RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy11101
         (157 letters)



>gnl|CDD|241395 cd13241, PH2_Kalirin_Trio_p63RhoGEF, p63RhoGEF pleckstrin homology
           (PH) domain, repeat 2.  The guanine nucleotide exchange
           factor p63RhoGEF is an effector of the heterotrimeric G
           protein, Galphaq and linking Galphaq-coupled receptors
           (GPCRs) to the activation of RhoA. The Dbl(DH) and PH
           domains of p63RhoGEF interact with the effector-binding
           site and the C-terminal region of Galphaq and appear to
           relieve autoinhibition of the catalytic DH domain by the
           PH domain. Trio, Duet, and p63RhoGEF are shown to
           constitute a family of Galphaq effectors that appear to
           activate RhoA both in vitro and in intact cells. Dbs is
           a guanine nucleotide exchange factor (GEF), which
           contains spectrin repeats, a rhoGEF (DH) domain and a PH
           domain. The Dbs PH domain participates in binding to
           both the Cdc42 and RhoA GTPases. Trio plays an essential
           role in regulating the actin cytoskeleton during axonal
           guidance and branching. Trio is a multidomain signaling
           protein that contains two RhoGEF(DH)-PH domains in
           tandem. PH domains have diverse functions, but in
           general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 140

 Score =  179 bits (456), Expect = 5e-59
 Identities = 77/157 (49%), Positives = 96/157 (61%), Gaps = 28/157 (17%)

Query: 4   VARLKGFDGKITAQGKLLMRGPLYCTETSVASSSSSNSRGKELQVFLFEQSMIFSEAVGK 63
           V RL+GFDGKITAQGKLL++  L  +E      +  +S+GKE +VFLFEQ +IFSE +GK
Sbjct: 1   VGRLQGFDGKITAQGKLLLQDTLLVSEPE----AGLSSKGKERRVFLFEQIIIFSEILGK 56

Query: 64  KTQFS-----------VNKMSVEEKVPEELTPAGSGGSRGGLSAYFLLKSIDPKKPALTF 112
           KTQFS           VNKMS+EE V  +                F L+S DP KP  +F
Sbjct: 57  KTQFSNPGYIYKNSIKVNKMSLEENVDGDPCR-------------FALRSRDPNKPGESF 103

Query: 113 LCQAPTEESRSEWLRCLGLILQTQRDFLKAIQSPIAY 149
           + QAP+ E R EW+  +  IL TQRDFL A+QSPIAY
Sbjct: 104 VLQAPSPEIRQEWVDTINQILDTQRDFLNALQSPIAY 140


>gnl|CDD|241394 cd13240, PH1_Kalirin_Trio_like, Triple functional domain pleckstrin
           homology pleckstrin homology (PH) domain, repeat 1.
           RhoGEFs, Kalirin and Trio, the mammalian homologs of
           Drosophila Trio and Caenorhabditis elegans UNC-73
           regulate a novel step in secretory granule maturation.
           Their signaling modulates the extent to which regulated
           cargo enter and remain in the regulated secretory
           pathway. This allows for fine tuning of peptides
           released by a single secretory cell type with impaired
           signaling leading to pathological states. Trio plays an
           essential role in regulating the actin cytoskeleton
           during axonal guidance and branching. Kalirin and Trio
           are encoded by separate genes in mammals and by a single
           one in invertebrates. Kalirin and Trio share the same
           complex multidomain structure and display several splice
           variants. The longest Kalirin and Trio proteins have a
           Sec14 domain, a stretch of spectrin repeats, a
           RhoGEF(DH)/PH cassette (also called GEF1), an SH3
           domain, a second RhoGEF(DH)/PH cassette (also called
           GEF2), a second SH3 domain, Ig/FNIII domains, and a
           kinase domain. The first RhoGEF(DH)/PH cassette
           catalyzes exchange on Rac1 and RhoG while the second
           RhoGEF(DH)/PH cassette is specific for RhoA. Kalirin and
           Trio are closely related to p63RhoGEF and have PH
           domains of similar function. PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.not conserved
           across all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinases,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, cytoskeletal associated molecules,
           and in lipid associated enzymes.
          Length = 123

 Score = 39.2 bits (92), Expect = 1e-04
 Identities = 30/137 (21%), Positives = 58/137 (42%), Gaps = 27/137 (19%)

Query: 7   LKGFDGKITAQGKLLMRGPLYCTETSVASSSSSNSRGKELQVFLFEQSMIFSEAV----G 62
           L+GFD  + + G+++++         V        +G+E  VFLFE  ++FS+ V    G
Sbjct: 2   LEGFDESLESLGEVILQ-----DSFQVWDPKQLIRKGRERHVFLFELCLVFSKEVKDSNG 56

Query: 63  K-----KTQFSVNKMSVEEKVPEELTPAGSGGSRGGLSAYFLLKSIDPKKPALTFLCQAP 117
           K     K++   +++ V E +              G    F L +          + +A 
Sbjct: 57  KSKYIYKSKLMTSELGVTEHIE-------------GDPCKFALWTGRVPTSDNKIVLKAS 103

Query: 118 TEESRSEWLRCLGLILQ 134
           + E + EW++ L  ++Q
Sbjct: 104 SLEVKQEWVKKLREVIQ 120


>gnl|CDD|214574 smart00233, PH, Pleckstrin homology domain.  Domain commonly found
           in eukaryotic signalling proteins. The domain family
           possesses multiple functions including the abilities to
           bind inositol phosphates, and various proteins. PH
           domains have been found to possess inserted domains
           (such as in PLC gamma, syntrophins) and to be inserted
           within other domains. Mutations in Brutons tyrosine
           kinase (Btk) within its PH domain cause X-linked
           agammaglobulinaemia (XLA) in patients. Point mutations
           cluster into the positively charged end of the molecule
           around the predicted binding site for
           phosphatidylinositol lipids.
          Length = 102

 Score = 37.5 bits (87), Expect = 4e-04
 Identities = 23/116 (19%), Positives = 42/116 (36%), Gaps = 25/116 (21%)

Query: 20  LLMRGPLYCTETSVASSSSSNSRGKELQVFLFEQSMIFSEAVGKKTQ------FSVNKMS 73
           ++  G LY        S       K+    LF  ++++ ++   K          ++  +
Sbjct: 1   VIKEGWLYK------KSGGGKKSWKKRYFVLFNSTLLYYKSKKDKKSYKPKGSIDLSGCT 54

Query: 74  VEEKVPEELTPAGSGGSRGGLSAYFLLKSIDPKKPALTFLCQAPTEESRSEWLRCL 129
           V E    + +              F +K+ D K    T L QA +EE R +W+  L
Sbjct: 55  VREAPDPDSSKK---------PHCFEIKTSDRK----TLLLQAESEEEREKWVEAL 97


>gnl|CDD|241308 cd10572, PH_RhoGEF3_XPLN, Rho guanine nucleotide exchange factor 3
           Pleckstrin homology (PH) domain.  RhoGEF3/XPLN, a Rho
           family GEF, preferentially stimulates guanine nucleotide
           exchange on RhoA and RhoB, but not RhoC, RhoG, Rac1, or
           Cdc42 in vitro. It also possesses transforming activity.
           RhoGEF3/XPLN contains a tandem Dbl homology and PH
           domain, but lacks homology with other known functional
           domains or motifs. It is expressed in the brain,
           skeletal muscle, heart, kidney, platelets, and
           macrophage and neuronal cell lines. PH domains have
           diverse functions, but in general are involved in
           targeting proteins to the appropriate cellular location
           or in the interaction with a binding partner. They share
           little sequence conservation, but all have a common
           fold, which is electrostatically polarized. Less than
           10% of PH domains bind phosphoinositide phosphates
           (PIPs) with high affinity and specificity. PH domains
           are distinguished from other PIP-binding domains by
           their specific high-affinity binding to PIPs with two
           vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
           or PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 143

 Score = 36.9 bits (86), Expect = 0.001
 Identities = 31/103 (30%), Positives = 47/103 (45%), Gaps = 14/103 (13%)

Query: 40  NSRGKELQVFLFEQSMIFSEAV--GKKTQFSVNK--MSVEEKVPEELTPAG---SGGS-R 91
           N RG +L VFLFE  ++ +  V   ++  + V +  + V++ V E+L P G    GGS R
Sbjct: 38  NKRGTKLHVFLFEDVLVLTRPVTRNEQLCYQVYRQPIPVQDLVLEDL-PDGEVRLGGSFR 96

Query: 92  GGLS-----AYFLLKSIDPKKPALTFLCQAPTEESRSEWLRCL 129
           G  S       F   S        +   QA  E  + +WL C+
Sbjct: 97  GAFSNNDKAKNFFRVSFKDGSKGQSHTLQANDEFDKQQWLNCI 139


>gnl|CDD|241261 cd01227, PH_Dbs, DBL's big sister protein pleckstrin homology (PH)
           domain.  Dbs (also called MCF2-transforming
           sequence-like protein 2) is a guanine nucleotide
           exchange factor (GEF), which contains spectrin repeats,
           a rhoGEF (DH) domain and a PH domain. The Dbs PH domain
           participates in binding to both the Cdc42 and RhoA
           GTPases. PH domains have diverse functions, but in
           general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 132

 Score = 34.9 bits (80), Expect = 0.006
 Identities = 30/139 (21%), Positives = 61/139 (43%), Gaps = 21/139 (15%)

Query: 9   GFDGKITAQGKLLMRGPL--YCTETSVASSSSSNSRGKELQ--VFLFEQSMIFSEAVGKK 64
           G++G ++  GKLLM+G    +       +     +R K +Q  +FL+E++++F +   + 
Sbjct: 4   GYEGNLSDLGKLLMQGSFNVWTEHKKGHNKVKKLARFKPMQRHLFLYEKAVLFCKKREEN 63

Query: 65  TQFSVNKMSVEEKVPEELTPAGSGGSRGGLSAYFLLKSIDPKKPAL-------TFLCQAP 117
            +      S   K   +++  G   +  G          D KK  +        ++ QAP
Sbjct: 64  GEGYEKAPSYSYKNSLKMSAVGITENVKG----------DNKKFEIWYNGREEVYIIQAP 113

Query: 118 TEESRSEWLRCLGLILQTQ 136
           T E ++ W+  +  +L +Q
Sbjct: 114 TPEIKAAWVNEIRKVLTSQ 132


>gnl|CDD|215766 pfam00169, PH, PH domain.  PH stands for pleckstrin homology.
          Length = 101

 Score = 32.1 bits (73), Expect = 0.032
 Identities = 18/94 (19%), Positives = 37/94 (39%), Gaps = 8/94 (8%)

Query: 36  SSSSNSRGKELQVFLFEQSMIFSEAVGKKTQFSVNKMSVEEKVPEELTPAGSGGSRGGLS 95
            S      K+    LF+  +++ +   K +      + +      ++         G   
Sbjct: 11  GSGGRKSWKKRYFVLFDGVLLYYKDSKKSSSRPKGSIPLSGCQVTKVPD----SEDGKRK 66

Query: 96  AYFLLKSIDPKKPALTFLCQAPTEESRSEWLRCL 129
             F +++ D +    TFL QA +EE R EW++ +
Sbjct: 67  NCFEIRTGDRE----TFLLQAESEEERKEWVKAI 96


>gnl|CDD|241378 cd13224, PH_Net1, Neuroepithelial cell transforming 1 Pleckstrin
           homology (PH) domain.  Net1 (also called ArhGEF8) is
           part of the family of Rho guanine nucleotide exchange
           factors. Members of this family activate Rho proteins by
           catalyzing the exchange of GDP for GTP. The protein
           encoded by this gene interacts with RhoA within the cell
           nucleus and may play a role in repairing DNA damage
           after ionizing radiation. Net1 binds to caspase
           activation and recruitment domain (CARD)- and
           membrane-associated guanylate kinase-like
           domain-containing (CARMA) proteins and regulates nuclear
           factor kB activation. Net1 contains a RhoGEF domain
           N-terminal to a single PH domain.  PH domains have
           diverse functions, but in generally are involved in
           targeting proteins to the appropriate cellular location
           or in the interaction with a binding partner. They share
           little sequence conservation, but all have a common
           fold, which is electrostatically polarized. Less than
           10% of PH domains bind phosphoinositide phosphates
           (PIPs) with high affinity and specificity. PH domains
           are distinguished from other PIP-binding domains by
           their specific high-affinity binding to PIPs with two
           vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
           or PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 119

 Score = 31.0 bits (70), Expect = 0.095
 Identities = 28/103 (27%), Positives = 47/103 (45%), Gaps = 14/103 (13%)

Query: 40  NSRGKELQVFLFEQSMIFSEAVGKKTQ--FSVNK--MSVEEKVPEELTPAG--SGGS-RG 92
           N  G +L VFLF+  ++ +  V +  +  + V +  + V+E + E+L       GGS RG
Sbjct: 12  NKSGHKLHVFLFQDVLVLTRPVTRNERQCYQVYRQPIPVQELLLEDLQDGDVRMGGSFRG 71

Query: 93  GLS------AYFLLKSIDPKKPALTFLCQAPTEESRSEWLRCL 129
             S        F ++  DP  P  +   QA     + +WL C+
Sbjct: 72  AFSNSEKAKNIFRVRFKDP-SPGQSHTLQANDVFHKQQWLNCI 113


>gnl|CDD|241231 cd00821, PH, Pleckstrin homology (PH) domain.  PH domains have
           diverse functions, but in general are involved in
           targeting proteins to the appropriate cellular location
           or in the interaction with a binding partner. They share
           little sequence conservation, but all have a common
           fold, which is electrostatically polarized. Less than
           10% of PH domains bind phosphoinositide phosphates
           (PIPs) with high affinity and specificity. PH domains
           are distinguished from other PIP-binding domains by
           their specific high-affinity binding to PIPs with two
           vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
           or PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 92

 Score = 28.9 bits (64), Expect = 0.43
 Identities = 18/93 (19%), Positives = 35/93 (37%), Gaps = 9/93 (9%)

Query: 36  SSSSNSRGKELQVFLFEQSMIFSEAVGKKTQFSVNKMSVEEKVPEELTPAGSGGSRGGLS 95
                   K+    LF+  +++ ++    ++     + + + +  EL          G  
Sbjct: 9   GGKGLKSWKKRWFVLFDDVLLYYKSKKDSSKKPKGLIPLSDGLEVELVS------SSGKP 62

Query: 96  AYFLLKSIDPKKPALTFLCQAPTEESRSEWLRC 128
             F L + D  +   T+  QA +EE R EWL  
Sbjct: 63  NCFELVTPDRGR---TYYLQAESEEEREEWLEA 92


>gnl|CDD|234018 TIGR02799, thio_ybgC, tol-pal system-associated acyl-CoA
           thioesterase.  The tol-pal system consists of five
           critical genes. Inner membrane proteins TolQ and TolR
           convert protomotive force to energy that is transduced
           through TolA to an outer membrane complex of TolB and
           Pal. The system is known to be required to maintain
           outer membrane integrity. In a system with several
           homologous parts, ExbB and ExbD transduces energy
           through TonB to a variety of outer membrane proteins,
           many of which are siderophore receptors. The tol-pal
           system therefore may also be involved in transport. This
           family consists of a protein nearly always found in
           operons with the genes of the tol-pal system. The
           significance of this thioesterase to the tol-pal system
           is unclear, but either of two observations may be
           relevant. First, Pal, or peptidoglycan-associated
           lipoprotein, has a conserved N-terminal cleavage and
           acylation that makes it a lipoprotein. Second, the
           tol-pal system is implicated not only in the import of
           certain organics but also in the maintenance of outer
           membrane integrity (by an unknown mechanism).
          Length = 126

 Score = 28.7 bits (65), Expect = 0.75
 Identities = 8/17 (47%), Positives = 10/17 (58%)

Query: 119 EESRSEWLRCLGLILQT 135
           E +R+EWLR LG     
Sbjct: 28  ERARTEWLRALGFEQSA 44


>gnl|CDD|241396 cd13242, PH_puratrophin-1, Puratrophin-1 pleckstrin homology (PH)
          domain.  Puratrophin-1 (also called Purkinje cell
          atrophy-associated protein 1 or PLEKHG4/Pleckstrin
          homology domain-containing family G member 4) contains
          a spectrin repeat, a RhoGEF (DH) domain, and a PH
          domain. It is thought to function in intracellular
          signaling and cytoskeleton dynamics at the Golgi.
          Puratrophin-1 is expressed in kidney, Leydig cells in
          the testis, epithelial cells in the prostate gland and
          Langerhans islet in the pancreas. A single nucleotide
          substitution in the puratrophin-1 gene were once
          thought to result in autosomal dominant cerebellar
          ataxia (ADCA), but now it has been demonstrated that
          this ataxia is a result of defects in the BEAN gene.
          Puratrophin contains a domain architecture similar to
          that of Dbl family members Dbs and Trio. Dbs is a
          guanine nucleotide exchange factor (GEF), which
          contains spectrin repeats, a RhoGEF (DH) domain and a
          PH domain. The Dbs PH domain participates in binding to
          both the Cdc42 and RhoA GTPases. Trio plays an
          essential role in regulating the actin cytoskeleton
          during axonal guidance and branching. Trio is a
          multidomain signaling protein that contains two
          RhoGEF(DH)-PH domains in tandem. PH domains have
          diverse functions, but in general are involved in
          targeting proteins to the appropriate cellular location
          or in the interaction with a binding partner. They
          share little sequence conservation, but all have a
          common fold, which is electrostatically polarized. Less
          than 10% of PH domains bind phosphoinositide phosphates
          (PIPs) with high affinity and specificity. PH domains
          are distinguished from other PIP-binding domains by
          their specific high-affinity binding to PIPs with two
          vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
          or PtdIns(3,4,5)P3 which results in targeting some PH
          domain proteins to the plasma membrane. A few display
          strong specificity in lipid binding. Any specificity is
          usually determined by loop regions or insertions in the
          N-terminus of the domain, which are not conserved
          across all PH domains. PH domains are found in cellular
          signaling proteins such as serine/threonine kinase,
          tyrosine kinases, regulators of G-proteins, endocytotic
          GTPases, adaptors, as well as cytoskeletal associated
          molecules and in lipid associated enzymes.
          Length = 136

 Score = 28.8 bits (65), Expect = 0.83
 Identities = 18/60 (30%), Positives = 27/60 (45%), Gaps = 13/60 (21%)

Query: 2  MDVARLKGFDGKITAQGKLLMRGPLYCTETSVASSSSSNSRGKEL-QVFLFEQSMIFSEA 60
          MD   ++G D  +  QG+LL +      +           R K L  VFLFE  ++FS+ 
Sbjct: 13 MDA--IRGCDVNLKEQGQLLRQDEFLVWQ----------GRKKSLRHVFLFEDLILFSKP 60


>gnl|CDD|241393 cd13239, PH_Obscurin, Obscurin pleckstrin homology (PH) domain.
          Obscurin (also called Obscurin-RhoGEF; Obscurin-myosin
          light chain kinase/Obscurin-MLCK) is a giant muscle
          protein that is concentrated at the peripheries of
          Z-disks and M-lines. It binds small ankyrin I, a
          component of the sarcoplasmic reticulum (SR) membrane.
          It is associated with the contractile apparatus through
          binding with titin and sarcomeric myosin. It plays
          important roles in the organization and assembly of the
          myofibril and the SR. Obscurin has been observed as
          alternatively-spliced isoforms. The major isoform in
          sleletal muscle, approximately 800 kDa in size, is
          composed of many adhesion modules and signaling
          domains. It harbors 49 Ig and 2 FNIII repeats at the
          N-terminues, a complex middle region with additional Ig
          domains, an IQ motif, and a conserved SH3 domain near
          RhoGEF and PH domains, and a non-modular C-terminus
          with phosphorylation motifs. The obscurin gene also
          encodes two kinase domains, which are not part of the
          800 kDa form of the protein, but is part of smaller
          spliced products that present in heart muscle. PH
          domains have diverse functions, but in general are
          involved in targeting proteins to the appropriate
          cellular location or in the interaction with a binding
          partner. They share little sequence conservation, but
          all have a common fold, which is electrostatically
          polarized. Less than 10% of PH domains bind
          phosphoinositide phosphates (PIPs) with high affinity
          and specificity. PH domains are distinguished from
          other PIP-binding domains by their specific
          high-affinity binding to PIPs with two vicinal
          phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
          PtdIns(3,4,5)P3 which results in targeting some PH
          domain proteins to the plasma membrane. A few display
          strong specificity in lipid binding. Any specificity is
          usually determined by loop regions or insertions in the
          N-terminus of the domain, which are not conserved
          across all PH domains. PH domains are found in cellular
          signaling proteins such as serine/threonine kinase,
          tyrosine kinases, regulators of G-proteins, endocytotic
          GTPases, adaptors, as well as cytoskeletal associated
          molecules and in lipid associated enzymes.
          Length = 125

 Score = 28.2 bits (63), Expect = 0.98
 Identities = 12/51 (23%), Positives = 25/51 (49%), Gaps = 2/51 (3%)

Query: 7  LKGFDGKITAQGKLLMRGPLYCTETSVASSSSSNSRGKELQVFLFEQSMIF 57
          ++ + G + A G+ + +G     E   A    ++S+G    VFLF+  ++ 
Sbjct: 2  IENYPGNLEALGEPIRQGHFTVWEG--APGVRTSSKGHHRHVFLFKNCIVI 50


>gnl|CDD|241409 cd13255, PH_TAAP2-like, Tandem PH-domain-containing protein 2
           Pleckstrin homology (PH) domain.  The binding of TAPP2
           (also called PLEKHA2) adaptors to PtdIns(3,4)P(2), but
           not PI(3,4, 5)P3, function as negative regulators of
           insulin and PI3K signalling pathways (i.e.
           TAPP/utrophin/syntrophin complex). TAPP2 contains two
           sequential PH domains in which the C-terminal PH domain
           specifically binds PtdIns(3,4)P2 with high affinity. The
           N-terminal PH domain does not interact with any
           phosphoinositide tested. They also contain a C-terminal
           PDZ-binding motif that interacts with several
           PDZ-binding proteins, including PTPN13 (known previously
           as PTPL1 or FAP-1) as well as the scaffolding proteins
           MUPP1 (multiple PDZ-domain-containing protein 1),
           syntrophin and utrophin. The members here are most
           sequence similar to TAPP2 proteins, but may not be
           actual TAPP2 proteins. PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 110

 Score = 28.1 bits (63), Expect = 1.0
 Identities = 10/31 (32%), Positives = 14/31 (45%)

Query: 108 PALTFLCQAPTEESRSEWLRCLGLILQTQRD 138
           PA TF  QA ++     W+  + L  Q  R 
Sbjct: 74  PARTFYVQADSKAEMESWISAINLARQALRA 104


>gnl|CDD|241282 cd01251, PH2_ADAP, ArfGAP with dual PH domains Pleckstrin homology
           (PH) domain, repeat 2.  ADAP (also called centaurin
           alpha) is a phophatidlyinositide binding protein
           consisting of an N-terminal ArfGAP domain and two PH
           domains. In response to growth factor activation, PI3K
           phosphorylates phosphatidylinositol 4,5-bisphosphate to
           phosphatidylinositol 3,4,5-trisphosphate. Centaurin
           alpha 1 is recruited to the plasma membrane following
           growth factor stimulation by specific binding of its PH
           domain to phosphatidylinositol 3,4,5-trisphosphate.
           Centaurin alpha 2 is constitutively bound to the plasma
           membrane since it binds phosphatidylinositol
           4,5-bisphosphate and phosphatidylinositol
           3,4,5-trisphosphate with equal affinity. This cd
           contains the second PH domain repeat. PH domains have
           diverse functions, but in general are involved in
           targeting proteins to the appropriate cellular location
           or in the interaction with a binding partner. They share
           little sequence conservation, but all have a common
           fold, which is electrostatically polarized. Less than
           10% of PH domains bind phosphoinositide phosphates
           (PIPs) with high affinity and specificity. PH domains
           are distinguished from other PIP-binding domains by
           their specific high-affinity binding to PIPs with two
           vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
           or PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 105

 Score = 27.6 bits (62), Expect = 1.3
 Identities = 11/27 (40%), Positives = 16/27 (59%)

Query: 108 PALTFLCQAPTEESRSEWLRCLGLILQ 134
           P  TF+  A TEE R EW+  +  +L+
Sbjct: 78  PDRTFVLSAETEEERREWITAIQKVLE 104


>gnl|CDD|220674 pfam10282, Lactonase, Lactonase, 7-bladed beta-propeller.  This
           entry contains bacterial 6-phosphogluconolactonases
           (6PGL)YbhE-type (EC:3.1.1.31) which hydrolyse
           6-phosphogluconolactone to 6-phosphogluconate. The entry
           also contains the fungal muconate lactonising enzyme
           carboxy-cis,cis-muconate cyclase (EC:5.5.1.5) and
           muconate cycloisomerase (EC:5.5.1.1), which convert
           cis,cis-muconates to muconolactones and vice versa as
           part of the microbial beta-ketoadipate pathway.
           Structures of proteins in this family have revealed a
           7-bladed beta-propeller fold.
          Length = 344

 Score = 28.7 bits (65), Expect = 1.4
 Identities = 14/31 (45%), Positives = 16/31 (51%), Gaps = 4/31 (12%)

Query: 89  GSRGGLSAYFLLKSIDPKKPALTFLCQAPTE 119
           G  GG+SA+     IDP    LT L Q PT 
Sbjct: 58  GEDGGVSAF----RIDPDTGKLTLLNQVPTG 84


>gnl|CDD|224366 COG1449, COG1449, Alpha-amylase/alpha-mannosidase [Carbohydrate
           transport and metabolism].
          Length = 615

 Score = 28.6 bits (64), Expect = 1.5
 Identities = 13/48 (27%), Positives = 18/48 (37%), Gaps = 3/48 (6%)

Query: 112 FLCQAPTEESRSEWLRCLG---LILQTQRDFLKAIQSPIAYQKELSKD 156
            L  +  +E   E LR L     I  T+ DF +AI     +    S  
Sbjct: 118 GLPLSFWQEENVEILRRLLNEAWIPATRIDFDRAIADTNLFIPNYSLS 165


>gnl|CDD|241423 cd13269, PH_alsin, Alsin Pleckstrin homology (PH) domain.  The ALS2
           gene encodes alsin, a GEF, that has dual specificity for
           Rac1 and Rab5 GTPases. Alsin mutations in the form of
           truncated proteins are responsible for motor function
           disorders including juvenile-onset amyotrophic lateral
           sclerosis, familial juvenile primary lateral sclerosis,
           and infantile-onset ascending hereditary spastic
           paralysis. The alsin protein is widely expressed in the
           developing CNS including neurons of the cerebral cortex,
           brain stem, spinal cord, and cerebellum. Alsin contains
           a regulator of chromosome condensation 1 (RCC1) domain,
           a Rho guanine nucleotide exchanging factor (RhoGEF)
           domain, a PH domain, a Membrane Occupation and
           Recognition Nexus (MORN), a vacuolar protein sorting 9
           (Vps9) domain, and a Dbl homology (DH) domain. Alsin
           interacts with Rab5 through its Vps9 domain and through
           this interaction modulates early endosome fusion and
           trafficking. The GEF activity of alsin towards Rab5 is
           regulated by Rac1 function. The GEF activity of alsin
           for Rac1 occurs via its DH domain and this interaction
           plays a role in promoting spinal motor neuron survival
           via multiple Rac-dependent signaling pathways. PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 106

 Score = 27.0 bits (60), Expect = 2.7
 Identities = 8/22 (36%), Positives = 13/22 (59%)

Query: 108 PALTFLCQAPTEESRSEWLRCL 129
           P  +F   A T + ++EWLR +
Sbjct: 75  PEESFTLVASTPQEKAEWLRAI 96


>gnl|CDD|241404 cd13250, PH_ACAP, ArfGAP with coiled-coil, ankyrin repeat and PH
           domains Pleckstrin homology (PH) domain.  ACAP (also
           called centaurin beta) functions both as a Rab35
           effector and as an Arf6-GTPase-activating protein (GAP)
           by which it controls actin remodeling and membrane
           trafficking. ACAP contain an NH2-terminal
           bin/amphiphysin/Rvs (BAR) domain, a phospholipid-binding
           domain, a PH domain, a GAP domain, and four ankyrin
           repeats. The AZAPs constitute a family of Arf GAPs that
           are characterized by an NH2-terminal pleckstrin homology
           (PH) domain and a central Arf GAP domain followed by two
           or more ankyrin repeats. On the basis of sequence and
           domain organization, the AZAP family is further
           subdivided into four subfamilies: 1) the ACAPs contain
           an NH2-terminal bin/amphiphysin/Rvs (BAR) domain (a
           phospholipid-binding domain that is thought to sense
           membrane curvature), a single PH domain followed by the
           GAP domain, and four ankyrin repeats; 2) the ASAPs also
           contain an NH2-terminal BAR domain, the tandem PH
           domain/GAP domain, three ankyrin repeats, two
           proline-rich regions, and a COOH-terminal Src homology 3
           domain; 3) the AGAPs contain an NH2-terminal GTPase-like
           domain (GLD), a split PH domain, and the GAP domain
           followed by four ankyrin repeats; and 4) the ARAPs
           contain both an Arf GAP domain and a Rho GAP domain, as
           well as an NH2-terminal sterile-a motif (SAM), a
           proline-rich region, a GTPase-binding domain, and five
           PH domains. PMID 18003747 and 19055940 Centaurin can
           bind to phosphatidlyinositol (3,4,5)P3. PH domains have
           diverse functions, but in general are involved in
           targeting proteins to the appropriate cellular location
           or in the interaction with a binding partner. They share
           little sequence conservation, but all have a common
           fold, which is electrostatically polarized. Less than
           10% of PH domains bind phosphoinositide phosphates
           (PIPs) with high affinity and specificity. PH domains
           are distinguished from other PIP-binding domains by
           their specific high-affinity binding to PIPs with two
           vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
           or PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 98

 Score = 26.0 bits (58), Expect = 3.9
 Identities = 8/27 (29%), Positives = 16/27 (59%), Gaps = 3/27 (11%)

Query: 103 IDPKKPALTFLCQAPTEESRSEWLRCL 129
           + P K   +++ QA +EE R  W++ +
Sbjct: 66  VSPTK---SYMLQAESEEDRQAWIQAI 89


>gnl|CDD|241414 cd13260, PH_RASA1, RAS p21 protein activator (GTPase activating
           protein) 1 Pleckstrin homology (PH) domain.  RASA1 (also
           called RasGap1 or p120) is a member of the RasGAP family
           of GTPase-activating proteins. RASA1 contains N-terminal
           SH2-SH3-SH2 domains, followed by two C2 domains, a PH
           domain, a RasGAP domain, and a BTK domain. Splice
           variants lack the N-terminal domains. It is a cytosolic
           vertebrate protein that acts as a suppressor of RAS via
           its C-terminal GAP domain function, enhancing the weak
           intrinsic GTPase activity of RAS proteins resulting in
           the inactive GDP-bound form of RAS, allowing control of
           cellular proliferation and differentiation.
           Additionally, it is involved in mitogenic signal
           transmission towards downstream interacting partners
           through its N-terminal SH2-SH3-SH2 domains. RASA1
           interacts with a number of proteins including: G3BP1,
           SOCS3, ANXA6, Huntingtin, KHDRBS1, Src, EPHB3, EPH
           receptor B2, Insulin-like growth factor 1 receptor,
           PTK2B, DOK1, PDGFRB, HCK, Caveolin 2, DNAJA3, HRAS,
           GNB2L1 and NCK1. PH domains have diverse functions, but
           in general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 103

 Score = 26.1 bits (58), Expect = 4.1
 Identities = 7/19 (36%), Positives = 11/19 (57%), Gaps = 1/19 (5%)

Query: 111 TFLCQAPTEESRSEWLRCL 129
            +LC A T E   +W++ L
Sbjct: 82  YYLC-ADTAELAQDWMKAL 99


>gnl|CDD|227434 COG5103, CDC39, Cell division control protein, negative regulator of
            transcription [Cell division and chromosome partitioning
            / Transcription].
          Length = 2005

 Score = 26.9 bits (59), Expect = 7.1
 Identities = 12/53 (22%), Positives = 20/53 (37%), Gaps = 3/53 (5%)

Query: 14   ITAQGKLLMRGPLYCTETSVASSSSSNSRGKELQVFLFEQSMIFSEAVGKKTQ 66
            +TA+  +       CT   +A SS    +    +      +M+   A G K Q
Sbjct: 1443 VTAEVPICTVYDFICTLEMLAGSSDPKVKDFFQK---ISNTMMHIVAKGNKQQ 1492


>gnl|CDD|241296 cd01265, PH_TBC1D2A, TBC1 domain family member 2A pleckstrin
           homology (PH) domain.  TBC1D2A (also called
           PARIS-1/Prostate antigen recognized and identified by
           SEREX 1 and ARMUS) contains a PH domain and a TBC-type
           GTPase catalytic domain. TBC1D2A integrates signaling
           between Arf6, Rac1, and Rab7 during junction
           disassembly. Activated Rac1 recruits TBC1D2A to locally
           inactivate Rab7 via its C-terminal TBC/RabGAP domain and
           facilitate E-cadherin degradation in lysosomes. The
           TBC1D2A PH domain mediates localization at cell-cell
           contacts and coprecipitates with cadherin complexes. PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 101

 Score = 25.3 bits (56), Expect = 8.1
 Identities = 7/31 (22%), Positives = 15/31 (48%), Gaps = 4/31 (12%)

Query: 108 PALTFLCQAPTEESRSEWLRCLGLILQTQRD 138
           P   ++ +A   ++   WL+     LQ++R 
Sbjct: 70  PGRVYILKASDRQAMLYWLQ----ELQSKRR 96


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.315    0.130    0.363 

Gapped
Lambda     K      H
   0.267   0.0618    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 7,506,080
Number of extensions: 630385
Number of successful extensions: 512
Number of sequences better than 10.0: 1
Number of HSP's gapped: 504
Number of HSP's successfully gapped: 26
Length of query: 157
Length of database: 10,937,602
Length adjustment: 89
Effective length of query: 68
Effective length of database: 6,990,096
Effective search space: 475326528
Effective search space used: 475326528
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 55 (25.2 bits)