BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy11109
         (93 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2V1U|A Chain A, Structure Of The Aeropyrum Pernix Orc1 Protein In Complex
           With Dna
          Length = 387

 Score = 27.7 bits (60), Expect = 1.8,   Method: Composition-based stats.
 Identities = 20/71 (28%), Positives = 33/71 (46%), Gaps = 16/71 (22%)

Query: 17  LGNPIWVDLLGIAVGHMYYFIEDVFPNLRGG-------FRLLQTPRILKVL-------FD 62
           LG+ +WV L+GI   +   F+E++ P ++         F     P++  +L       F+
Sbjct: 162 LGDRVWVSLVGIT--NSLGFVENLEPRVKSSLGEVELVFPPYTAPQLRDILETRAEEAFN 219

Query: 63  PHPEDPDYSPL 73
           P   DPD  PL
Sbjct: 220 PGVLDPDVVPL 230


>pdb|2V36|A Chain A, Crystal Structure Of Gamma-Glutamyl Transferase From
           Bacillus Subtilis
 pdb|2V36|C Chain C, Crystal Structure Of Gamma-Glutamyl Transferase From
           Bacillus Subtilis
          Length = 376

 Score = 26.2 bits (56), Expect = 4.5,   Method: Composition-based stats.
 Identities = 17/43 (39%), Positives = 19/43 (44%), Gaps = 7/43 (16%)

Query: 15  ILLGNPIWVDLLGIAVGHMYYFIEDVFPNLRGGFRLLQTPRIL 57
           I +  PIW D  G       Y I    P   GG  LLQ P+IL
Sbjct: 244 ITIDEPIWGDYQG-------YQIATTPPPSSGGIFLLQMPKIL 279


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.324    0.152    0.522 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,679,031
Number of Sequences: 62578
Number of extensions: 155548
Number of successful extensions: 280
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 280
Number of HSP's gapped (non-prelim): 2
length of query: 93
length of database: 14,973,337
effective HSP length: 60
effective length of query: 33
effective length of database: 11,218,657
effective search space: 370215681
effective search space used: 370215681
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 45 (21.9 bits)