Diaphorina citri psyllid: psy11111

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80----
MDGRSTAVDSVWTVDTPQDYCWRHSSIGTAYASLLSPYGGTQQLSNIMVKTFQAYLPNCHRTYSCVHCRAHLASHDELISKIPR
ccccccccccEEEEcccccHHHHHccccccccccccccccccccHHHHHHHHHHHccccccEEEEHHHHHHHcccHHHHHcccc
******A**SVWTVDTPQDYCWRHSSIGTAYASLLSPYGGTQQLSNIMVKTFQAYLPNCHRTYSCVHCRAHLASHDELISKI**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDGRSTAVDSVWTVDTPQDYCWRHSSIGTAYASLLSPYGGTQQLSNIMVKTFQAYLPNCHRTYSCVHCRAHLASHDELISKIPR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein yippee-like CG15309 very confidentQ9W2X7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0007476 [BP]imaginal disc-derived wing morphogenesisprobableGO:0048563, GO:0048569, GO:0035107, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0007472, GO:0007552, GO:0048513, GO:0032502, GO:0048707, GO:0009886, GO:0035114, GO:0008150, GO:0044767, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731, GO:0048736, GO:0048737

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted