Query         psy11111
Match_columns 84
No_of_seqs    109 out of 199
Neff          3.3 
Searched_HMMs 46136
Date          Fri Aug 16 18:13:09 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy11111.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/11111hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3399|consensus               99.3 1.3E-12 2.8E-17   92.4   1.9   37   48-84      1-37  (122)
  2 PRK02935 hypothetical protein;  70.4     3.5 7.6E-05   29.2   2.0   25   60-84     84-108 (110)
  3 PF11023 DUF2614:  Protein of u  62.4     3.5 7.5E-05   29.3   0.7   24   61-84     84-107 (114)
  4 PF13465 zf-H2C2_2:  Zinc-finge  54.7     7.3 0.00016   19.9   1.0   13   59-71     11-23  (26)
  5 PF04236 Transp_Tc5_C:  Tc5 tra  51.8      13 0.00028   23.5   2.0   47   13-81     13-59  (63)
  6 PF06462 Hyd_WA:  Propeller;  I  45.6      16 0.00035   19.8   1.5   16    9-24      1-16  (32)
  7 PF13912 zf-C2H2_6:  C2H2-type   43.7     4.4 9.6E-05   20.1  -0.9   18   62-79      1-18  (27)
  8 PF00096 zf-C2H2:  Zinc finger,  43.0     5.4 0.00012   19.1  -0.6   17   63-79      1-17  (23)
  9 PRK04860 hypothetical protein;  41.9      13 0.00029   26.9   1.0   20   59-78    140-159 (160)
 10 PF03691 UPF0167:  Uncharacteri  41.1      13 0.00028   27.6   0.8   25   52-76    146-174 (176)
 11 TIGR00319 desulf_FeS4 desulfof  40.0      19  0.0004   19.4   1.2   13   61-73      6-18  (34)
 12 PF12572 DUF3752:  Protein of u  40.0     8.5 0.00018   26.9  -0.3   18    7-25     30-47  (152)
 13 KOG0856|consensus               38.9      18  0.0004   26.7   1.3   15   60-74     52-66  (146)
 14 KOG2462|consensus               38.8      10 0.00022   30.5  -0.0   21   59-79    212-232 (279)
 15 cd00974 DSRD Desulforedoxin (D  38.1      21 0.00045   19.2   1.2   13   61-73      3-15  (34)
 16 PRK11586 napB nitrate reductas  37.7      26 0.00056   26.0   1.9   34   48-84    109-142 (149)
 17 PF10955 DUF2757:  Protein of u  35.7      16 0.00035   24.1   0.6   15   62-76      4-18  (76)
 18 PF06397 Desulfoferrod_N:  Desu  35.3      21 0.00045   20.5   0.9   13   60-72      4-16  (36)
 19 PF03811 Zn_Tnp_IS1:  InsA N-te  35.3      26 0.00057   19.8   1.3   12   58-69     25-36  (36)
 20 PF13842 Tnp_zf-ribbon_2:  DDE_  34.8      26 0.00056   19.2   1.2   14   61-74     15-28  (32)
 21 PF06524 NOA36:  NOA36 protein;  34.2      23  0.0005   28.9   1.3   20   59-78    139-158 (314)
 22 PRK05508 methionine sulfoxide   33.4      25 0.00054   24.9   1.2   17   60-76     31-47  (119)
 23 smart00132 LIM Zinc-binding do  33.0      18 0.00039   18.3   0.4   13   61-73     26-38  (39)
 24 cd08585 GDPD_like_3 Glyceropho  33.0      14  0.0003   27.2  -0.1   11   10-20    213-223 (237)
 25 TIGR00357 methionine-R-sulfoxi  32.9      25 0.00054   25.3   1.2   17   60-76     38-54  (134)
 26 PRK05978 hypothetical protein;  30.9      22 0.00048   25.8   0.7   26   48-76     41-66  (148)
 27 cd08573 GDPD_GDE1 Glycerophosp  30.6      16 0.00034   27.2  -0.1   12   10-21    232-243 (258)
 28 PRK00222 methionine sulfoxide   30.6      26 0.00057   25.4   1.0   17   60-76     41-57  (142)
 29 PF04828 GFA:  Glutathione-depe  30.2      26 0.00057   20.8   0.8   15   60-74     46-60  (92)
 30 PF01641 SelR:  SelR domain;  I  29.6      23  0.0005   25.0   0.6   15   60-74     35-49  (124)
 31 cd08581 GDPD_like_1 Glyceropho  29.1      18 0.00039   26.3  -0.0   11   10-20    203-213 (229)
 32 PRK15272 pertussis toxin-like   29.0      29 0.00062   27.5   1.0   12    5-16     16-27  (242)
 33 PRK08270 anaerobic ribonucleos  28.9      37 0.00081   29.5   1.8   16   11-26    619-634 (656)
 34 COG1861 SpsF Spore coat polysa  28.7      18 0.00038   28.7  -0.2   12   10-21    187-198 (241)
 35 PRK00398 rpoP DNA-directed RNA  27.6      32 0.00069   19.5   0.8   15   62-76      3-17  (46)
 36 cd08583 PI-PLCc_GDPD_SF_unchar  26.3      21 0.00045   25.7  -0.1   12   10-21    209-220 (237)
 37 PF13894 zf-C2H2_4:  C2H2-type   25.7      17 0.00038   16.5  -0.4   16   63-78      1-16  (24)
 38 cd08580 GDPD_Rv2277c_like Glyc  24.6      27 0.00059   26.5   0.2   11   10-20    234-244 (263)
 39 cd08565 GDPD_pAtGDE_like Glyce  24.2      23  0.0005   25.9  -0.2   11   10-20    205-215 (235)
 40 PF03892 NapB:  Nitrate reducta  23.7      28  0.0006   25.0   0.1   25   60-84    107-131 (133)
 41 cd08574 GDPD_GDE_2_3_6 Glycero  23.6      23 0.00051   26.1  -0.3   12   10-21    227-238 (252)
 42 cd08608 GDPD_GDE2 Glycerophosp  23.3      26 0.00057   28.1  -0.1   11   10-20    227-237 (351)
 43 COG5349 Uncharacterized protei  23.3      35 0.00077   24.7   0.6   26   48-76     29-54  (126)
 44 COG3043 NapB Nitrate reductase  23.2      58  0.0012   24.3   1.7   26   59-84    123-148 (155)
 45 cd08575 GDPD_GDE4_like Glycero  22.9      31 0.00068   25.6   0.2   11   10-20    235-245 (264)
 46 cd08612 GDPD_GDE4 Glycerophosp  22.8      27 0.00058   26.5  -0.1   11   10-20    265-275 (300)
 47 PRK14704 anaerobic ribonucleos  22.1      51  0.0011   28.6   1.4   16   11-26    552-567 (618)
 48 PF00412 LIM:  LIM domain;  Int  22.0      41 0.00089   18.8   0.6   16   61-76     25-40  (58)
 49 PF13717 zinc_ribbon_4:  zinc-r  21.8      43 0.00093   18.6   0.6   18   63-80      3-20  (36)
 50 TIGR01053 LSD1 zinc finger dom  21.4      56  0.0012   17.9   1.0   18   53-71     11-28  (31)
 51 TIGR03552 F420_cofC 2-phospho-  21.2      27 0.00058   24.0  -0.4   10   12-21    175-184 (195)
 52 TIGR02487 NrdD anaerobic ribon  21.0      68  0.0015   27.3   1.9   17   10-26    516-532 (579)
 53 PF06353 DUF1062:  Protein of u  20.8      52  0.0011   23.6   1.0    9   62-70     13-21  (142)
 54 cd08568 GDPD_TmGDE_like Glycer  20.8      29 0.00063   24.8  -0.3   11   10-20    198-208 (226)
 55 cd08610 GDPD_GDE6 Glycerophosp  20.7      29 0.00062   27.3  -0.3   11   10-20    249-259 (316)
 56 COG1996 RPC10 DNA-directed RNA  20.4      53  0.0011   20.1   0.9   13   60-72      4-16  (49)
 57 KOG1074|consensus               20.2      48   0.001   30.8   0.9   26   51-78    624-649 (958)
 58 PF07503 zf-HYPF:  HypF finger;  20.1      60  0.0013   18.2   1.0   14   62-75     21-34  (35)
 59 PF04777 Evr1_Alr:  Erv1 / Alr   20.1     3.8 8.2E-05   26.1  -4.5   20   51-73     28-47  (95)

No 1  
>KOG3399|consensus
Probab=99.28  E-value=1.3e-12  Score=92.44  Aligned_cols=37  Identities=57%  Similarity=0.942  Sum_probs=34.6

Q ss_pred             hhhhhhhhcCCCCceEEcccCCCCCCCCCccccCCCC
Q psy11111         48 MVKTFQAYLPNCHRTYSCVHCRAHLASHDELISKIPR   84 (84)
Q Consensus        48 MGRlF~~YL~~g~riYsC~~C~tHLA~~ddLISKsFq   84 (84)
                      |||+|..+|++.+|.|+|++|+||||+++|||||+||
T Consensus         1 mgR~F~~~l~~~~~~y~C~~C~thla~~~dliSksf~   37 (122)
T KOG3399|consen    1 MGRLFEAMLEANHRLYSCAHCKTHLARHDDLISKSFR   37 (122)
T ss_pred             CcchHHHHhccCCceEeccCCcccccchhhccccccc
Confidence            8999999996555899999999999999999999997


No 2  
>PRK02935 hypothetical protein; Provisional
Probab=70.37  E-value=3.5  Score=29.18  Aligned_cols=25  Identities=28%  Similarity=0.429  Sum_probs=22.3

Q ss_pred             CceEEcccCCCCCCCCCccccCCCC
Q psy11111         60 HRTYSCVHCRAHLASHDELISKIPR   84 (84)
Q Consensus        60 ~riYsC~~C~tHLA~~ddLISKsFq   84 (84)
                      +|+..|-+|+++|+...++--|.|.
T Consensus        84 GrvD~CM~C~~PLTLd~~legkefd  108 (110)
T PRK02935         84 GRVDACMHCNQPLTLDRSLEGKEFD  108 (110)
T ss_pred             cceeecCcCCCcCCcCccccccCcC
Confidence            3789999999999999999888873


No 3  
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=62.44  E-value=3.5  Score=29.30  Aligned_cols=24  Identities=29%  Similarity=0.497  Sum_probs=21.3

Q ss_pred             ceEEcccCCCCCCCCCccccCCCC
Q psy11111         61 RTYSCVHCRAHLASHDELISKIPR   84 (84)
Q Consensus        61 riYsC~~C~tHLA~~ddLISKsFq   84 (84)
                      |...|-+|+++|....++-=|.|.
T Consensus        84 r~D~CM~C~~pLTLd~~legkef~  107 (114)
T PF11023_consen   84 RVDACMHCKEPLTLDPSLEGKEFD  107 (114)
T ss_pred             hhhccCcCCCcCccCchhhcchhh
Confidence            678999999999999999888773


No 4  
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=54.74  E-value=7.3  Score=19.94  Aligned_cols=13  Identities=23%  Similarity=0.680  Sum_probs=10.7

Q ss_pred             CCceEEcccCCCC
Q psy11111         59 CHRTYSCVHCRAH   71 (84)
Q Consensus        59 g~riYsC~~C~tH   71 (84)
                      +.+.|.|..|+.-
T Consensus        11 ~~k~~~C~~C~k~   23 (26)
T PF13465_consen   11 GEKPYKCPYCGKS   23 (26)
T ss_dssp             SSSSEEESSSSEE
T ss_pred             CCCCCCCCCCcCe
Confidence            5689999999853


No 5  
>PF04236 Transp_Tc5_C:  Tc5 transposase C-terminal domain;  InterPro: IPR007350 This domain corresponds to a C-terminal cysteine rich region that probably binds to a metal ion and could be DNA-binding. It is found in association with the DDE superfamily (IPR004875 from INTERPRO) and the Tc5 transposase family (IPR004906 from INTERPRO). More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=51.82  E-value=13  Score=23.46  Aligned_cols=47  Identities=21%  Similarity=0.458  Sum_probs=30.7

Q ss_pred             eecCCccceecccccccccccccCCCCCCccccchhhhhhhhhcCCCCceEEcccCCCCCCCCCccccC
Q psy11111         13 TVDTPQDYCWRHSSIGTAYASLLSPYGGTQQLSNIMVKTFQAYLPNCHRTYSCVHCRAHLASHDELISK   81 (84)
Q Consensus        13 ~~~~~~~~~~~~~~~~~~~~s~~~~~~~~s~~~~~MGRlF~~YL~~g~riYsC~~C~tHLA~~ddLISK   81 (84)
                      ..+||-|+|.+....+.-...-+                      +......|..|+.+|-...=||++
T Consensus        13 ~f~tP~~~cF~~~~~~~C~~~gC----------------------~~~s~I~C~~Ckk~~Cf~Hfiv~~   59 (63)
T PF04236_consen   13 PFETPVDFCFPKNVAGDCDITGC----------------------NNTSFIRCAYCKKSLCFNHFIVSE   59 (63)
T ss_pred             CCCCHHHHhCCCCCcCcCCCCCC----------------------CCcCEEEccccCCcccccceeeee
Confidence            36799999986544443333333                      122468999999999877766643


No 6  
>PF06462 Hyd_WA:  Propeller;  InterPro: IPR006624  Tectonins I and II are two dominant proteins in the nuclei and nuclear matrix from plasmodia of Physarum polycephalum (Slime mold) which encode 217 and 353 amino acids, respectively. Tectonin I is homologous to the C-terminal two-thirds of tectonin II. Both proteins contain six tandem repeats that are each 33-37 amino acids in length and define a new consensus sequence. Homologous repeats are found in L-6, a bacterial lipopolysaccharide-binding lectin from horseshoe crab hemocytes. The repetitive sequences of the tectonins and L-6 are reminiscent of the WD repeats of the beta-subunit of G proteins, suggesting that they form beta-propeller domains. The tectonins may be lectins that function as part of a transmembrane signalling complex during phagocytosis [].
Probab=45.62  E-value=16  Score=19.81  Aligned_cols=16  Identities=31%  Similarity=0.692  Sum_probs=14.2

Q ss_pred             eeeeeecCCccceecc
Q psy11111          9 DSVWTVDTPQDYCWRH   24 (84)
Q Consensus         9 ~~~~~~~~~~~~~~~~   24 (84)
                      |.||.|+.--..+.|.
T Consensus         1 ~~VWav~~~G~v~~R~   16 (32)
T PF06462_consen    1 DQVWAVTSDGSVYFRT   16 (32)
T ss_pred             CeEEEEcCCCCEEEEC
Confidence            6899999988888886


No 7  
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=43.69  E-value=4.4  Score=20.12  Aligned_cols=18  Identities=22%  Similarity=0.551  Sum_probs=14.0

Q ss_pred             eEEcccCCCCCCCCCccc
Q psy11111         62 TYSCVHCRAHLASHDELI   79 (84)
Q Consensus        62 iYsC~~C~tHLA~~ddLI   79 (84)
                      +|.|..|+.-+.+.+.|+
T Consensus         1 ~~~C~~C~~~F~~~~~l~   18 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALR   18 (27)
T ss_dssp             SEEETTTTEEESSHHHHH
T ss_pred             CCCCCccCCccCChhHHH
Confidence            589999998877766554


No 8  
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=43.03  E-value=5.4  Score=19.07  Aligned_cols=17  Identities=29%  Similarity=0.677  Sum_probs=13.5

Q ss_pred             EEcccCCCCCCCCCccc
Q psy11111         63 YSCVHCRAHLASHDELI   79 (84)
Q Consensus        63 YsC~~C~tHLA~~ddLI   79 (84)
                      |.|..|+.-+....+|.
T Consensus         1 y~C~~C~~~f~~~~~l~   17 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLK   17 (23)
T ss_dssp             EEETTTTEEESSHHHHH
T ss_pred             CCCCCCCCccCCHHHHH
Confidence            78999998888776654


No 9  
>PRK04860 hypothetical protein; Provisional
Probab=41.85  E-value=13  Score=26.86  Aligned_cols=20  Identities=25%  Similarity=0.496  Sum_probs=14.8

Q ss_pred             CCceEEcccCCCCCCCCCcc
Q psy11111         59 CHRTYSCVHCRAHLASHDEL   78 (84)
Q Consensus        59 g~riYsC~~C~tHLA~~ddL   78 (84)
                      +.+.|.|..|+-.|...+++
T Consensus       140 g~~~YrC~~C~~~l~~~~~~  159 (160)
T PRK04860        140 GEAVYRCRRCGETLVFKGEQ  159 (160)
T ss_pred             CCccEECCCCCceeEEeccc
Confidence            45678888888888766654


No 10 
>PF03691 UPF0167:  Uncharacterised protein family (UPF0167);  InterPro: IPR005363 The proteins in this family are about 200 amino acids long and each contain 3 CXXC motifs.
Probab=41.12  E-value=13  Score=27.65  Aligned_cols=25  Identities=28%  Similarity=0.630  Sum_probs=17.0

Q ss_pred             hhhhcCCCCc----eEEcccCCCCCCCCC
Q psy11111         52 FQAYLPNCHR----TYSCVHCRAHLASHD   76 (84)
Q Consensus        52 F~~YL~~g~r----iYsC~~C~tHLA~~d   76 (84)
                      ++++|.+++.    .|.|.+|+.|+...|
T Consensus       146 l~~~l~~~G~~~gYlFrClhCgk~~l~~D  174 (176)
T PF03691_consen  146 LEEYLVKGGDMQGYLFRCLHCGKHRLYVD  174 (176)
T ss_pred             HHHHhcCCCceEEEEEEcCcCCcEEEEee
Confidence            4566644432    599999999976543


No 11 
>TIGR00319 desulf_FeS4 desulfoferrodoxin FeS4 iron-binding domain. Neelaredoxin, a monomeric blue non-heme iron protein, lacks this domain.
Probab=40.03  E-value=19  Score=19.39  Aligned_cols=13  Identities=23%  Similarity=0.687  Sum_probs=10.8

Q ss_pred             ceEEcccCCCCCC
Q psy11111         61 RTYSCVHCRAHLA   73 (84)
Q Consensus        61 riYsC~~C~tHLA   73 (84)
                      ++|.|..|++-+.
T Consensus         6 ~~ykC~~Cgniv~   18 (34)
T TIGR00319         6 QVYKCEVCGNIVE   18 (34)
T ss_pred             cEEEcCCCCcEEE
Confidence            6999999998653


No 12 
>PF12572 DUF3752:  Protein of unknown function (DUF3752);  InterPro: IPR022226  This domain family is found in eukaryotes, and is typically between 140 and 163 amino acids in length. 
Probab=40.00  E-value=8.5  Score=26.95  Aligned_cols=18  Identities=33%  Similarity=0.579  Sum_probs=13.7

Q ss_pred             cceeeeeecCCccceeccc
Q psy11111          7 AVDSVWTVDTPQDYCWRHS   25 (84)
Q Consensus         7 ~~~~~~~~~~~~~~~~~~~   25 (84)
                      +++|+|| |||++-=-|-.
T Consensus        30 ~d~S~WT-eTP~ek~~Rl~   47 (152)
T PF12572_consen   30 GDRSSWT-ETPEEKAKRLA   47 (152)
T ss_pred             CCccccc-cCHHHHHHhhh
Confidence            4899998 89998655543


No 13 
>KOG0856|consensus
Probab=38.89  E-value=18  Score=26.70  Aligned_cols=15  Identities=27%  Similarity=0.629  Sum_probs=12.7

Q ss_pred             CceEEcccCCCCCCC
Q psy11111         60 HRTYSCVHCRAHLAS   74 (84)
Q Consensus        60 ~riYsC~~C~tHLA~   74 (84)
                      +-||.|+.|+++|=.
T Consensus        52 ~GvY~C~~C~~pLyk   66 (146)
T KOG0856|consen   52 EGVYVCAGCGTPLYK   66 (146)
T ss_pred             CceEEEeecCCcccc
Confidence            469999999999854


No 14 
>KOG2462|consensus
Probab=38.83  E-value=10  Score=30.48  Aligned_cols=21  Identities=29%  Similarity=0.667  Sum_probs=17.7

Q ss_pred             CCceEEcccCCCCCCCCCccc
Q psy11111         59 CHRTYSCVHCRAHLASHDELI   79 (84)
Q Consensus        59 g~riYsC~~C~tHLA~~ddLI   79 (84)
                      |+++|+|.+|+.-+|....|-
T Consensus       212 GEKPF~C~hC~kAFADRSNLR  232 (279)
T KOG2462|consen  212 GEKPFSCPHCGKAFADRSNLR  232 (279)
T ss_pred             CCCCccCCcccchhcchHHHH
Confidence            568999999999998877664


No 15 
>cd00974 DSRD Desulforedoxin (DSRD) domain; a small non-heme iron domain present in the desulforedoxin (rubredoxin oxidoreductase) and desulfoferrodoxin proteins of some archeael and bacterial methanogens and sulfate/sulfur reducers. Desulforedoxin is a small, single-domain homodimeric protein; each subunit contains an iron atom bound to four cysteinyl sulfur atoms, Fe(S-Cys)4, in a distorted tetrahedral coordination. Its metal center is similar to that found in rubredoxin type proteins. Desulforedoxin is regarded as a potential redox partner for rubredoxin. Desulfoferrodoxin forms a homodimeric protein, with each protomer comprised of two domains, the N-terminal DSRD domain and C-terminal superoxide reductase-like (SORL) domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].
Probab=38.07  E-value=21  Score=19.25  Aligned_cols=13  Identities=23%  Similarity=0.654  Sum_probs=10.7

Q ss_pred             ceEEcccCCCCCC
Q psy11111         61 RTYSCVHCRAHLA   73 (84)
Q Consensus        61 riYsC~~C~tHLA   73 (84)
                      .+|.|..|++-+.
T Consensus         3 ~~ykC~~CGniv~   15 (34)
T cd00974           3 EVYKCEICGNIVE   15 (34)
T ss_pred             cEEEcCCCCcEEE
Confidence            6899999998653


No 16 
>PRK11586 napB nitrate reductase cytochrome C550 subunit; Provisional
Probab=37.65  E-value=26  Score=25.96  Aligned_cols=34  Identities=21%  Similarity=0.300  Sum_probs=26.8

Q ss_pred             hhhhhhhhcCCCCceEEcccCCCCCCCCCccccCCCC
Q psy11111         48 MVKTFQAYLPNCHRTYSCVHCRAHLASHDELISKIPR   84 (84)
Q Consensus        48 MGRlF~~YL~~g~riYsC~~C~tHLA~~ddLISKsFq   84 (84)
                      -|+.. ..+  .+|.|-|..|+++=++..-|+--.|+
T Consensus       109 ~Gk~l-~~v--sprRYfCtQCHVPQada~PLV~N~F~  142 (149)
T PRK11586        109 DGKVG-AEV--APRRYFCLQCHVPQADTAPIVGNTFT  142 (149)
T ss_pred             CCCCc-ccc--CccceeeccccCccccCccCCCCCcc
Confidence            34443 445  35899999999999999999988885


No 17 
>PF10955 DUF2757:  Protein of unknown function (DUF2757);  InterPro: IPR020115 This entry contains proteins with no known function.
Probab=35.75  E-value=16  Score=24.09  Aligned_cols=15  Identities=33%  Similarity=0.891  Sum_probs=12.3

Q ss_pred             eEEcccCCCCCCCCC
Q psy11111         62 TYSCVHCRAHLASHD   76 (84)
Q Consensus        62 iYsC~~C~tHLA~~d   76 (84)
                      .|.|++|++-++.-+
T Consensus         4 ~Y~CRHCg~~IG~i~   18 (76)
T PF10955_consen    4 HYYCRHCGTKIGTID   18 (76)
T ss_pred             EEEecCCCCEEEEee
Confidence            599999999887654


No 18 
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=35.33  E-value=21  Score=20.53  Aligned_cols=13  Identities=31%  Similarity=0.772  Sum_probs=7.8

Q ss_pred             CceEEcccCCCCC
Q psy11111         60 HRTYSCVHCRAHL   72 (84)
Q Consensus        60 ~riYsC~~C~tHL   72 (84)
                      ..+|.|..|++-+
T Consensus         4 ~~~YkC~~CGniV   16 (36)
T PF06397_consen    4 GEFYKCEHCGNIV   16 (36)
T ss_dssp             TEEEE-TTT--EE
T ss_pred             ccEEEccCCCCEE
Confidence            3799999998744


No 19 
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=35.28  E-value=26  Score=19.80  Aligned_cols=12  Identities=42%  Similarity=1.115  Sum_probs=9.8

Q ss_pred             CCCceEEcccCC
Q psy11111         58 NCHRTYSCVHCR   69 (84)
Q Consensus        58 ~g~riYsC~~C~   69 (84)
                      .|...|.|+.|+
T Consensus        25 ~G~qryrC~~C~   36 (36)
T PF03811_consen   25 SGHQRYRCKDCR   36 (36)
T ss_pred             CCCEeEecCcCC
Confidence            466889999996


No 20 
>PF13842 Tnp_zf-ribbon_2:  DDE_Tnp_1-like zinc-ribbon
Probab=34.83  E-value=26  Score=19.17  Aligned_cols=14  Identities=29%  Similarity=0.733  Sum_probs=11.3

Q ss_pred             ceEEcccCCCCCCC
Q psy11111         61 RTYSCVHCRAHLAS   74 (84)
Q Consensus        61 riYsC~~C~tHLA~   74 (84)
                      -.|.|..|+.+|-.
T Consensus        15 T~~~C~~C~v~lC~   28 (32)
T PF13842_consen   15 TRYMCSKCDVPLCV   28 (32)
T ss_pred             eEEEccCCCCcccC
Confidence            36999999988754


No 21 
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=34.23  E-value=23  Score=28.91  Aligned_cols=20  Identities=25%  Similarity=0.677  Sum_probs=17.1

Q ss_pred             CCceEEcccCCCCCCCCCcc
Q psy11111         59 CHRTYSCVHCRAHLASHDEL   78 (84)
Q Consensus        59 g~riYsC~~C~tHLA~~ddL   78 (84)
                      |+|||.|..|...|--.|+.
T Consensus       139 GGrif~CsfC~~flCEDDQF  158 (314)
T PF06524_consen  139 GGRIFKCSFCDNFLCEDDQF  158 (314)
T ss_pred             CCeEEEeecCCCeeeccchh
Confidence            67999999999999877764


No 22 
>PRK05508 methionine sulfoxide reductase B; Provisional
Probab=33.37  E-value=25  Score=24.94  Aligned_cols=17  Identities=35%  Similarity=0.702  Sum_probs=13.7

Q ss_pred             CceEEcccCCCCCCCCC
Q psy11111         60 HRTYSCVHCRAHLASHD   76 (84)
Q Consensus        60 ~riYsC~~C~tHLA~~d   76 (84)
                      .-+|.|+.|+++|=..+
T Consensus        31 ~G~Y~C~~Cg~pLF~S~   47 (119)
T PRK05508         31 KGTYVCKQCGAPLYRSE   47 (119)
T ss_pred             CeEEEecCCCCcccccc
Confidence            46999999999985544


No 23 
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=33.03  E-value=18  Score=18.31  Aligned_cols=13  Identities=23%  Similarity=0.762  Sum_probs=10.8

Q ss_pred             ceEEcccCCCCCC
Q psy11111         61 RTYSCVHCRAHLA   73 (84)
Q Consensus        61 riYsC~~C~tHLA   73 (84)
                      .-|.|..|+..|+
T Consensus        26 ~Cf~C~~C~~~L~   38 (39)
T smart00132       26 ECFKCSKCGKPLG   38 (39)
T ss_pred             cCCCCcccCCcCc
Confidence            4589999999886


No 24 
>cd08585 GDPD_like_3 Glycerophosphodiester phosphodiesterase domain of uncharacterized bacterial glycerophosphodiester phosphodiesterases. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in a group of uncharacterized bacterial glycerophosphodiester phosphodiesterase and similar proteins. They show high sequence similarity with Escherichia coli glycerophosphodiester phosphodiesterase, which catalyzes the degradation of glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols.
Probab=32.98  E-value=14  Score=27.20  Aligned_cols=11  Identities=55%  Similarity=0.881  Sum_probs=8.9

Q ss_pred             eeeeecCCccc
Q psy11111         10 SVWTVDTPQDY   20 (84)
Q Consensus        10 ~~~~~~~~~~~   20 (84)
                      .|||||+|++.
T Consensus       213 ~vWTVnd~~~~  223 (237)
T cd08585         213 IVWTVRTEEDI  223 (237)
T ss_pred             EEEeCCCHHHH
Confidence            48999999864


No 25 
>TIGR00357 methionine-R-sulfoxide reductase. This model describes a domain found in PilB, a protein important for pilin expression, N-terminal to a domain coextensive to with the known peptide methionine sulfoxide reductase (MsrA), a protein repair enzyme, of E. coli. Among the early completed genomes, this module is found if and only if MsrA is also found, whether N-terminal to MsrA (as for Helicobacter pylori), C-terminal (as for Treponema pallidum), or in a separate polypeptide. Although the function of this region is not clear, an auxiliary function to MsrA is suggested.
Probab=32.91  E-value=25  Score=25.28  Aligned_cols=17  Identities=24%  Similarity=0.413  Sum_probs=13.7

Q ss_pred             CceEEcccCCCCCCCCC
Q psy11111         60 HRTYSCVHCRAHLASHD   76 (84)
Q Consensus        60 ~riYsC~~C~tHLA~~d   76 (84)
                      .-+|.|+.|+++|=..+
T Consensus        38 ~G~Y~C~~Cg~pLF~S~   54 (134)
T TIGR00357        38 EGIYVDITCGEPLFSSE   54 (134)
T ss_pred             CeEEEccCCCCcccccc
Confidence            45899999999986544


No 26 
>PRK05978 hypothetical protein; Provisional
Probab=30.93  E-value=22  Score=25.76  Aligned_cols=26  Identities=27%  Similarity=0.538  Sum_probs=20.6

Q ss_pred             hhhhhhhhcCCCCceEEcccCCCCCCCCC
Q psy11111         48 MVKTFQAYLPNCHRTYSCVHCRAHLASHD   76 (84)
Q Consensus        48 MGRlF~~YL~~g~riYsC~~C~tHLA~~d   76 (84)
                      -|++|..||.   -.=.|.+|+..+..++
T Consensus        41 ~G~LF~g~Lk---v~~~C~~CG~~~~~~~   66 (148)
T PRK05978         41 EGKLFRAFLK---PVDHCAACGEDFTHHR   66 (148)
T ss_pred             CCcccccccc---cCCCccccCCccccCC
Confidence            7899999992   3458999999887653


No 27 
>cd08573 GDPD_GDE1 Glycerophosphodiester phosphodiesterase domain of mammalian glycerophosphodiester phosphodiesterase GDE1 and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in mammalian GDE1 (also known as MIR16, membrane interacting protein of RGS16) and their metazoan homologs. GDE1 is widely expressed in mammalian tissues, including the heart, brain, liver, and kidney. It shows sequence homology to bacterial glycerophosphodiester phosphodiesterases (GP-GDEs, EC 3.1.4.46), which catalyzes the hydrolysis of various glycerophosphodiesters, and produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols. GDE1 has been characterized as GPI-GDE (EC 3.1.4.44) that selectively hydrolyzes extracellular glycerophosphoinositol (GPI) to generate glycerol phosphate and inositol. It functions as an integral membrane-bound glycoprotein interacting with regulator of G protein signaling protein RGS16, and is modulated by G 
Probab=30.63  E-value=16  Score=27.17  Aligned_cols=12  Identities=42%  Similarity=0.803  Sum_probs=9.8

Q ss_pred             eeeeecCCccce
Q psy11111         10 SVWTVDTPQDYC   21 (84)
Q Consensus        10 ~~~~~~~~~~~~   21 (84)
                      .+||||+|++.-
T Consensus       232 ~vWTVn~~~~~~  243 (258)
T cd08573         232 IAWTVNTPTEKQ  243 (258)
T ss_pred             EEEecCCHHHHH
Confidence            589999998753


No 28 
>PRK00222 methionine sulfoxide reductase B; Provisional
Probab=30.62  E-value=26  Score=25.43  Aligned_cols=17  Identities=35%  Similarity=0.710  Sum_probs=13.6

Q ss_pred             CceEEcccCCCCCCCCC
Q psy11111         60 HRTYSCVHCRAHLASHD   76 (84)
Q Consensus        60 ~riYsC~~C~tHLA~~d   76 (84)
                      .-+|.|+.|+++|=..+
T Consensus        41 ~G~Y~C~~Cg~pLF~S~   57 (142)
T PRK00222         41 KGIYVCIVCGEPLFSSD   57 (142)
T ss_pred             CeEEEecCCCchhcCCc
Confidence            45999999999985543


No 29 
>PF04828 GFA:  Glutathione-dependent formaldehyde-activating enzyme;  InterPro: IPR006913 The GFA family consists mainly of glutathione-dependent formaldehyde-activating enzymes, but also includes centromere protein V and a fission yeast protein described as uncharacterised lyase. Glutathione-dependent formaldehyde-activating enzyme catalyse the condensation of formaldehyde and glutathione to S-hydroxymethylglutathione.  All known members of this family contain 5 strongly conserved cysteine residues.; GO: 0016846 carbon-sulfur lyase activity, 0008152 metabolic process; PDB: 3FAC_B 1XA8_A 1X6M_B.
Probab=30.18  E-value=26  Score=20.83  Aligned_cols=15  Identities=33%  Similarity=0.600  Sum_probs=10.8

Q ss_pred             CceEEcccCCCCCCC
Q psy11111         60 HRTYSCVHCRAHLAS   74 (84)
Q Consensus        60 ~riYsC~~C~tHLA~   74 (84)
                      .+.+-|++|+++|..
T Consensus        46 ~~r~FC~~CGs~l~~   60 (92)
T PF04828_consen   46 VERYFCPTCGSPLFS   60 (92)
T ss_dssp             CEEEEETTT--EEEE
T ss_pred             CcCcccCCCCCeeec
Confidence            367999999999974


No 30 
>PF01641 SelR:  SelR domain;  InterPro: IPR002579 Peptide methionine sulphoxide reductase (Msr) reverses the inactivation of many proteins due to the oxidation of critical methionine residues by reducing methionine sulphoxide, Met(O), to methionine []. It is present in most living organisms, and the cognate structural gene belongs to the so-called minimum gene set [, ]. The domains: MsrA and MsrB, reduce different epimeric forms of methionine sulphoxide. This group represents MsrB, the crystal structure of which has been determined to 1.8A []. The overall structure shows no resemblance to the structures of MsrA (IPR002569 from INTERPRO) from other organisms; though the active sites show approximate mirror symmetry. In each case, conserved amino acid motifs mediate the stereo-specific recognition and reduction of the substrate. Unlike the MsrA domain, the MsrB domain activates the cysteine or selenocysteine nucleophile through a unique Cys-Arg-Asp/Glu catalytic triad. The collapse of the reaction intermediate most likely results in the formation of a sulphenic or selenenic acid moiety. Regeneration of the active site occurs through a series of thiol-disulphide exchange steps involving another active site Cys residue and thioredoxin. In a number of pathogenic bacteria, including Neisseria gonorrhoeae, the MsrA and MsrB domains are fused; the MsrA being N-terminal to MsrB. This arrangement is reversed in Treponema pallidum. In N. gonorrhoeae and Neisseria meningitidis, a thioredoxin domain is fused to the N terminus. This may function to reduce the active sites of the downstream MsrA and MsrB domains. ; GO: 0008113 peptide-methionine-(S)-S-oxide reductase activity, 0055114 oxidation-reduction process; PDB: 1L1D_A 3E0O_D 2KZN_A 3HCG_B 3HCH_A 2L1U_A 3MAO_A 2K8D_A 3HCJ_A 3HCI_A ....
Probab=29.62  E-value=23  Score=25.03  Aligned_cols=15  Identities=33%  Similarity=0.647  Sum_probs=11.4

Q ss_pred             CceEEcccCCCCCCC
Q psy11111         60 HRTYSCVHCRAHLAS   74 (84)
Q Consensus        60 ~riYsC~~C~tHLA~   74 (84)
                      .-+|.|+.|+++|=.
T Consensus        35 ~G~Y~C~~Cg~pLF~   49 (124)
T PF01641_consen   35 EGIYVCAVCGTPLFS   49 (124)
T ss_dssp             SEEEEETTTS-EEEE
T ss_pred             CEEEEcCCCCCcccc
Confidence            459999999998843


No 31 
>cd08581 GDPD_like_1 Glycerophosphodiester phosphodiesterase domain of uncharacterized bacterial glycerophosphodiester phosphodiesterases. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in a group of uncharacterized bacterial glycerophosphodiester phosphodiesterase and similar proteins. They show high sequence similarity to Escherichia coli glycerophosphodiester phosphodiesterase, which catalyzes the degradation of glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols.
Probab=29.08  E-value=18  Score=26.33  Aligned_cols=11  Identities=18%  Similarity=0.592  Sum_probs=9.4

Q ss_pred             eeeeecCCccc
Q psy11111         10 SVWTVDTPQDY   20 (84)
Q Consensus        10 ~~~~~~~~~~~   20 (84)
                      .|||||+|.+.
T Consensus       203 ~vWTVn~~~~~  213 (229)
T cd08581         203 VIYEVNEPAEA  213 (229)
T ss_pred             EEEEcCCHHHH
Confidence            58999999875


No 32 
>PRK15272 pertussis toxin-like subunit ArtA; Provisional
Probab=28.96  E-value=29  Score=27.52  Aligned_cols=12  Identities=50%  Similarity=0.656  Sum_probs=10.4

Q ss_pred             cccceeeeeecC
Q psy11111          5 STAVDSVWTVDT   16 (84)
Q Consensus         5 ~~~~~~~~~~~~   16 (84)
                      +-|+|-||.|||
T Consensus        16 ~~Apd~VyRVDt   27 (242)
T PRK15272         16 NYAVDFVYRVDS   27 (242)
T ss_pred             ccCceEEEEcCC
Confidence            457999999998


No 33 
>PRK08270 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=28.90  E-value=37  Score=29.49  Aligned_cols=16  Identities=19%  Similarity=0.289  Sum_probs=14.1

Q ss_pred             eeeecCCccceecccc
Q psy11111         11 VWTVDTPQDYCWRHSS   26 (84)
Q Consensus        11 ~~~~~~~~~~~~~~~~   26 (84)
                      -|++.+|-|+|-.|..
T Consensus       619 Y~~in~~~~~C~~CG~  634 (656)
T PRK08270        619 YITITPTFSICPKHGY  634 (656)
T ss_pred             eEEeCCCCcccCCCCC
Confidence            5899999999998875


No 34 
>COG1861 SpsF Spore coat polysaccharide biosynthesis protein F, CMP-KDO synthetase homolog [Cell envelope biogenesis, outer membrane]
Probab=28.68  E-value=18  Score=28.65  Aligned_cols=12  Identities=42%  Similarity=0.565  Sum_probs=10.2

Q ss_pred             eeeeecCCccce
Q psy11111         10 SVWTVDTPQDYC   21 (84)
Q Consensus        10 ~~~~~~~~~~~~   21 (84)
                      --|||||++|+=
T Consensus       187 ~RltvDt~eD~~  198 (241)
T COG1861         187 YRLTVDTQEDFA  198 (241)
T ss_pred             eEEEeccHHHHH
Confidence            469999999984


No 35 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=27.65  E-value=32  Score=19.47  Aligned_cols=15  Identities=20%  Similarity=0.736  Sum_probs=10.3

Q ss_pred             eEEcccCCCCCCCCC
Q psy11111         62 TYSCVHCRAHLASHD   76 (84)
Q Consensus        62 iYsC~~C~tHLA~~d   76 (84)
                      .|.|.+|++.+...+
T Consensus         3 ~y~C~~CG~~~~~~~   17 (46)
T PRK00398          3 EYKCARCGREVELDE   17 (46)
T ss_pred             EEECCCCCCEEEECC
Confidence            578888887765443


No 36 
>cd08583 PI-PLCc_GDPD_SF_unchar1 Uncharacterized hypothetical proteins similar to the catalytic domains of Phosphoinositide-specific phospholipaseand Glycerophosphodiester phosphodiesterases. This subfamily corresponds to a group of uncharacterized hypothetical proteins similar to the catalytic domains of Phosphoinositide-specific phospholipase C (PI-PLC), and glycerophosphodiester phosphodiesterases (GP-GDE), and also sphingomyelinases D (SMases D) and similar proteins. They hydrolyze the 3'-5' phosphodiester bonds in different substrates, utilizing a similar mechanism of general base and acid catalysis involving two conserved histidine residues.
Probab=26.34  E-value=21  Score=25.73  Aligned_cols=12  Identities=25%  Similarity=0.354  Sum_probs=9.8

Q ss_pred             eeeeecCCccce
Q psy11111         10 SVWTVDTPQDYC   21 (84)
Q Consensus        10 ~~~~~~~~~~~~   21 (84)
                      .|||||+|+++-
T Consensus       209 ~vwTVn~~~~~~  220 (237)
T cd08583         209 YVYTINDLKDAQ  220 (237)
T ss_pred             EEEeCCCHHHHH
Confidence            589999998753


No 37 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=25.66  E-value=17  Score=16.54  Aligned_cols=16  Identities=31%  Similarity=0.729  Sum_probs=10.2

Q ss_pred             EEcccCCCCCCCCCcc
Q psy11111         63 YSCVHCRAHLASHDEL   78 (84)
Q Consensus        63 YsC~~C~tHLA~~ddL   78 (84)
                      |.|..|+.-+.+.++|
T Consensus         1 ~~C~~C~~~~~~~~~l   16 (24)
T PF13894_consen    1 FQCPICGKSFRSKSEL   16 (24)
T ss_dssp             EE-SSTS-EESSHHHH
T ss_pred             CCCcCCCCcCCcHHHH
Confidence            6788898777766654


No 38 
>cd08580 GDPD_Rv2277c_like Glycerophosphodiester phosphodiesterase domain of uncharacterized bacterial protein Rv2277c and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in uncharacterized bacterial protein Rv2277c and similar proteins. Members in this subfamily are bacterial homologous of mammalian GDE4, a transmembrane protein whose cellular function has not yet been elucidated.
Probab=24.58  E-value=27  Score=26.54  Aligned_cols=11  Identities=27%  Similarity=0.752  Sum_probs=9.3

Q ss_pred             eeeeecCCccc
Q psy11111         10 SVWTVDTPQDY   20 (84)
Q Consensus        10 ~~~~~~~~~~~   20 (84)
                      .+||||+|++.
T Consensus       234 ~~WTVN~~~~~  244 (263)
T cd08580         234 VLFGINTADDY  244 (263)
T ss_pred             EEEEeCCHHHH
Confidence            58999999874


No 39 
>cd08565 GDPD_pAtGDE_like Glycerophosphodiester phosphodiesterase domain of putative Agrobacterium tumefaciens glycerophosphodiester phosphodiesterase and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in putative Agrobacterium tumefaciens glycerophosphodiester phosphodiesterase (pAtGDE, EC 3.1.4.46) and its uncharacterized homologs. Members in this family show high sequence similarity to Escherichia coli GP-GDE, which catalyzes the degradation of glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols.
Probab=24.19  E-value=23  Score=25.87  Aligned_cols=11  Identities=36%  Similarity=0.634  Sum_probs=9.1

Q ss_pred             eeeeecCCccc
Q psy11111         10 SVWTVDTPQDY   20 (84)
Q Consensus        10 ~~~~~~~~~~~   20 (84)
                      .+||||+++++
T Consensus       205 ~~WTVn~~~~~  215 (235)
T cd08565         205 GVWTVNDDSLI  215 (235)
T ss_pred             EEEccCCHHHH
Confidence            37999999875


No 40 
>PF03892 NapB:  Nitrate reductase cytochrome c-type subunit (NapB);  InterPro: IPR005591 The napB gene encodes a dihaem cytochrome c, the small subunit of a heterodimeric periplasmic nitrate reductase [].; PDB: 3O5A_B 3ML1_B 1OGY_L 1JNI_A.
Probab=23.68  E-value=28  Score=24.97  Aligned_cols=25  Identities=24%  Similarity=0.522  Sum_probs=15.2

Q ss_pred             CceEEcccCCCCCCCCCccccCCCC
Q psy11111         60 HRTYSCVHCRAHLASHDELISKIPR   84 (84)
Q Consensus        60 ~riYsC~~C~tHLA~~ddLISKsFq   84 (84)
                      ++.|-|..|+++=++.+-||--.|+
T Consensus       107 ~~RyfC~qCHvpQ~da~PlV~N~F~  131 (133)
T PF03892_consen  107 PRRYFCTQCHVPQADAKPLVENTFK  131 (133)
T ss_dssp             CCCCSGGGT--B-BSS--SS-B--B
T ss_pred             cceeeeccccCccccCccCCCCCcc
Confidence            5889999999999999999988874


No 41 
>cd08574 GDPD_GDE_2_3_6 Glycerophosphodiester phosphodiesterase domain of mammalian glycerophosphodiester phosphodiesterase GDE2, GDE3, GDE6-like proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in mammalian glycerophosphodiester phosphodiesterase domain-containing protein subtype 5 (GDE2), subtype 2 (GDE3), subtype 1 (GDE6), and their eukaryotic homologs. Mammalian GDE2, GDE3, and GDE6 show very high sequence similarity to each other and have been classified into the same family. Although they are all transmembrane proteins, based on different pattern of tissue distribution, these enzymes might display diverse cellular functions. Mammalian GDE2 is primarily expressed in mature neurons. It selectively hydrolyzes glycerophosphocholine (GPC) and mainly functions in a complex with an antioxidant scavenger peroxiredoxin1 (Prdx1) to control motor neuron differentiation in the spinal cord.  Mammalian GDE3 is specifically expressed in bo
Probab=23.62  E-value=23  Score=26.12  Aligned_cols=12  Identities=25%  Similarity=0.587  Sum_probs=9.8

Q ss_pred             eeeeecCCccce
Q psy11111         10 SVWTVDTPQDYC   21 (84)
Q Consensus        10 ~~~~~~~~~~~~   21 (84)
                      .+||||+|+++.
T Consensus       227 ~~WTVn~~~~~~  238 (252)
T cd08574         227 NLYVVNEPWLYS  238 (252)
T ss_pred             EEEccCCHHHHH
Confidence            489999998764


No 42 
>cd08608 GDPD_GDE2 Glycerophosphodiester phosphodiesterase domain of mammalian glycerophosphodiester phosphodiesterase GDE2 and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in mammalian GDE2 (also known as glycerophosphodiester phosphodiesterase domain-containing protein 5 (GDPD5)) and their metazoan homologs. Mammalian GDE2 is transmembrane protein primarily expressed in mature neurons. It is a mammalian homolog of bacterial glycerophosphodiester phosphodiesterases (GP-GDEs, EC 3.1.4.46), which catalyze the hydrolysis of various glycerophosphodiesters, and produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols. Mammalian GDE2 selectively hydrolyzes glycerophosphocholine (GPC) and has been characterized as GPC-GDE (EC 3.1.4.2) that contributes to osmotic regulation of cellular GPC. Mammalian GDE2 functions in a complex with an antioxidant scavenger peroxiredoxin1 (Prdx1) to control motor neuron differenti
Probab=23.32  E-value=26  Score=28.05  Aligned_cols=11  Identities=36%  Similarity=0.712  Sum_probs=9.4

Q ss_pred             eeeeecCCccc
Q psy11111         10 SVWTVDTPQDY   20 (84)
Q Consensus        10 ~~~~~~~~~~~   20 (84)
                      .|||||+|+++
T Consensus       227 ~vWTVN~~~~~  237 (351)
T cd08608         227 NLYTVNEPWLY  237 (351)
T ss_pred             EEEecCCHHHH
Confidence            58999999875


No 43 
>COG5349 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=23.27  E-value=35  Score=24.66  Aligned_cols=26  Identities=19%  Similarity=0.382  Sum_probs=19.0

Q ss_pred             hhhhhhhhcCCCCceEEcccCCCCCCCCC
Q psy11111         48 MVKTFQAYLPNCHRTYSCVHCRAHLASHD   76 (84)
Q Consensus        48 MGRlF~~YL~~g~riYsC~~C~tHLA~~d   76 (84)
                      =||+|+.||-   ..=.|..|+-.+..+|
T Consensus        29 eGrLF~gFLK---~~p~C~aCG~dyg~~~   54 (126)
T COG5349          29 EGRLFRGFLK---VVPACEACGLDYGFAD   54 (126)
T ss_pred             Cchhhhhhcc---cCchhhhccccccCCc
Confidence            5899999992   3458999987655443


No 44 
>COG3043 NapB Nitrate reductase cytochrome c-type subunit [Energy production and conversion]
Probab=23.21  E-value=58  Score=24.34  Aligned_cols=26  Identities=23%  Similarity=0.514  Sum_probs=22.9

Q ss_pred             CCceEEcccCCCCCCCCCccccCCCC
Q psy11111         59 CHRTYSCVHCRAHLASHDELISKIPR   84 (84)
Q Consensus        59 g~riYsC~~C~tHLA~~ddLISKsFq   84 (84)
                      .+|.|-|-.|+.+=|+.+-|+-..|+
T Consensus       123 SPRRYFClQCHVPQaD~kPlV~N~F~  148 (155)
T COG3043         123 SPRRYFCLQCHVPQADVKPLVGNTFK  148 (155)
T ss_pred             CccceeeeecccccccccccCCCCcc
Confidence            35899999999999999999988874


No 45 
>cd08575 GDPD_GDE4_like Glycerophosphodiester phosphodiesterase domain of mammalian glycerophosphodiester phosphodiesterase GDE4-like proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in mammalian GDE4 (also known as glycerophosphodiester phosphodiesterase domain-containing protein 1 (GDPD1)) and similar proteins. Mammalian GDE4 is a transmembrane protein whose cellular function is not elucidated. It is expressed widely, including in placenta, liver, kidney, pancreas, spleen, thymus, ovary, small intestine and peripheral blood leukocytes. It is also expressed in the growth cones in neuroblastoma Neuro2a cells, which suggests mammalian GDE4 may play some distinct role from other members of mammalian GDEs family. Also included in this subfamily are uncharacterized mammalian glycerophosphodiester phosphodiesterase domain-containing protein 3 (GDPD3) and similar proteins which display very high sequence homology to mammalian GDE4.
Probab=22.88  E-value=31  Score=25.57  Aligned_cols=11  Identities=18%  Similarity=0.881  Sum_probs=9.2

Q ss_pred             eeeeecCCccc
Q psy11111         10 SVWTVDTPQDY   20 (84)
Q Consensus        10 ~~~~~~~~~~~   20 (84)
                      .+||||+++++
T Consensus       235 ~vWTVNd~~~~  245 (264)
T cd08575         235 YLWVLNDEEDF  245 (264)
T ss_pred             EEEEECCHHHH
Confidence            58999999875


No 46 
>cd08612 GDPD_GDE4 Glycerophosphodiester phosphodiesterase domain of mammalian glycerophosphodiester phosphodiesterase GDE4 and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in mammalian GDE4 (also known as glycerophosphodiester phosphodiesterase domain-containing protein 1 (GDPD1)) and similar proteins. Mammalian GDE4 is a transmembrane protein whose cellular function has not yet been elucidated. It is expressed widely, including in placenta, liver, kidney, pancreas, spleen, thymus, ovary, small intestine and peripheral blood leukocytes. It is also expressed in the growth cones in neuroblastoma Neuro2a cells, which suggests GDE4 may play some distinct role from other members of the GDE family.
Probab=22.85  E-value=27  Score=26.47  Aligned_cols=11  Identities=9%  Similarity=0.667  Sum_probs=9.2

Q ss_pred             eeeeecCCccc
Q psy11111         10 SVWTVDTPQDY   20 (84)
Q Consensus        10 ~~~~~~~~~~~   20 (84)
                      .|||||+|+++
T Consensus       265 ~vWTVNd~~~~  275 (300)
T cd08612         265 YGWVLNDEEEF  275 (300)
T ss_pred             EEeecCCHHHH
Confidence            58999999864


No 47 
>PRK14704 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=22.15  E-value=51  Score=28.57  Aligned_cols=16  Identities=25%  Similarity=0.318  Sum_probs=14.1

Q ss_pred             eeeecCCccceecccc
Q psy11111         11 VWTVDTPQDYCWRHSS   26 (84)
Q Consensus        11 ~~~~~~~~~~~~~~~~   26 (84)
                      .|++.+|-|+|-.|..
T Consensus       552 Y~sin~~~~~C~~CGy  567 (618)
T PRK14704        552 YGSINHPVDRCKCCSY  567 (618)
T ss_pred             eEEeCCCCeecCCCCC
Confidence            5899999999998875


No 48 
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=21.98  E-value=41  Score=18.76  Aligned_cols=16  Identities=25%  Similarity=0.681  Sum_probs=13.6

Q ss_pred             ceEEcccCCCCCCCCC
Q psy11111         61 RTYSCVHCRAHLASHD   76 (84)
Q Consensus        61 riYsC~~C~tHLA~~d   76 (84)
                      .-|.|..|+..|...+
T Consensus        25 ~Cf~C~~C~~~l~~~~   40 (58)
T PF00412_consen   25 ECFKCSKCGKPLNDGD   40 (58)
T ss_dssp             TTSBETTTTCBTTTSS
T ss_pred             cccccCCCCCccCCCe
Confidence            4589999999998775


No 49 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=21.78  E-value=43  Score=18.55  Aligned_cols=18  Identities=33%  Similarity=0.684  Sum_probs=15.0

Q ss_pred             EEcccCCCCCCCCCcccc
Q psy11111         63 YSCVHCRAHLASHDELIS   80 (84)
Q Consensus        63 YsC~~C~tHLA~~ddLIS   80 (84)
                      ..|.+|++-....|+.|.
T Consensus         3 i~Cp~C~~~y~i~d~~ip   20 (36)
T PF13717_consen    3 ITCPNCQAKYEIDDEKIP   20 (36)
T ss_pred             EECCCCCCEEeCCHHHCC
Confidence            579999999888888775


No 50 
>TIGR01053 LSD1 zinc finger domain, LSD1 subclass. This model describes a putative zinc finger domain found in three closely spaced copies in Arabidopsis protein LSD1 and in two copies in other proteins from the same species. The motif resembles CxxCRxxLMYxxGASxVxCxxC
Probab=21.37  E-value=56  Score=17.94  Aligned_cols=18  Identities=17%  Similarity=0.409  Sum_probs=12.5

Q ss_pred             hhhcCCCCceEEcccCCCC
Q psy11111         53 QAYLPNCHRTYSCVHCRAH   71 (84)
Q Consensus        53 ~~YL~~g~riYsC~~C~tH   71 (84)
                      +.|- .|.+-+.|..|++.
T Consensus        11 L~yP-~gA~~vrCs~C~~v   28 (31)
T TIGR01053        11 LMYP-RGASSVRCALCQTV   28 (31)
T ss_pred             eecC-CCCCeEECCCCCeE
Confidence            4454 46688889888764


No 51 
>TIGR03552 F420_cofC 2-phospho-L-lactate guanylyltransferase CofC. Members of this protein family are the CofC enzyme of coenzyme F420 biosynthesis.
Probab=21.25  E-value=27  Score=23.96  Aligned_cols=10  Identities=50%  Similarity=0.813  Sum_probs=8.8

Q ss_pred             eeecCCccce
Q psy11111         12 WTVDTPQDYC   21 (84)
Q Consensus        12 ~~~~~~~~~~   21 (84)
                      |-||||+||=
T Consensus       175 ~DiDtp~Dl~  184 (195)
T TIGR03552       175 LDVDTPEDLA  184 (195)
T ss_pred             ecCCCHHHHH
Confidence            8999999984


No 52 
>TIGR02487 NrdD anaerobic ribonucleoside-triphosphate reductase. This model represents the oxygen-sensitive (anaerobic, class III) ribonucleotide reductase. The mechanism of the enzyme involves a glycine-centered radical, a C-terminal zinc binding site, and a set of conserved active site cysteines and asparagines. This enzyme requires an activating component, NrdG, a radical-SAM domain containing enzyme (TIGR02491). Together the two form an alpha-2/beta-2 heterodimer.
Probab=21.03  E-value=68  Score=27.27  Aligned_cols=17  Identities=18%  Similarity=0.413  Sum_probs=14.6

Q ss_pred             eeeeecCCccceecccc
Q psy11111         10 SVWTVDTPQDYCWRHSS   26 (84)
Q Consensus        10 ~~~~~~~~~~~~~~~~~   26 (84)
                      ..|++.+|-|+|-.|..
T Consensus       516 ~Y~~~n~~~~~C~~CG~  532 (579)
T TIGR02487       516 GYFGINPPVDVCEDCGY  532 (579)
T ss_pred             ceEEeccCCccCCCCCC
Confidence            46899999999998865


No 53 
>PF06353 DUF1062:  Protein of unknown function (DUF1062);  InterPro: IPR009412 This entry consists of several hypothetical bacterial proteins of unknown function.
Probab=20.84  E-value=52  Score=23.59  Aligned_cols=9  Identities=33%  Similarity=0.969  Sum_probs=8.3

Q ss_pred             eEEcccCCC
Q psy11111         62 TYSCVHCRA   70 (84)
Q Consensus        62 iYsC~~C~t   70 (84)
                      ||.|.+|++
T Consensus        13 IYrC~~C~~   21 (142)
T PF06353_consen   13 IYRCEKCDY   21 (142)
T ss_pred             EEEcccCcC
Confidence            899999986


No 54 
>cd08568 GDPD_TmGDE_like Glycerophosphodiester phosphodiesterase domain of Thermotoga maritime and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in Thermotoga maritime glycerophosphodiester phosphodiesterase (TmGDE, EC 3.1.4.46) and its uncharacterized  homologs. Members in this family show high sequence similarity to Escherichia coli GP-GDE, which catalyzes the degradation of glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols. TmGDE exists as a monomer that might be the biologically relevant form.
Probab=20.80  E-value=29  Score=24.80  Aligned_cols=11  Identities=36%  Similarity=0.827  Sum_probs=8.8

Q ss_pred             eeeeecCCccc
Q psy11111         10 SVWTVDTPQDY   20 (84)
Q Consensus        10 ~~~~~~~~~~~   20 (84)
                      .+||||+|++.
T Consensus       198 ~~WTvn~~~~~  208 (226)
T cd08568         198 VLWTVNDPELV  208 (226)
T ss_pred             EEEcCCCHHHH
Confidence            38999998764


No 55 
>cd08610 GDPD_GDE6 Glycerophosphodiester phosphodiesterase domain of mammalian glycerophosphodiester phosphodiesterase GDE6 and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in mammalian GDE6 (also known as glycerophosphodiester phosphodiesterase domain-containing protein 4 (GDPD4)) and their metazoan homologs. Mammalian GDE6 is a transmembrane protein predominantly expressed in the spermatocytes of testis. Although the specific physiological function of mammalian GDE6 has not been elucidated, its different pattern of tissue distribution suggests it might play a critical role in the completion of meiosis during male germ cell differentiation.
Probab=20.68  E-value=29  Score=27.29  Aligned_cols=11  Identities=18%  Similarity=0.594  Sum_probs=9.5

Q ss_pred             eeeeecCCccc
Q psy11111         10 SVWTVDTPQDY   20 (84)
Q Consensus        10 ~~~~~~~~~~~   20 (84)
                      .|||||+|+++
T Consensus       249 ~vWTVNd~~~~  259 (316)
T cd08610         249 NVYVINEPWLF  259 (316)
T ss_pred             EEECCCCHHHH
Confidence            58999999865


No 56 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=20.40  E-value=53  Score=20.07  Aligned_cols=13  Identities=23%  Similarity=0.746  Sum_probs=11.2

Q ss_pred             CceEEcccCCCCC
Q psy11111         60 HRTYSCVHCRAHL   72 (84)
Q Consensus        60 ~riYsC~~C~tHL   72 (84)
                      ...|.|..|+..+
T Consensus         4 ~~~Y~C~~Cg~~~   16 (49)
T COG1996           4 MMEYKCARCGREV   16 (49)
T ss_pred             eEEEEhhhcCCee
Confidence            3579999999988


No 57 
>KOG1074|consensus
Probab=20.17  E-value=48  Score=30.79  Aligned_cols=26  Identities=15%  Similarity=0.491  Sum_probs=20.6

Q ss_pred             hhhhhcCCCCceEEcccCCCCCCCCCcc
Q psy11111         51 TFQAYLPNCHRTYSCVHCRAHLASHDEL   78 (84)
Q Consensus        51 lF~~YL~~g~riYsC~~C~tHLA~~ddL   78 (84)
                      -|+.+-  |+|.|.||-|+--++....|
T Consensus       624 HyrtHt--GERPFkCKiCgRAFtTkGNL  649 (958)
T KOG1074|consen  624 HYRTHT--GERPFKCKICGRAFTTKGNL  649 (958)
T ss_pred             hhhccc--CcCccccccccchhccccch
Confidence            356664  78999999999888877665


No 58 
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=20.12  E-value=60  Score=18.25  Aligned_cols=14  Identities=21%  Similarity=0.489  Sum_probs=8.8

Q ss_pred             eEEcccCCCCCCCC
Q psy11111         62 TYSCVHCRAHLASH   75 (84)
Q Consensus        62 iYsC~~C~tHLA~~   75 (84)
                      ..+|.+|+..++..
T Consensus        21 ~isC~~CGPr~~i~   34 (35)
T PF07503_consen   21 FISCTNCGPRYSII   34 (35)
T ss_dssp             T--BTTCC-SCCCE
T ss_pred             CccCCCCCCCEEEe
Confidence            35899999998753


No 59 
>PF04777 Evr1_Alr:  Erv1 / Alr family;  InterPro: IPR006863 Biogenesis of Fe/S clusters involves a number of essential mitochondrial proteins. Erv1p of Saccharomyces cerevisiae (Baker's yeast) mitochondria is required for the maturation of Fe/S proteins in the cytosol. The ALR (augmenter of liver regeneration) represents a mammalian ortholog of yeast Erv1p. Both Erv1p and full-length ALR are located in the mitochondrial intermembrane and it is thought to operate downstream of the mitochondrial ABC transporter [].; GO: 0016972 thiol oxidase activity, 0055114 oxidation-reduction process; PDB: 3MBG_C 3U2L_A 3U2M_A 3QD9_D 3QCP_A 3O55_A 2HJ3_B 3GWN_A 3T58_D 3T59_B ....
Probab=20.07  E-value=3.8  Score=26.11  Aligned_cols=20  Identities=25%  Similarity=0.705  Sum_probs=14.1

Q ss_pred             hhhhhcCCCCceEEcccCCCCCC
Q psy11111         51 TFQAYLPNCHRTYSCVHCRAHLA   73 (84)
Q Consensus        51 lF~~YL~~g~riYsC~~C~tHLA   73 (84)
                      .|..++   ...|+|..|+.|+-
T Consensus        28 ~~~~~~---~~~~pC~~C~~hf~   47 (95)
T PF04777_consen   28 AFFRSF---PHFFPCEECRNHFS   47 (95)
T ss_dssp             HHHHHH---HHHSSSHHHHHHHH
T ss_pred             HHHHHH---HHHCCcHHHHHHHH
Confidence            355555   26789999998863


Done!