Query psy11111
Match_columns 84
No_of_seqs 109 out of 199
Neff 3.3
Searched_HMMs 46136
Date Fri Aug 16 18:13:09 2013
Command hhsearch -i /work/01045/syshi/Psyhhblits/psy11111.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/11111hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 KOG3399|consensus 99.3 1.3E-12 2.8E-17 92.4 1.9 37 48-84 1-37 (122)
2 PRK02935 hypothetical protein; 70.4 3.5 7.6E-05 29.2 2.0 25 60-84 84-108 (110)
3 PF11023 DUF2614: Protein of u 62.4 3.5 7.5E-05 29.3 0.7 24 61-84 84-107 (114)
4 PF13465 zf-H2C2_2: Zinc-finge 54.7 7.3 0.00016 19.9 1.0 13 59-71 11-23 (26)
5 PF04236 Transp_Tc5_C: Tc5 tra 51.8 13 0.00028 23.5 2.0 47 13-81 13-59 (63)
6 PF06462 Hyd_WA: Propeller; I 45.6 16 0.00035 19.8 1.5 16 9-24 1-16 (32)
7 PF13912 zf-C2H2_6: C2H2-type 43.7 4.4 9.6E-05 20.1 -0.9 18 62-79 1-18 (27)
8 PF00096 zf-C2H2: Zinc finger, 43.0 5.4 0.00012 19.1 -0.6 17 63-79 1-17 (23)
9 PRK04860 hypothetical protein; 41.9 13 0.00029 26.9 1.0 20 59-78 140-159 (160)
10 PF03691 UPF0167: Uncharacteri 41.1 13 0.00028 27.6 0.8 25 52-76 146-174 (176)
11 TIGR00319 desulf_FeS4 desulfof 40.0 19 0.0004 19.4 1.2 13 61-73 6-18 (34)
12 PF12572 DUF3752: Protein of u 40.0 8.5 0.00018 26.9 -0.3 18 7-25 30-47 (152)
13 KOG0856|consensus 38.9 18 0.0004 26.7 1.3 15 60-74 52-66 (146)
14 KOG2462|consensus 38.8 10 0.00022 30.5 -0.0 21 59-79 212-232 (279)
15 cd00974 DSRD Desulforedoxin (D 38.1 21 0.00045 19.2 1.2 13 61-73 3-15 (34)
16 PRK11586 napB nitrate reductas 37.7 26 0.00056 26.0 1.9 34 48-84 109-142 (149)
17 PF10955 DUF2757: Protein of u 35.7 16 0.00035 24.1 0.6 15 62-76 4-18 (76)
18 PF06397 Desulfoferrod_N: Desu 35.3 21 0.00045 20.5 0.9 13 60-72 4-16 (36)
19 PF03811 Zn_Tnp_IS1: InsA N-te 35.3 26 0.00057 19.8 1.3 12 58-69 25-36 (36)
20 PF13842 Tnp_zf-ribbon_2: DDE_ 34.8 26 0.00056 19.2 1.2 14 61-74 15-28 (32)
21 PF06524 NOA36: NOA36 protein; 34.2 23 0.0005 28.9 1.3 20 59-78 139-158 (314)
22 PRK05508 methionine sulfoxide 33.4 25 0.00054 24.9 1.2 17 60-76 31-47 (119)
23 smart00132 LIM Zinc-binding do 33.0 18 0.00039 18.3 0.4 13 61-73 26-38 (39)
24 cd08585 GDPD_like_3 Glyceropho 33.0 14 0.0003 27.2 -0.1 11 10-20 213-223 (237)
25 TIGR00357 methionine-R-sulfoxi 32.9 25 0.00054 25.3 1.2 17 60-76 38-54 (134)
26 PRK05978 hypothetical protein; 30.9 22 0.00048 25.8 0.7 26 48-76 41-66 (148)
27 cd08573 GDPD_GDE1 Glycerophosp 30.6 16 0.00034 27.2 -0.1 12 10-21 232-243 (258)
28 PRK00222 methionine sulfoxide 30.6 26 0.00057 25.4 1.0 17 60-76 41-57 (142)
29 PF04828 GFA: Glutathione-depe 30.2 26 0.00057 20.8 0.8 15 60-74 46-60 (92)
30 PF01641 SelR: SelR domain; I 29.6 23 0.0005 25.0 0.6 15 60-74 35-49 (124)
31 cd08581 GDPD_like_1 Glyceropho 29.1 18 0.00039 26.3 -0.0 11 10-20 203-213 (229)
32 PRK15272 pertussis toxin-like 29.0 29 0.00062 27.5 1.0 12 5-16 16-27 (242)
33 PRK08270 anaerobic ribonucleos 28.9 37 0.00081 29.5 1.8 16 11-26 619-634 (656)
34 COG1861 SpsF Spore coat polysa 28.7 18 0.00038 28.7 -0.2 12 10-21 187-198 (241)
35 PRK00398 rpoP DNA-directed RNA 27.6 32 0.00069 19.5 0.8 15 62-76 3-17 (46)
36 cd08583 PI-PLCc_GDPD_SF_unchar 26.3 21 0.00045 25.7 -0.1 12 10-21 209-220 (237)
37 PF13894 zf-C2H2_4: C2H2-type 25.7 17 0.00038 16.5 -0.4 16 63-78 1-16 (24)
38 cd08580 GDPD_Rv2277c_like Glyc 24.6 27 0.00059 26.5 0.2 11 10-20 234-244 (263)
39 cd08565 GDPD_pAtGDE_like Glyce 24.2 23 0.0005 25.9 -0.2 11 10-20 205-215 (235)
40 PF03892 NapB: Nitrate reducta 23.7 28 0.0006 25.0 0.1 25 60-84 107-131 (133)
41 cd08574 GDPD_GDE_2_3_6 Glycero 23.6 23 0.00051 26.1 -0.3 12 10-21 227-238 (252)
42 cd08608 GDPD_GDE2 Glycerophosp 23.3 26 0.00057 28.1 -0.1 11 10-20 227-237 (351)
43 COG5349 Uncharacterized protei 23.3 35 0.00077 24.7 0.6 26 48-76 29-54 (126)
44 COG3043 NapB Nitrate reductase 23.2 58 0.0012 24.3 1.7 26 59-84 123-148 (155)
45 cd08575 GDPD_GDE4_like Glycero 22.9 31 0.00068 25.6 0.2 11 10-20 235-245 (264)
46 cd08612 GDPD_GDE4 Glycerophosp 22.8 27 0.00058 26.5 -0.1 11 10-20 265-275 (300)
47 PRK14704 anaerobic ribonucleos 22.1 51 0.0011 28.6 1.4 16 11-26 552-567 (618)
48 PF00412 LIM: LIM domain; Int 22.0 41 0.00089 18.8 0.6 16 61-76 25-40 (58)
49 PF13717 zinc_ribbon_4: zinc-r 21.8 43 0.00093 18.6 0.6 18 63-80 3-20 (36)
50 TIGR01053 LSD1 zinc finger dom 21.4 56 0.0012 17.9 1.0 18 53-71 11-28 (31)
51 TIGR03552 F420_cofC 2-phospho- 21.2 27 0.00058 24.0 -0.4 10 12-21 175-184 (195)
52 TIGR02487 NrdD anaerobic ribon 21.0 68 0.0015 27.3 1.9 17 10-26 516-532 (579)
53 PF06353 DUF1062: Protein of u 20.8 52 0.0011 23.6 1.0 9 62-70 13-21 (142)
54 cd08568 GDPD_TmGDE_like Glycer 20.8 29 0.00063 24.8 -0.3 11 10-20 198-208 (226)
55 cd08610 GDPD_GDE6 Glycerophosp 20.7 29 0.00062 27.3 -0.3 11 10-20 249-259 (316)
56 COG1996 RPC10 DNA-directed RNA 20.4 53 0.0011 20.1 0.9 13 60-72 4-16 (49)
57 KOG1074|consensus 20.2 48 0.001 30.8 0.9 26 51-78 624-649 (958)
58 PF07503 zf-HYPF: HypF finger; 20.1 60 0.0013 18.2 1.0 14 62-75 21-34 (35)
59 PF04777 Evr1_Alr: Erv1 / Alr 20.1 3.8 8.2E-05 26.1 -4.5 20 51-73 28-47 (95)
No 1
>KOG3399|consensus
Probab=99.28 E-value=1.3e-12 Score=92.44 Aligned_cols=37 Identities=57% Similarity=0.942 Sum_probs=34.6
Q ss_pred hhhhhhhhcCCCCceEEcccCCCCCCCCCccccCCCC
Q psy11111 48 MVKTFQAYLPNCHRTYSCVHCRAHLASHDELISKIPR 84 (84)
Q Consensus 48 MGRlF~~YL~~g~riYsC~~C~tHLA~~ddLISKsFq 84 (84)
|||+|..+|++.+|.|+|++|+||||+++|||||+||
T Consensus 1 mgR~F~~~l~~~~~~y~C~~C~thla~~~dliSksf~ 37 (122)
T KOG3399|consen 1 MGRLFEAMLEANHRLYSCAHCKTHLARHDDLISKSFR 37 (122)
T ss_pred CcchHHHHhccCCceEeccCCcccccchhhccccccc
Confidence 8999999996555899999999999999999999997
No 2
>PRK02935 hypothetical protein; Provisional
Probab=70.37 E-value=3.5 Score=29.18 Aligned_cols=25 Identities=28% Similarity=0.429 Sum_probs=22.3
Q ss_pred CceEEcccCCCCCCCCCccccCCCC
Q psy11111 60 HRTYSCVHCRAHLASHDELISKIPR 84 (84)
Q Consensus 60 ~riYsC~~C~tHLA~~ddLISKsFq 84 (84)
+|+..|-+|+++|+...++--|.|.
T Consensus 84 GrvD~CM~C~~PLTLd~~legkefd 108 (110)
T PRK02935 84 GRVDACMHCNQPLTLDRSLEGKEFD 108 (110)
T ss_pred cceeecCcCCCcCCcCccccccCcC
Confidence 3789999999999999999888873
No 3
>PF11023 DUF2614: Protein of unknown function (DUF2614); InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=62.44 E-value=3.5 Score=29.30 Aligned_cols=24 Identities=29% Similarity=0.497 Sum_probs=21.3
Q ss_pred ceEEcccCCCCCCCCCccccCCCC
Q psy11111 61 RTYSCVHCRAHLASHDELISKIPR 84 (84)
Q Consensus 61 riYsC~~C~tHLA~~ddLISKsFq 84 (84)
|...|-+|+++|....++-=|.|.
T Consensus 84 r~D~CM~C~~pLTLd~~legkef~ 107 (114)
T PF11023_consen 84 RVDACMHCKEPLTLDPSLEGKEFD 107 (114)
T ss_pred hhhccCcCCCcCccCchhhcchhh
Confidence 678999999999999999888773
No 4
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=54.74 E-value=7.3 Score=19.94 Aligned_cols=13 Identities=23% Similarity=0.680 Sum_probs=10.7
Q ss_pred CCceEEcccCCCC
Q psy11111 59 CHRTYSCVHCRAH 71 (84)
Q Consensus 59 g~riYsC~~C~tH 71 (84)
+.+.|.|..|+.-
T Consensus 11 ~~k~~~C~~C~k~ 23 (26)
T PF13465_consen 11 GEKPYKCPYCGKS 23 (26)
T ss_dssp SSSSEEESSSSEE
T ss_pred CCCCCCCCCCcCe
Confidence 5689999999853
No 5
>PF04236 Transp_Tc5_C: Tc5 transposase C-terminal domain; InterPro: IPR007350 This domain corresponds to a C-terminal cysteine rich region that probably binds to a metal ion and could be DNA-binding. It is found in association with the DDE superfamily (IPR004875 from INTERPRO) and the Tc5 transposase family (IPR004906 from INTERPRO). More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=51.82 E-value=13 Score=23.46 Aligned_cols=47 Identities=21% Similarity=0.458 Sum_probs=30.7
Q ss_pred eecCCccceecccccccccccccCCCCCCccccchhhhhhhhhcCCCCceEEcccCCCCCCCCCccccC
Q psy11111 13 TVDTPQDYCWRHSSIGTAYASLLSPYGGTQQLSNIMVKTFQAYLPNCHRTYSCVHCRAHLASHDELISK 81 (84)
Q Consensus 13 ~~~~~~~~~~~~~~~~~~~~s~~~~~~~~s~~~~~MGRlF~~YL~~g~riYsC~~C~tHLA~~ddLISK 81 (84)
..+||-|+|.+....+.-...-+ +......|..|+.+|-...=||++
T Consensus 13 ~f~tP~~~cF~~~~~~~C~~~gC----------------------~~~s~I~C~~Ckk~~Cf~Hfiv~~ 59 (63)
T PF04236_consen 13 PFETPVDFCFPKNVAGDCDITGC----------------------NNTSFIRCAYCKKSLCFNHFIVSE 59 (63)
T ss_pred CCCCHHHHhCCCCCcCcCCCCCC----------------------CCcCEEEccccCCcccccceeeee
Confidence 36799999986544443333333 122468999999999877766643
No 6
>PF06462 Hyd_WA: Propeller; InterPro: IPR006624 Tectonins I and II are two dominant proteins in the nuclei and nuclear matrix from plasmodia of Physarum polycephalum (Slime mold) which encode 217 and 353 amino acids, respectively. Tectonin I is homologous to the C-terminal two-thirds of tectonin II. Both proteins contain six tandem repeats that are each 33-37 amino acids in length and define a new consensus sequence. Homologous repeats are found in L-6, a bacterial lipopolysaccharide-binding lectin from horseshoe crab hemocytes. The repetitive sequences of the tectonins and L-6 are reminiscent of the WD repeats of the beta-subunit of G proteins, suggesting that they form beta-propeller domains. The tectonins may be lectins that function as part of a transmembrane signalling complex during phagocytosis [].
Probab=45.62 E-value=16 Score=19.81 Aligned_cols=16 Identities=31% Similarity=0.692 Sum_probs=14.2
Q ss_pred eeeeeecCCccceecc
Q psy11111 9 DSVWTVDTPQDYCWRH 24 (84)
Q Consensus 9 ~~~~~~~~~~~~~~~~ 24 (84)
|.||.|+.--..+.|.
T Consensus 1 ~~VWav~~~G~v~~R~ 16 (32)
T PF06462_consen 1 DQVWAVTSDGSVYFRT 16 (32)
T ss_pred CeEEEEcCCCCEEEEC
Confidence 6899999988888886
No 7
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=43.69 E-value=4.4 Score=20.12 Aligned_cols=18 Identities=22% Similarity=0.551 Sum_probs=14.0
Q ss_pred eEEcccCCCCCCCCCccc
Q psy11111 62 TYSCVHCRAHLASHDELI 79 (84)
Q Consensus 62 iYsC~~C~tHLA~~ddLI 79 (84)
+|.|..|+.-+.+.+.|+
T Consensus 1 ~~~C~~C~~~F~~~~~l~ 18 (27)
T PF13912_consen 1 PFECDECGKTFSSLSALR 18 (27)
T ss_dssp SEEETTTTEEESSHHHHH
T ss_pred CCCCCccCCccCChhHHH
Confidence 589999998877766554
No 8
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target. The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=43.03 E-value=5.4 Score=19.07 Aligned_cols=17 Identities=29% Similarity=0.677 Sum_probs=13.5
Q ss_pred EEcccCCCCCCCCCccc
Q psy11111 63 YSCVHCRAHLASHDELI 79 (84)
Q Consensus 63 YsC~~C~tHLA~~ddLI 79 (84)
|.|..|+.-+....+|.
T Consensus 1 y~C~~C~~~f~~~~~l~ 17 (23)
T PF00096_consen 1 YKCPICGKSFSSKSNLK 17 (23)
T ss_dssp EEETTTTEEESSHHHHH
T ss_pred CCCCCCCCccCCHHHHH
Confidence 78999998888776654
No 9
>PRK04860 hypothetical protein; Provisional
Probab=41.85 E-value=13 Score=26.86 Aligned_cols=20 Identities=25% Similarity=0.496 Sum_probs=14.8
Q ss_pred CCceEEcccCCCCCCCCCcc
Q psy11111 59 CHRTYSCVHCRAHLASHDEL 78 (84)
Q Consensus 59 g~riYsC~~C~tHLA~~ddL 78 (84)
+.+.|.|..|+-.|...+++
T Consensus 140 g~~~YrC~~C~~~l~~~~~~ 159 (160)
T PRK04860 140 GEAVYRCRRCGETLVFKGEQ 159 (160)
T ss_pred CCccEECCCCCceeEEeccc
Confidence 45678888888888766654
No 10
>PF03691 UPF0167: Uncharacterised protein family (UPF0167); InterPro: IPR005363 The proteins in this family are about 200 amino acids long and each contain 3 CXXC motifs.
Probab=41.12 E-value=13 Score=27.65 Aligned_cols=25 Identities=28% Similarity=0.630 Sum_probs=17.0
Q ss_pred hhhhcCCCCc----eEEcccCCCCCCCCC
Q psy11111 52 FQAYLPNCHR----TYSCVHCRAHLASHD 76 (84)
Q Consensus 52 F~~YL~~g~r----iYsC~~C~tHLA~~d 76 (84)
++++|.+++. .|.|.+|+.|+...|
T Consensus 146 l~~~l~~~G~~~gYlFrClhCgk~~l~~D 174 (176)
T PF03691_consen 146 LEEYLVKGGDMQGYLFRCLHCGKHRLYVD 174 (176)
T ss_pred HHHHhcCCCceEEEEEEcCcCCcEEEEee
Confidence 4566644432 599999999976543
No 11
>TIGR00319 desulf_FeS4 desulfoferrodoxin FeS4 iron-binding domain. Neelaredoxin, a monomeric blue non-heme iron protein, lacks this domain.
Probab=40.03 E-value=19 Score=19.39 Aligned_cols=13 Identities=23% Similarity=0.687 Sum_probs=10.8
Q ss_pred ceEEcccCCCCCC
Q psy11111 61 RTYSCVHCRAHLA 73 (84)
Q Consensus 61 riYsC~~C~tHLA 73 (84)
++|.|..|++-+.
T Consensus 6 ~~ykC~~Cgniv~ 18 (34)
T TIGR00319 6 QVYKCEVCGNIVE 18 (34)
T ss_pred cEEEcCCCCcEEE
Confidence 6999999998653
No 12
>PF12572 DUF3752: Protein of unknown function (DUF3752); InterPro: IPR022226 This domain family is found in eukaryotes, and is typically between 140 and 163 amino acids in length.
Probab=40.00 E-value=8.5 Score=26.95 Aligned_cols=18 Identities=33% Similarity=0.579 Sum_probs=13.7
Q ss_pred cceeeeeecCCccceeccc
Q psy11111 7 AVDSVWTVDTPQDYCWRHS 25 (84)
Q Consensus 7 ~~~~~~~~~~~~~~~~~~~ 25 (84)
+++|+|| |||++-=-|-.
T Consensus 30 ~d~S~WT-eTP~ek~~Rl~ 47 (152)
T PF12572_consen 30 GDRSSWT-ETPEEKAKRLA 47 (152)
T ss_pred CCccccc-cCHHHHHHhhh
Confidence 4899998 89998655543
No 13
>KOG0856|consensus
Probab=38.89 E-value=18 Score=26.70 Aligned_cols=15 Identities=27% Similarity=0.629 Sum_probs=12.7
Q ss_pred CceEEcccCCCCCCC
Q psy11111 60 HRTYSCVHCRAHLAS 74 (84)
Q Consensus 60 ~riYsC~~C~tHLA~ 74 (84)
+-||.|+.|+++|=.
T Consensus 52 ~GvY~C~~C~~pLyk 66 (146)
T KOG0856|consen 52 EGVYVCAGCGTPLYK 66 (146)
T ss_pred CceEEEeecCCcccc
Confidence 469999999999854
No 14
>KOG2462|consensus
Probab=38.83 E-value=10 Score=30.48 Aligned_cols=21 Identities=29% Similarity=0.667 Sum_probs=17.7
Q ss_pred CCceEEcccCCCCCCCCCccc
Q psy11111 59 CHRTYSCVHCRAHLASHDELI 79 (84)
Q Consensus 59 g~riYsC~~C~tHLA~~ddLI 79 (84)
|+++|+|.+|+.-+|....|-
T Consensus 212 GEKPF~C~hC~kAFADRSNLR 232 (279)
T KOG2462|consen 212 GEKPFSCPHCGKAFADRSNLR 232 (279)
T ss_pred CCCCccCCcccchhcchHHHH
Confidence 568999999999998877664
No 15
>cd00974 DSRD Desulforedoxin (DSRD) domain; a small non-heme iron domain present in the desulforedoxin (rubredoxin oxidoreductase) and desulfoferrodoxin proteins of some archeael and bacterial methanogens and sulfate/sulfur reducers. Desulforedoxin is a small, single-domain homodimeric protein; each subunit contains an iron atom bound to four cysteinyl sulfur atoms, Fe(S-Cys)4, in a distorted tetrahedral coordination. Its metal center is similar to that found in rubredoxin type proteins. Desulforedoxin is regarded as a potential redox partner for rubredoxin. Desulfoferrodoxin forms a homodimeric protein, with each protomer comprised of two domains, the N-terminal DSRD domain and C-terminal superoxide reductase-like (SORL) domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].
Probab=38.07 E-value=21 Score=19.25 Aligned_cols=13 Identities=23% Similarity=0.654 Sum_probs=10.7
Q ss_pred ceEEcccCCCCCC
Q psy11111 61 RTYSCVHCRAHLA 73 (84)
Q Consensus 61 riYsC~~C~tHLA 73 (84)
.+|.|..|++-+.
T Consensus 3 ~~ykC~~CGniv~ 15 (34)
T cd00974 3 EVYKCEICGNIVE 15 (34)
T ss_pred cEEEcCCCCcEEE
Confidence 6899999998653
No 16
>PRK11586 napB nitrate reductase cytochrome C550 subunit; Provisional
Probab=37.65 E-value=26 Score=25.96 Aligned_cols=34 Identities=21% Similarity=0.300 Sum_probs=26.8
Q ss_pred hhhhhhhhcCCCCceEEcccCCCCCCCCCccccCCCC
Q psy11111 48 MVKTFQAYLPNCHRTYSCVHCRAHLASHDELISKIPR 84 (84)
Q Consensus 48 MGRlF~~YL~~g~riYsC~~C~tHLA~~ddLISKsFq 84 (84)
-|+.. ..+ .+|.|-|..|+++=++..-|+--.|+
T Consensus 109 ~Gk~l-~~v--sprRYfCtQCHVPQada~PLV~N~F~ 142 (149)
T PRK11586 109 DGKVG-AEV--APRRYFCLQCHVPQADTAPIVGNTFT 142 (149)
T ss_pred CCCCc-ccc--CccceeeccccCccccCccCCCCCcc
Confidence 34443 445 35899999999999999999988885
No 17
>PF10955 DUF2757: Protein of unknown function (DUF2757); InterPro: IPR020115 This entry contains proteins with no known function.
Probab=35.75 E-value=16 Score=24.09 Aligned_cols=15 Identities=33% Similarity=0.891 Sum_probs=12.3
Q ss_pred eEEcccCCCCCCCCC
Q psy11111 62 TYSCVHCRAHLASHD 76 (84)
Q Consensus 62 iYsC~~C~tHLA~~d 76 (84)
.|.|++|++-++.-+
T Consensus 4 ~Y~CRHCg~~IG~i~ 18 (76)
T PF10955_consen 4 HYYCRHCGTKIGTID 18 (76)
T ss_pred EEEecCCCCEEEEee
Confidence 599999999887654
No 18
>PF06397 Desulfoferrod_N: Desulfoferrodoxin, N-terminal domain; InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=35.33 E-value=21 Score=20.53 Aligned_cols=13 Identities=31% Similarity=0.772 Sum_probs=7.8
Q ss_pred CceEEcccCCCCC
Q psy11111 60 HRTYSCVHCRAHL 72 (84)
Q Consensus 60 ~riYsC~~C~tHL 72 (84)
..+|.|..|++-+
T Consensus 4 ~~~YkC~~CGniV 16 (36)
T PF06397_consen 4 GEFYKCEHCGNIV 16 (36)
T ss_dssp TEEEE-TTT--EE
T ss_pred ccEEEccCCCCEE
Confidence 3799999998744
No 19
>PF03811 Zn_Tnp_IS1: InsA N-terminal domain; InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=35.28 E-value=26 Score=19.80 Aligned_cols=12 Identities=42% Similarity=1.115 Sum_probs=9.8
Q ss_pred CCCceEEcccCC
Q psy11111 58 NCHRTYSCVHCR 69 (84)
Q Consensus 58 ~g~riYsC~~C~ 69 (84)
.|...|.|+.|+
T Consensus 25 ~G~qryrC~~C~ 36 (36)
T PF03811_consen 25 SGHQRYRCKDCR 36 (36)
T ss_pred CCCEeEecCcCC
Confidence 466889999996
No 20
>PF13842 Tnp_zf-ribbon_2: DDE_Tnp_1-like zinc-ribbon
Probab=34.83 E-value=26 Score=19.17 Aligned_cols=14 Identities=29% Similarity=0.733 Sum_probs=11.3
Q ss_pred ceEEcccCCCCCCC
Q psy11111 61 RTYSCVHCRAHLAS 74 (84)
Q Consensus 61 riYsC~~C~tHLA~ 74 (84)
-.|.|..|+.+|-.
T Consensus 15 T~~~C~~C~v~lC~ 28 (32)
T PF13842_consen 15 TRYMCSKCDVPLCV 28 (32)
T ss_pred eEEEccCCCCcccC
Confidence 36999999988754
No 21
>PF06524 NOA36: NOA36 protein; InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=34.23 E-value=23 Score=28.91 Aligned_cols=20 Identities=25% Similarity=0.677 Sum_probs=17.1
Q ss_pred CCceEEcccCCCCCCCCCcc
Q psy11111 59 CHRTYSCVHCRAHLASHDEL 78 (84)
Q Consensus 59 g~riYsC~~C~tHLA~~ddL 78 (84)
|+|||.|..|...|--.|+.
T Consensus 139 GGrif~CsfC~~flCEDDQF 158 (314)
T PF06524_consen 139 GGRIFKCSFCDNFLCEDDQF 158 (314)
T ss_pred CCeEEEeecCCCeeeccchh
Confidence 67999999999999877764
No 22
>PRK05508 methionine sulfoxide reductase B; Provisional
Probab=33.37 E-value=25 Score=24.94 Aligned_cols=17 Identities=35% Similarity=0.702 Sum_probs=13.7
Q ss_pred CceEEcccCCCCCCCCC
Q psy11111 60 HRTYSCVHCRAHLASHD 76 (84)
Q Consensus 60 ~riYsC~~C~tHLA~~d 76 (84)
.-+|.|+.|+++|=..+
T Consensus 31 ~G~Y~C~~Cg~pLF~S~ 47 (119)
T PRK05508 31 KGTYVCKQCGAPLYRSE 47 (119)
T ss_pred CeEEEecCCCCcccccc
Confidence 46999999999985544
No 23
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=33.03 E-value=18 Score=18.31 Aligned_cols=13 Identities=23% Similarity=0.762 Sum_probs=10.8
Q ss_pred ceEEcccCCCCCC
Q psy11111 61 RTYSCVHCRAHLA 73 (84)
Q Consensus 61 riYsC~~C~tHLA 73 (84)
.-|.|..|+..|+
T Consensus 26 ~Cf~C~~C~~~L~ 38 (39)
T smart00132 26 ECFKCSKCGKPLG 38 (39)
T ss_pred cCCCCcccCCcCc
Confidence 4589999999886
No 24
>cd08585 GDPD_like_3 Glycerophosphodiester phosphodiesterase domain of uncharacterized bacterial glycerophosphodiester phosphodiesterases. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in a group of uncharacterized bacterial glycerophosphodiester phosphodiesterase and similar proteins. They show high sequence similarity with Escherichia coli glycerophosphodiester phosphodiesterase, which catalyzes the degradation of glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols.
Probab=32.98 E-value=14 Score=27.20 Aligned_cols=11 Identities=55% Similarity=0.881 Sum_probs=8.9
Q ss_pred eeeeecCCccc
Q psy11111 10 SVWTVDTPQDY 20 (84)
Q Consensus 10 ~~~~~~~~~~~ 20 (84)
.|||||+|++.
T Consensus 213 ~vWTVnd~~~~ 223 (237)
T cd08585 213 IVWTVRTEEDI 223 (237)
T ss_pred EEEeCCCHHHH
Confidence 48999999864
No 25
>TIGR00357 methionine-R-sulfoxide reductase. This model describes a domain found in PilB, a protein important for pilin expression, N-terminal to a domain coextensive to with the known peptide methionine sulfoxide reductase (MsrA), a protein repair enzyme, of E. coli. Among the early completed genomes, this module is found if and only if MsrA is also found, whether N-terminal to MsrA (as for Helicobacter pylori), C-terminal (as for Treponema pallidum), or in a separate polypeptide. Although the function of this region is not clear, an auxiliary function to MsrA is suggested.
Probab=32.91 E-value=25 Score=25.28 Aligned_cols=17 Identities=24% Similarity=0.413 Sum_probs=13.7
Q ss_pred CceEEcccCCCCCCCCC
Q psy11111 60 HRTYSCVHCRAHLASHD 76 (84)
Q Consensus 60 ~riYsC~~C~tHLA~~d 76 (84)
.-+|.|+.|+++|=..+
T Consensus 38 ~G~Y~C~~Cg~pLF~S~ 54 (134)
T TIGR00357 38 EGIYVDITCGEPLFSSE 54 (134)
T ss_pred CeEEEccCCCCcccccc
Confidence 45899999999986544
No 26
>PRK05978 hypothetical protein; Provisional
Probab=30.93 E-value=22 Score=25.76 Aligned_cols=26 Identities=27% Similarity=0.538 Sum_probs=20.6
Q ss_pred hhhhhhhhcCCCCceEEcccCCCCCCCCC
Q psy11111 48 MVKTFQAYLPNCHRTYSCVHCRAHLASHD 76 (84)
Q Consensus 48 MGRlF~~YL~~g~riYsC~~C~tHLA~~d 76 (84)
-|++|..||. -.=.|.+|+..+..++
T Consensus 41 ~G~LF~g~Lk---v~~~C~~CG~~~~~~~ 66 (148)
T PRK05978 41 EGKLFRAFLK---PVDHCAACGEDFTHHR 66 (148)
T ss_pred CCcccccccc---cCCCccccCCccccCC
Confidence 7899999992 3458999999887653
No 27
>cd08573 GDPD_GDE1 Glycerophosphodiester phosphodiesterase domain of mammalian glycerophosphodiester phosphodiesterase GDE1 and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in mammalian GDE1 (also known as MIR16, membrane interacting protein of RGS16) and their metazoan homologs. GDE1 is widely expressed in mammalian tissues, including the heart, brain, liver, and kidney. It shows sequence homology to bacterial glycerophosphodiester phosphodiesterases (GP-GDEs, EC 3.1.4.46), which catalyzes the hydrolysis of various glycerophosphodiesters, and produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols. GDE1 has been characterized as GPI-GDE (EC 3.1.4.44) that selectively hydrolyzes extracellular glycerophosphoinositol (GPI) to generate glycerol phosphate and inositol. It functions as an integral membrane-bound glycoprotein interacting with regulator of G protein signaling protein RGS16, and is modulated by G
Probab=30.63 E-value=16 Score=27.17 Aligned_cols=12 Identities=42% Similarity=0.803 Sum_probs=9.8
Q ss_pred eeeeecCCccce
Q psy11111 10 SVWTVDTPQDYC 21 (84)
Q Consensus 10 ~~~~~~~~~~~~ 21 (84)
.+||||+|++.-
T Consensus 232 ~vWTVn~~~~~~ 243 (258)
T cd08573 232 IAWTVNTPTEKQ 243 (258)
T ss_pred EEEecCCHHHHH
Confidence 589999998753
No 28
>PRK00222 methionine sulfoxide reductase B; Provisional
Probab=30.62 E-value=26 Score=25.43 Aligned_cols=17 Identities=35% Similarity=0.710 Sum_probs=13.6
Q ss_pred CceEEcccCCCCCCCCC
Q psy11111 60 HRTYSCVHCRAHLASHD 76 (84)
Q Consensus 60 ~riYsC~~C~tHLA~~d 76 (84)
.-+|.|+.|+++|=..+
T Consensus 41 ~G~Y~C~~Cg~pLF~S~ 57 (142)
T PRK00222 41 KGIYVCIVCGEPLFSSD 57 (142)
T ss_pred CeEEEecCCCchhcCCc
Confidence 45999999999985543
No 29
>PF04828 GFA: Glutathione-dependent formaldehyde-activating enzyme; InterPro: IPR006913 The GFA family consists mainly of glutathione-dependent formaldehyde-activating enzymes, but also includes centromere protein V and a fission yeast protein described as uncharacterised lyase. Glutathione-dependent formaldehyde-activating enzyme catalyse the condensation of formaldehyde and glutathione to S-hydroxymethylglutathione. All known members of this family contain 5 strongly conserved cysteine residues.; GO: 0016846 carbon-sulfur lyase activity, 0008152 metabolic process; PDB: 3FAC_B 1XA8_A 1X6M_B.
Probab=30.18 E-value=26 Score=20.83 Aligned_cols=15 Identities=33% Similarity=0.600 Sum_probs=10.8
Q ss_pred CceEEcccCCCCCCC
Q psy11111 60 HRTYSCVHCRAHLAS 74 (84)
Q Consensus 60 ~riYsC~~C~tHLA~ 74 (84)
.+.+-|++|+++|..
T Consensus 46 ~~r~FC~~CGs~l~~ 60 (92)
T PF04828_consen 46 VERYFCPTCGSPLFS 60 (92)
T ss_dssp CEEEEETTT--EEEE
T ss_pred CcCcccCCCCCeeec
Confidence 367999999999974
No 30
>PF01641 SelR: SelR domain; InterPro: IPR002579 Peptide methionine sulphoxide reductase (Msr) reverses the inactivation of many proteins due to the oxidation of critical methionine residues by reducing methionine sulphoxide, Met(O), to methionine []. It is present in most living organisms, and the cognate structural gene belongs to the so-called minimum gene set [, ]. The domains: MsrA and MsrB, reduce different epimeric forms of methionine sulphoxide. This group represents MsrB, the crystal structure of which has been determined to 1.8A []. The overall structure shows no resemblance to the structures of MsrA (IPR002569 from INTERPRO) from other organisms; though the active sites show approximate mirror symmetry. In each case, conserved amino acid motifs mediate the stereo-specific recognition and reduction of the substrate. Unlike the MsrA domain, the MsrB domain activates the cysteine or selenocysteine nucleophile through a unique Cys-Arg-Asp/Glu catalytic triad. The collapse of the reaction intermediate most likely results in the formation of a sulphenic or selenenic acid moiety. Regeneration of the active site occurs through a series of thiol-disulphide exchange steps involving another active site Cys residue and thioredoxin. In a number of pathogenic bacteria, including Neisseria gonorrhoeae, the MsrA and MsrB domains are fused; the MsrA being N-terminal to MsrB. This arrangement is reversed in Treponema pallidum. In N. gonorrhoeae and Neisseria meningitidis, a thioredoxin domain is fused to the N terminus. This may function to reduce the active sites of the downstream MsrA and MsrB domains. ; GO: 0008113 peptide-methionine-(S)-S-oxide reductase activity, 0055114 oxidation-reduction process; PDB: 1L1D_A 3E0O_D 2KZN_A 3HCG_B 3HCH_A 2L1U_A 3MAO_A 2K8D_A 3HCJ_A 3HCI_A ....
Probab=29.62 E-value=23 Score=25.03 Aligned_cols=15 Identities=33% Similarity=0.647 Sum_probs=11.4
Q ss_pred CceEEcccCCCCCCC
Q psy11111 60 HRTYSCVHCRAHLAS 74 (84)
Q Consensus 60 ~riYsC~~C~tHLA~ 74 (84)
.-+|.|+.|+++|=.
T Consensus 35 ~G~Y~C~~Cg~pLF~ 49 (124)
T PF01641_consen 35 EGIYVCAVCGTPLFS 49 (124)
T ss_dssp SEEEEETTTS-EEEE
T ss_pred CEEEEcCCCCCcccc
Confidence 459999999998843
No 31
>cd08581 GDPD_like_1 Glycerophosphodiester phosphodiesterase domain of uncharacterized bacterial glycerophosphodiester phosphodiesterases. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in a group of uncharacterized bacterial glycerophosphodiester phosphodiesterase and similar proteins. They show high sequence similarity to Escherichia coli glycerophosphodiester phosphodiesterase, which catalyzes the degradation of glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols.
Probab=29.08 E-value=18 Score=26.33 Aligned_cols=11 Identities=18% Similarity=0.592 Sum_probs=9.4
Q ss_pred eeeeecCCccc
Q psy11111 10 SVWTVDTPQDY 20 (84)
Q Consensus 10 ~~~~~~~~~~~ 20 (84)
.|||||+|.+.
T Consensus 203 ~vWTVn~~~~~ 213 (229)
T cd08581 203 VIYEVNEPAEA 213 (229)
T ss_pred EEEEcCCHHHH
Confidence 58999999875
No 32
>PRK15272 pertussis toxin-like subunit ArtA; Provisional
Probab=28.96 E-value=29 Score=27.52 Aligned_cols=12 Identities=50% Similarity=0.656 Sum_probs=10.4
Q ss_pred cccceeeeeecC
Q psy11111 5 STAVDSVWTVDT 16 (84)
Q Consensus 5 ~~~~~~~~~~~~ 16 (84)
+-|+|-||.|||
T Consensus 16 ~~Apd~VyRVDt 27 (242)
T PRK15272 16 NYAVDFVYRVDS 27 (242)
T ss_pred ccCceEEEEcCC
Confidence 457999999998
No 33
>PRK08270 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=28.90 E-value=37 Score=29.49 Aligned_cols=16 Identities=19% Similarity=0.289 Sum_probs=14.1
Q ss_pred eeeecCCccceecccc
Q psy11111 11 VWTVDTPQDYCWRHSS 26 (84)
Q Consensus 11 ~~~~~~~~~~~~~~~~ 26 (84)
-|++.+|-|+|-.|..
T Consensus 619 Y~~in~~~~~C~~CG~ 634 (656)
T PRK08270 619 YITITPTFSICPKHGY 634 (656)
T ss_pred eEEeCCCCcccCCCCC
Confidence 5899999999998875
No 34
>COG1861 SpsF Spore coat polysaccharide biosynthesis protein F, CMP-KDO synthetase homolog [Cell envelope biogenesis, outer membrane]
Probab=28.68 E-value=18 Score=28.65 Aligned_cols=12 Identities=42% Similarity=0.565 Sum_probs=10.2
Q ss_pred eeeeecCCccce
Q psy11111 10 SVWTVDTPQDYC 21 (84)
Q Consensus 10 ~~~~~~~~~~~~ 21 (84)
--|||||++|+=
T Consensus 187 ~RltvDt~eD~~ 198 (241)
T COG1861 187 YRLTVDTQEDFA 198 (241)
T ss_pred eEEEeccHHHHH
Confidence 469999999984
No 35
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=27.65 E-value=32 Score=19.47 Aligned_cols=15 Identities=20% Similarity=0.736 Sum_probs=10.3
Q ss_pred eEEcccCCCCCCCCC
Q psy11111 62 TYSCVHCRAHLASHD 76 (84)
Q Consensus 62 iYsC~~C~tHLA~~d 76 (84)
.|.|.+|++.+...+
T Consensus 3 ~y~C~~CG~~~~~~~ 17 (46)
T PRK00398 3 EYKCARCGREVELDE 17 (46)
T ss_pred EEECCCCCCEEEECC
Confidence 578888887765443
No 36
>cd08583 PI-PLCc_GDPD_SF_unchar1 Uncharacterized hypothetical proteins similar to the catalytic domains of Phosphoinositide-specific phospholipaseand Glycerophosphodiester phosphodiesterases. This subfamily corresponds to a group of uncharacterized hypothetical proteins similar to the catalytic domains of Phosphoinositide-specific phospholipase C (PI-PLC), and glycerophosphodiester phosphodiesterases (GP-GDE), and also sphingomyelinases D (SMases D) and similar proteins. They hydrolyze the 3'-5' phosphodiester bonds in different substrates, utilizing a similar mechanism of general base and acid catalysis involving two conserved histidine residues.
Probab=26.34 E-value=21 Score=25.73 Aligned_cols=12 Identities=25% Similarity=0.354 Sum_probs=9.8
Q ss_pred eeeeecCCccce
Q psy11111 10 SVWTVDTPQDYC 21 (84)
Q Consensus 10 ~~~~~~~~~~~~ 21 (84)
.|||||+|+++-
T Consensus 209 ~vwTVn~~~~~~ 220 (237)
T cd08583 209 YVYTINDLKDAQ 220 (237)
T ss_pred EEEeCCCHHHHH
Confidence 589999998753
No 37
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=25.66 E-value=17 Score=16.54 Aligned_cols=16 Identities=31% Similarity=0.729 Sum_probs=10.2
Q ss_pred EEcccCCCCCCCCCcc
Q psy11111 63 YSCVHCRAHLASHDEL 78 (84)
Q Consensus 63 YsC~~C~tHLA~~ddL 78 (84)
|.|..|+.-+.+.++|
T Consensus 1 ~~C~~C~~~~~~~~~l 16 (24)
T PF13894_consen 1 FQCPICGKSFRSKSEL 16 (24)
T ss_dssp EE-SSTS-EESSHHHH
T ss_pred CCCcCCCCcCCcHHHH
Confidence 6788898777766654
No 38
>cd08580 GDPD_Rv2277c_like Glycerophosphodiester phosphodiesterase domain of uncharacterized bacterial protein Rv2277c and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in uncharacterized bacterial protein Rv2277c and similar proteins. Members in this subfamily are bacterial homologous of mammalian GDE4, a transmembrane protein whose cellular function has not yet been elucidated.
Probab=24.58 E-value=27 Score=26.54 Aligned_cols=11 Identities=27% Similarity=0.752 Sum_probs=9.3
Q ss_pred eeeeecCCccc
Q psy11111 10 SVWTVDTPQDY 20 (84)
Q Consensus 10 ~~~~~~~~~~~ 20 (84)
.+||||+|++.
T Consensus 234 ~~WTVN~~~~~ 244 (263)
T cd08580 234 VLFGINTADDY 244 (263)
T ss_pred EEEEeCCHHHH
Confidence 58999999874
No 39
>cd08565 GDPD_pAtGDE_like Glycerophosphodiester phosphodiesterase domain of putative Agrobacterium tumefaciens glycerophosphodiester phosphodiesterase and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in putative Agrobacterium tumefaciens glycerophosphodiester phosphodiesterase (pAtGDE, EC 3.1.4.46) and its uncharacterized homologs. Members in this family show high sequence similarity to Escherichia coli GP-GDE, which catalyzes the degradation of glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols.
Probab=24.19 E-value=23 Score=25.87 Aligned_cols=11 Identities=36% Similarity=0.634 Sum_probs=9.1
Q ss_pred eeeeecCCccc
Q psy11111 10 SVWTVDTPQDY 20 (84)
Q Consensus 10 ~~~~~~~~~~~ 20 (84)
.+||||+++++
T Consensus 205 ~~WTVn~~~~~ 215 (235)
T cd08565 205 GVWTVNDDSLI 215 (235)
T ss_pred EEEccCCHHHH
Confidence 37999999875
No 40
>PF03892 NapB: Nitrate reductase cytochrome c-type subunit (NapB); InterPro: IPR005591 The napB gene encodes a dihaem cytochrome c, the small subunit of a heterodimeric periplasmic nitrate reductase [].; PDB: 3O5A_B 3ML1_B 1OGY_L 1JNI_A.
Probab=23.68 E-value=28 Score=24.97 Aligned_cols=25 Identities=24% Similarity=0.522 Sum_probs=15.2
Q ss_pred CceEEcccCCCCCCCCCccccCCCC
Q psy11111 60 HRTYSCVHCRAHLASHDELISKIPR 84 (84)
Q Consensus 60 ~riYsC~~C~tHLA~~ddLISKsFq 84 (84)
++.|-|..|+++=++.+-||--.|+
T Consensus 107 ~~RyfC~qCHvpQ~da~PlV~N~F~ 131 (133)
T PF03892_consen 107 PRRYFCTQCHVPQADAKPLVENTFK 131 (133)
T ss_dssp CCCCSGGGT--B-BSS--SS-B--B
T ss_pred cceeeeccccCccccCccCCCCCcc
Confidence 5889999999999999999988874
No 41
>cd08574 GDPD_GDE_2_3_6 Glycerophosphodiester phosphodiesterase domain of mammalian glycerophosphodiester phosphodiesterase GDE2, GDE3, GDE6-like proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in mammalian glycerophosphodiester phosphodiesterase domain-containing protein subtype 5 (GDE2), subtype 2 (GDE3), subtype 1 (GDE6), and their eukaryotic homologs. Mammalian GDE2, GDE3, and GDE6 show very high sequence similarity to each other and have been classified into the same family. Although they are all transmembrane proteins, based on different pattern of tissue distribution, these enzymes might display diverse cellular functions. Mammalian GDE2 is primarily expressed in mature neurons. It selectively hydrolyzes glycerophosphocholine (GPC) and mainly functions in a complex with an antioxidant scavenger peroxiredoxin1 (Prdx1) to control motor neuron differentiation in the spinal cord. Mammalian GDE3 is specifically expressed in bo
Probab=23.62 E-value=23 Score=26.12 Aligned_cols=12 Identities=25% Similarity=0.587 Sum_probs=9.8
Q ss_pred eeeeecCCccce
Q psy11111 10 SVWTVDTPQDYC 21 (84)
Q Consensus 10 ~~~~~~~~~~~~ 21 (84)
.+||||+|+++.
T Consensus 227 ~~WTVn~~~~~~ 238 (252)
T cd08574 227 NLYVVNEPWLYS 238 (252)
T ss_pred EEEccCCHHHHH
Confidence 489999998764
No 42
>cd08608 GDPD_GDE2 Glycerophosphodiester phosphodiesterase domain of mammalian glycerophosphodiester phosphodiesterase GDE2 and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in mammalian GDE2 (also known as glycerophosphodiester phosphodiesterase domain-containing protein 5 (GDPD5)) and their metazoan homologs. Mammalian GDE2 is transmembrane protein primarily expressed in mature neurons. It is a mammalian homolog of bacterial glycerophosphodiester phosphodiesterases (GP-GDEs, EC 3.1.4.46), which catalyze the hydrolysis of various glycerophosphodiesters, and produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols. Mammalian GDE2 selectively hydrolyzes glycerophosphocholine (GPC) and has been characterized as GPC-GDE (EC 3.1.4.2) that contributes to osmotic regulation of cellular GPC. Mammalian GDE2 functions in a complex with an antioxidant scavenger peroxiredoxin1 (Prdx1) to control motor neuron differenti
Probab=23.32 E-value=26 Score=28.05 Aligned_cols=11 Identities=36% Similarity=0.712 Sum_probs=9.4
Q ss_pred eeeeecCCccc
Q psy11111 10 SVWTVDTPQDY 20 (84)
Q Consensus 10 ~~~~~~~~~~~ 20 (84)
.|||||+|+++
T Consensus 227 ~vWTVN~~~~~ 237 (351)
T cd08608 227 NLYTVNEPWLY 237 (351)
T ss_pred EEEecCCHHHH
Confidence 58999999875
No 43
>COG5349 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=23.27 E-value=35 Score=24.66 Aligned_cols=26 Identities=19% Similarity=0.382 Sum_probs=19.0
Q ss_pred hhhhhhhhcCCCCceEEcccCCCCCCCCC
Q psy11111 48 MVKTFQAYLPNCHRTYSCVHCRAHLASHD 76 (84)
Q Consensus 48 MGRlF~~YL~~g~riYsC~~C~tHLA~~d 76 (84)
=||+|+.||- ..=.|..|+-.+..+|
T Consensus 29 eGrLF~gFLK---~~p~C~aCG~dyg~~~ 54 (126)
T COG5349 29 EGRLFRGFLK---VVPACEACGLDYGFAD 54 (126)
T ss_pred Cchhhhhhcc---cCchhhhccccccCCc
Confidence 5899999992 3458999987655443
No 44
>COG3043 NapB Nitrate reductase cytochrome c-type subunit [Energy production and conversion]
Probab=23.21 E-value=58 Score=24.34 Aligned_cols=26 Identities=23% Similarity=0.514 Sum_probs=22.9
Q ss_pred CCceEEcccCCCCCCCCCccccCCCC
Q psy11111 59 CHRTYSCVHCRAHLASHDELISKIPR 84 (84)
Q Consensus 59 g~riYsC~~C~tHLA~~ddLISKsFq 84 (84)
.+|.|-|-.|+.+=|+.+-|+-..|+
T Consensus 123 SPRRYFClQCHVPQaD~kPlV~N~F~ 148 (155)
T COG3043 123 SPRRYFCLQCHVPQADVKPLVGNTFK 148 (155)
T ss_pred CccceeeeecccccccccccCCCCcc
Confidence 35899999999999999999988874
No 45
>cd08575 GDPD_GDE4_like Glycerophosphodiester phosphodiesterase domain of mammalian glycerophosphodiester phosphodiesterase GDE4-like proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in mammalian GDE4 (also known as glycerophosphodiester phosphodiesterase domain-containing protein 1 (GDPD1)) and similar proteins. Mammalian GDE4 is a transmembrane protein whose cellular function is not elucidated. It is expressed widely, including in placenta, liver, kidney, pancreas, spleen, thymus, ovary, small intestine and peripheral blood leukocytes. It is also expressed in the growth cones in neuroblastoma Neuro2a cells, which suggests mammalian GDE4 may play some distinct role from other members of mammalian GDEs family. Also included in this subfamily are uncharacterized mammalian glycerophosphodiester phosphodiesterase domain-containing protein 3 (GDPD3) and similar proteins which display very high sequence homology to mammalian GDE4.
Probab=22.88 E-value=31 Score=25.57 Aligned_cols=11 Identities=18% Similarity=0.881 Sum_probs=9.2
Q ss_pred eeeeecCCccc
Q psy11111 10 SVWTVDTPQDY 20 (84)
Q Consensus 10 ~~~~~~~~~~~ 20 (84)
.+||||+++++
T Consensus 235 ~vWTVNd~~~~ 245 (264)
T cd08575 235 YLWVLNDEEDF 245 (264)
T ss_pred EEEEECCHHHH
Confidence 58999999875
No 46
>cd08612 GDPD_GDE4 Glycerophosphodiester phosphodiesterase domain of mammalian glycerophosphodiester phosphodiesterase GDE4 and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in mammalian GDE4 (also known as glycerophosphodiester phosphodiesterase domain-containing protein 1 (GDPD1)) and similar proteins. Mammalian GDE4 is a transmembrane protein whose cellular function has not yet been elucidated. It is expressed widely, including in placenta, liver, kidney, pancreas, spleen, thymus, ovary, small intestine and peripheral blood leukocytes. It is also expressed in the growth cones in neuroblastoma Neuro2a cells, which suggests GDE4 may play some distinct role from other members of the GDE family.
Probab=22.85 E-value=27 Score=26.47 Aligned_cols=11 Identities=9% Similarity=0.667 Sum_probs=9.2
Q ss_pred eeeeecCCccc
Q psy11111 10 SVWTVDTPQDY 20 (84)
Q Consensus 10 ~~~~~~~~~~~ 20 (84)
.|||||+|+++
T Consensus 265 ~vWTVNd~~~~ 275 (300)
T cd08612 265 YGWVLNDEEEF 275 (300)
T ss_pred EEeecCCHHHH
Confidence 58999999864
No 47
>PRK14704 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=22.15 E-value=51 Score=28.57 Aligned_cols=16 Identities=25% Similarity=0.318 Sum_probs=14.1
Q ss_pred eeeecCCccceecccc
Q psy11111 11 VWTVDTPQDYCWRHSS 26 (84)
Q Consensus 11 ~~~~~~~~~~~~~~~~ 26 (84)
.|++.+|-|+|-.|..
T Consensus 552 Y~sin~~~~~C~~CGy 567 (618)
T PRK14704 552 YGSINHPVDRCKCCSY 567 (618)
T ss_pred eEEeCCCCeecCCCCC
Confidence 5899999999998875
No 48
>PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target. This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include: Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types. Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein. Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO). Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation []. Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6. These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is: C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD] LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=21.98 E-value=41 Score=18.76 Aligned_cols=16 Identities=25% Similarity=0.681 Sum_probs=13.6
Q ss_pred ceEEcccCCCCCCCCC
Q psy11111 61 RTYSCVHCRAHLASHD 76 (84)
Q Consensus 61 riYsC~~C~tHLA~~d 76 (84)
.-|.|..|+..|...+
T Consensus 25 ~Cf~C~~C~~~l~~~~ 40 (58)
T PF00412_consen 25 ECFKCSKCGKPLNDGD 40 (58)
T ss_dssp TTSBETTTTCBTTTSS
T ss_pred cccccCCCCCccCCCe
Confidence 4589999999998775
No 49
>PF13717 zinc_ribbon_4: zinc-ribbon domain
Probab=21.78 E-value=43 Score=18.55 Aligned_cols=18 Identities=33% Similarity=0.684 Sum_probs=15.0
Q ss_pred EEcccCCCCCCCCCcccc
Q psy11111 63 YSCVHCRAHLASHDELIS 80 (84)
Q Consensus 63 YsC~~C~tHLA~~ddLIS 80 (84)
..|.+|++-....|+.|.
T Consensus 3 i~Cp~C~~~y~i~d~~ip 20 (36)
T PF13717_consen 3 ITCPNCQAKYEIDDEKIP 20 (36)
T ss_pred EECCCCCCEEeCCHHHCC
Confidence 579999999888888775
No 50
>TIGR01053 LSD1 zinc finger domain, LSD1 subclass. This model describes a putative zinc finger domain found in three closely spaced copies in Arabidopsis protein LSD1 and in two copies in other proteins from the same species. The motif resembles CxxCRxxLMYxxGASxVxCxxC
Probab=21.37 E-value=56 Score=17.94 Aligned_cols=18 Identities=17% Similarity=0.409 Sum_probs=12.5
Q ss_pred hhhcCCCCceEEcccCCCC
Q psy11111 53 QAYLPNCHRTYSCVHCRAH 71 (84)
Q Consensus 53 ~~YL~~g~riYsC~~C~tH 71 (84)
+.|- .|.+-+.|..|++.
T Consensus 11 L~yP-~gA~~vrCs~C~~v 28 (31)
T TIGR01053 11 LMYP-RGASSVRCALCQTV 28 (31)
T ss_pred eecC-CCCCeEECCCCCeE
Confidence 4454 46688889888764
No 51
>TIGR03552 F420_cofC 2-phospho-L-lactate guanylyltransferase CofC. Members of this protein family are the CofC enzyme of coenzyme F420 biosynthesis.
Probab=21.25 E-value=27 Score=23.96 Aligned_cols=10 Identities=50% Similarity=0.813 Sum_probs=8.8
Q ss_pred eeecCCccce
Q psy11111 12 WTVDTPQDYC 21 (84)
Q Consensus 12 ~~~~~~~~~~ 21 (84)
|-||||+||=
T Consensus 175 ~DiDtp~Dl~ 184 (195)
T TIGR03552 175 LDVDTPEDLA 184 (195)
T ss_pred ecCCCHHHHH
Confidence 8999999984
No 52
>TIGR02487 NrdD anaerobic ribonucleoside-triphosphate reductase. This model represents the oxygen-sensitive (anaerobic, class III) ribonucleotide reductase. The mechanism of the enzyme involves a glycine-centered radical, a C-terminal zinc binding site, and a set of conserved active site cysteines and asparagines. This enzyme requires an activating component, NrdG, a radical-SAM domain containing enzyme (TIGR02491). Together the two form an alpha-2/beta-2 heterodimer.
Probab=21.03 E-value=68 Score=27.27 Aligned_cols=17 Identities=18% Similarity=0.413 Sum_probs=14.6
Q ss_pred eeeeecCCccceecccc
Q psy11111 10 SVWTVDTPQDYCWRHSS 26 (84)
Q Consensus 10 ~~~~~~~~~~~~~~~~~ 26 (84)
..|++.+|-|+|-.|..
T Consensus 516 ~Y~~~n~~~~~C~~CG~ 532 (579)
T TIGR02487 516 GYFGINPPVDVCEDCGY 532 (579)
T ss_pred ceEEeccCCccCCCCCC
Confidence 46899999999998865
No 53
>PF06353 DUF1062: Protein of unknown function (DUF1062); InterPro: IPR009412 This entry consists of several hypothetical bacterial proteins of unknown function.
Probab=20.84 E-value=52 Score=23.59 Aligned_cols=9 Identities=33% Similarity=0.969 Sum_probs=8.3
Q ss_pred eEEcccCCC
Q psy11111 62 TYSCVHCRA 70 (84)
Q Consensus 62 iYsC~~C~t 70 (84)
||.|.+|++
T Consensus 13 IYrC~~C~~ 21 (142)
T PF06353_consen 13 IYRCEKCDY 21 (142)
T ss_pred EEEcccCcC
Confidence 899999986
No 54
>cd08568 GDPD_TmGDE_like Glycerophosphodiester phosphodiesterase domain of Thermotoga maritime and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in Thermotoga maritime glycerophosphodiester phosphodiesterase (TmGDE, EC 3.1.4.46) and its uncharacterized homologs. Members in this family show high sequence similarity to Escherichia coli GP-GDE, which catalyzes the degradation of glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols. TmGDE exists as a monomer that might be the biologically relevant form.
Probab=20.80 E-value=29 Score=24.80 Aligned_cols=11 Identities=36% Similarity=0.827 Sum_probs=8.8
Q ss_pred eeeeecCCccc
Q psy11111 10 SVWTVDTPQDY 20 (84)
Q Consensus 10 ~~~~~~~~~~~ 20 (84)
.+||||+|++.
T Consensus 198 ~~WTvn~~~~~ 208 (226)
T cd08568 198 VLWTVNDPELV 208 (226)
T ss_pred EEEcCCCHHHH
Confidence 38999998764
No 55
>cd08610 GDPD_GDE6 Glycerophosphodiester phosphodiesterase domain of mammalian glycerophosphodiester phosphodiesterase GDE6 and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in mammalian GDE6 (also known as glycerophosphodiester phosphodiesterase domain-containing protein 4 (GDPD4)) and their metazoan homologs. Mammalian GDE6 is a transmembrane protein predominantly expressed in the spermatocytes of testis. Although the specific physiological function of mammalian GDE6 has not been elucidated, its different pattern of tissue distribution suggests it might play a critical role in the completion of meiosis during male germ cell differentiation.
Probab=20.68 E-value=29 Score=27.29 Aligned_cols=11 Identities=18% Similarity=0.594 Sum_probs=9.5
Q ss_pred eeeeecCCccc
Q psy11111 10 SVWTVDTPQDY 20 (84)
Q Consensus 10 ~~~~~~~~~~~ 20 (84)
.|||||+|+++
T Consensus 249 ~vWTVNd~~~~ 259 (316)
T cd08610 249 NVYVINEPWLF 259 (316)
T ss_pred EEECCCCHHHH
Confidence 58999999865
No 56
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=20.40 E-value=53 Score=20.07 Aligned_cols=13 Identities=23% Similarity=0.746 Sum_probs=11.2
Q ss_pred CceEEcccCCCCC
Q psy11111 60 HRTYSCVHCRAHL 72 (84)
Q Consensus 60 ~riYsC~~C~tHL 72 (84)
...|.|..|+..+
T Consensus 4 ~~~Y~C~~Cg~~~ 16 (49)
T COG1996 4 MMEYKCARCGREV 16 (49)
T ss_pred eEEEEhhhcCCee
Confidence 3579999999988
No 57
>KOG1074|consensus
Probab=20.17 E-value=48 Score=30.79 Aligned_cols=26 Identities=15% Similarity=0.491 Sum_probs=20.6
Q ss_pred hhhhhcCCCCceEEcccCCCCCCCCCcc
Q psy11111 51 TFQAYLPNCHRTYSCVHCRAHLASHDEL 78 (84)
Q Consensus 51 lF~~YL~~g~riYsC~~C~tHLA~~ddL 78 (84)
-|+.+- |+|.|.||-|+--++....|
T Consensus 624 HyrtHt--GERPFkCKiCgRAFtTkGNL 649 (958)
T KOG1074|consen 624 HYRTHT--GERPFKCKICGRAFTTKGNL 649 (958)
T ss_pred hhhccc--CcCccccccccchhccccch
Confidence 356664 78999999999888877665
No 58
>PF07503 zf-HYPF: HypF finger; InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target. Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=20.12 E-value=60 Score=18.25 Aligned_cols=14 Identities=21% Similarity=0.489 Sum_probs=8.8
Q ss_pred eEEcccCCCCCCCC
Q psy11111 62 TYSCVHCRAHLASH 75 (84)
Q Consensus 62 iYsC~~C~tHLA~~ 75 (84)
..+|.+|+..++..
T Consensus 21 ~isC~~CGPr~~i~ 34 (35)
T PF07503_consen 21 FISCTNCGPRYSII 34 (35)
T ss_dssp T--BTTCC-SCCCE
T ss_pred CccCCCCCCCEEEe
Confidence 35899999998753
No 59
>PF04777 Evr1_Alr: Erv1 / Alr family; InterPro: IPR006863 Biogenesis of Fe/S clusters involves a number of essential mitochondrial proteins. Erv1p of Saccharomyces cerevisiae (Baker's yeast) mitochondria is required for the maturation of Fe/S proteins in the cytosol. The ALR (augmenter of liver regeneration) represents a mammalian ortholog of yeast Erv1p. Both Erv1p and full-length ALR are located in the mitochondrial intermembrane and it is thought to operate downstream of the mitochondrial ABC transporter [].; GO: 0016972 thiol oxidase activity, 0055114 oxidation-reduction process; PDB: 3MBG_C 3U2L_A 3U2M_A 3QD9_D 3QCP_A 3O55_A 2HJ3_B 3GWN_A 3T58_D 3T59_B ....
Probab=20.07 E-value=3.8 Score=26.11 Aligned_cols=20 Identities=25% Similarity=0.705 Sum_probs=14.1
Q ss_pred hhhhhcCCCCceEEcccCCCCCC
Q psy11111 51 TFQAYLPNCHRTYSCVHCRAHLA 73 (84)
Q Consensus 51 lF~~YL~~g~riYsC~~C~tHLA 73 (84)
.|..++ ...|+|..|+.|+-
T Consensus 28 ~~~~~~---~~~~pC~~C~~hf~ 47 (95)
T PF04777_consen 28 AFFRSF---PHFFPCEECRNHFS 47 (95)
T ss_dssp HHHHHH---HHHSSSHHHHHHHH
T ss_pred HHHHHH---HHHCCcHHHHHHHH
Confidence 355555 26789999998863
Done!