHHHHHHHH
Q psy111           51 RDANIDDILNMTEVLQTMMN   70 (85)
Q Consensus        51 ~~~~~~~~ks~~~li~~Lv~   70 (85)
                      .++.|..||+.+++|+.+.+
T Consensus       325 ~dEaP~AYKdi~~Vi~~~~~  344 (356)
T TIGR03073       325 YEEAPEAYKSIDSVVGALLQ  344 (356)
T ss_pred             cccChhccCCHHHHHHhhhh
Confidence            46788899999999999655


No 51 
>smart00828 PKS_MT Methyltransferase  in polyketide synthase (PKS) enzymes.
Probab=21.90  E-value=1.1e+02  Score=20.68  Aligned_cols=24  Identities=8%  Similarity=0.178  Sum_probs=20.5

Q ss_pred             CCCHHHHHHHHHHhhcCCCcEEEe
Q psy111           58 ILNMTEVLQTMMNTVSFGDKTLSI   81 (85)
Q Consensus        58 ~ks~~~li~~Lv~~vskgGNlLLN   81 (85)
                      .....++++.+.+++..||-+++-
T Consensus        80 ~~~~~~~l~~~~~~LkpgG~l~i~  103 (224)
T smart00828       80 IKDKMDLFSNISRHLKDGGHLVLA  103 (224)
T ss_pred             CCCHHHHHHHHHHHcCCCCEEEEE
Confidence            445789999999999999999873


No 52 
>COG1782 Predicted metal-dependent RNase, consists of a metallo-beta-lactamase domain and an RNA-binding KH domain [General function prediction only]
Probab=21.57  E-value=1.1e+02  Score=25.46  Aligned_cols=41  Identities=24%  Similarity=0.336  Sum_probs=28.5

Q ss_pred             CCcccccCCCCCCCCCHHHHHHHHHHhhcCCCcEEEeccCC
Q psy111           45 YSWGYRRDANIDDILNMTEVLQTMMNTVSFGDKTLSILFSV   85 (85)
Q Consensus        45 ~sWGY~~~~~~~~~ks~~~li~~Lv~~vskgGNlLLNIG~~   85 (85)
                      ..+|=+.+..+..-...++|++.+-+++.+||.+|+=+-+|
T Consensus       378 sTYGg~~d~q~~R~eaE~~L~~vi~~t~~rGGKvLIP~fAV  418 (637)
T COG1782         378 STYGGRDDVQPPREEAEKELIKVINDTLKRGGKVLIPVFAV  418 (637)
T ss_pred             eccCCccccCccHHHHHHHHHHHHHHHHhcCCeEEEEeeec
Confidence            46663333333344567788888999999999999876554


No 53 
>PLN02233 ubiquinone biosynthesis methyltransferase
Probab=21.44  E-value=1.3e+02  Score=21.53  Aligned_cols=23  Identities=13%  Similarity=0.280  Sum_probs=20.2

Q ss_pred             CCCHHHHHHHHHHhhcCCCcEEE
Q psy111           58 ILNMTEVLQTMMNTVSFGDKTLS   80 (85)
Q Consensus        58 ~ks~~~li~~Lv~~vskgGNlLL   80 (85)
                      +..+.++++.+.+++..||.+++
T Consensus       158 ~~d~~~~l~ei~rvLkpGG~l~i  180 (261)
T PLN02233        158 VVDRLKAMQEMYRVLKPGSRVSI  180 (261)
T ss_pred             CCCHHHHHHHHHHHcCcCcEEEE
Confidence            44689999999999999999865


No 54 
>KOG1331|consensus
Probab=20.39  E-value=1.1e+02  Score=23.37  Aligned_cols=22  Identities=14%  Similarity=0.308  Sum_probs=19.4

Q ss_pred             HHHHHHHHHHhhcCCCcEEEec
Q psy111           61 MTEVLQTMMNTVSFGDKTLSIL   82 (85)
Q Consensus        61 ~~~li~~Lv~~vskgGNlLLNI   82 (85)
                      ...+++.+++++-.|||.|+=+
T Consensus       122 R~~~l~e~~r~lrpgg~~lvyv  143 (293)
T KOG1331|consen  122 RERALEELLRVLRPGGNALVYV  143 (293)
T ss_pred             HHHHHHHHHHHhcCCCceEEEE
Confidence            5789999999999999999744


No 55 
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional
Probab=20.22  E-value=1.1e+02  Score=21.64  Aligned_cols=22  Identities=23%  Similarity=0.196  Sum_probs=19.7

Q ss_pred             CCHHHHHHHHHHhhcCCCcEEE
Q psy111           59 LNMTEVLQTMMNTVSFGDKTLS   80 (85)
Q Consensus        59 ks~~~li~~Lv~~vskgGNlLL   80 (85)
                      ..+.++++.+.+++.+||-+++
T Consensus       126 ~~~~~~l~~~~~~LkpgG~l~i  147 (255)
T PRK11036        126 ADPKSVLQTLWSVLRPGGALSL  147 (255)
T ss_pred             CCHHHHHHHHHHHcCCCeEEEE
Confidence            4578999999999999999976


No 56 
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase. MenG is a generic term for a methyltransferase that catalyzes the last step in menaquinone biosynthesis; the exact enzymatic activity differs for different MenG because the menaquinone differ in their prenoid side chains in different species. Members of this MenG protein family are 2-heptaprenyl-1,4-naphthoquinone methyltransferase, and are found together in operons with the two subunits of the heptaprenyl diphosphate synthase in Bacillus subtilis and related species.
Probab=20.17  E-value=1.4e+02  Score=20.37  Aligned_cols=23  Identities=26%  Similarity=0.416  Sum_probs=19.5

Q ss_pred             CCCHHHHHHHHHHhhcCCCcEEE
Q psy111           58 ILNMTEVLQTMMNTVSFGDKTLS   80 (85)
Q Consensus        58 ~ks~~~li~~Lv~~vskgGNlLL   80 (85)
                      .....++++.+.+++.+||.+++
T Consensus       127 ~~~~~~~l~~~~~~Lk~gG~l~~  149 (231)
T TIGR02752       127 VPDYMQVLREMYRVVKPGGKVVC  149 (231)
T ss_pred             CCCHHHHHHHHHHHcCcCeEEEE
Confidence            34577899999999999999875


No 57 
>PF11334 DUF3136:  Protein of unknown function (DUF3136);  InterPro: IPR021483  This family of proteins with unknown function appear to be restricted to Cyanobacteria. 
Probab=20.17  E-value=87  Score=18.64  Aligned_cols=15  Identities=0%  Similarity=-0.148  Sum_probs=12.1

Q ss_pred             CCCCCCHHHHHHHHH
Q psy111           55 IDDILNMTEVLQTMM   69 (85)
Q Consensus        55 ~~~~ks~~~li~~Lv   69 (85)
                      +..||||+.|+..|-
T Consensus        47 P~~YksP~~L~~~~q   61 (64)
T PF11334_consen   47 PRRYKSPEYLMLLLQ   61 (64)
T ss_pred             ccccCCHHHHHHHHh
Confidence            467999999987763


No 58 
>PF06026 Rib_5-P_isom_A:  Ribose 5-phosphate isomerase A (phosphoriboisomerase A);  InterPro: IPR004788 Ribose 5-phosphate isomerase, also known as phosphoriboisomerase, catalyses the reversible conversion of D-ribose 5-phosphate to D-ribulose 5-phosphate, the first step in the non-oxidative branch of the pentose phosphate pathway []. This reaction enables ribose to be synthesized from sugars, as well as the recycling of sugars during the degradation of nucleotides. There are two unrelated types of ribose 5-phosphate isomerases: type A (RpiA) is the most common and is found in most organisms, while type B (RpiB) is restricted to specific eukaryotic and prokaryotic species. Escherichia coli produces both RpiA and RpiB (also known as AlsB), although RpiA accounts for 99% of total RPI enzymes [].  This entry represents type A (RpiA) enzymes found in eukaryotes (plants, Metazoa and fungi), bacteria and archaea.; GO: 0004751 ribose-5-phosphate isomerase activity, 0009052 pentose-phosphate shunt, non-oxidative branch; PDB: 1M0S_B 3HHE_B 1LKZ_B 1KS2_A 1O8B_A 3UW1_A 3U7J_A 3L7O_A 1XTZ_A 1UJ6_A ....
Probab=20.16  E-value=57  Score=22.65  Aligned_cols=12  Identities=8%  Similarity=-0.100  Sum_probs=8.1

Q ss_pred             hhcCCCcEEEec
Q psy111           71 TVSFGDKTLSIL   82 (85)
Q Consensus        71 ~vskgGNlLLNI   82 (85)
                      +++.|||++|++
T Consensus       119 ~vTDnGN~IlD~  130 (173)
T PF06026_consen  119 FVTDNGNYILDV  130 (173)
T ss_dssp             -B-TTS-EEEEE
T ss_pred             EEeCCCCEEEEe
Confidence            788899999986


No 59 
>PRK07402 precorrin-6B methylase; Provisional
Probab=20.10  E-value=1.5e+02  Score=19.97  Aligned_cols=25  Identities=20%  Similarity=0.292  Sum_probs=21.3

Q ss_pred             CHHHHHHHHHHhhcCCCcEEEeccC
Q psy111           60 NMTEVLQTMMNTVSFGDKTLSILFS   84 (85)
Q Consensus        60 s~~~li~~Lv~~vskgGNlLLNIG~   84 (85)
                      ...++++.+.+.+..||.+++...+
T Consensus       120 ~~~~~l~~~~~~LkpgG~li~~~~~  144 (196)
T PRK07402        120 PIKEILQAVWQYLKPGGRLVATASS  144 (196)
T ss_pred             CHHHHHHHHHHhcCCCeEEEEEeec
Confidence            4578999999999999999987643


No 60 
>PLN02244 tocopherol O-methyltransferase
Probab=20.07  E-value=1.3e+02  Score=22.50  Aligned_cols=24  Identities=8%  Similarity=0.231  Sum_probs=20.9

Q ss_pred             CCCCHHHHHHHHHHhhcCCCcEEE
Q psy111           57 DILNMTEVLQTMMNTVSFGDKTLS   80 (85)
Q Consensus        57 ~~ks~~~li~~Lv~~vskgGNlLL   80 (85)
                      ++....++++.+.+++..||.+++
T Consensus       198 h~~d~~~~l~e~~rvLkpGG~lvi  221 (340)
T PLN02244        198 HMPDKRKFVQELARVAAPGGRIII  221 (340)
T ss_pred             ccCCHHHHHHHHHHHcCCCcEEEE
Confidence            455678999999999999999987


No 61 
>PRK04457 spermidine synthase; Provisional
Probab=20.07  E-value=1.2e+02  Score=21.91  Aligned_cols=25  Identities=16%  Similarity=0.117  Sum_probs=21.9

Q ss_pred             CCHHHHHHHHHHhhcCCCcEEEecc
Q psy111           59 LNMTEVLQTMMNTVSFGDKTLSILF   83 (85)
Q Consensus        59 ks~~~li~~Lv~~vskgGNlLLNIG   83 (85)
                      ....++++.+.++++.||-|++|+.
T Consensus       154 l~t~efl~~~~~~L~pgGvlvin~~  178 (262)
T PRK04457        154 LCTQPFFDDCRNALSSDGIFVVNLW  178 (262)
T ss_pred             cCcHHHHHHHHHhcCCCcEEEEEcC
Confidence            3468999999999999999999964


Done!