Diaphorina citri psyllid: psy11114


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------
MRLFPIYLGKEFDLSQVLHGEQYLTLHQPLPTYGDIVSRCKVIDVLDKGKHAGLFSTLVRDQSRYAISKFTVPLFPHDPSYGERESLV
cccccccccccccccEEEEEEEEEEEEcccccccEEEEEEEEEEEEcccccEEEEEEEEEccccEEEEEEEEEEECcccccccccccc
MRLFPIYLGKEFDLSQVLHGEQYLTLHQPLPTYGDIVSRCKVIDVLDKGKHAGLFSTLVRDQSRYAISKFTVPLFPHDPS********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRLFPIYLGKEFDLSQVLHGEQYLTLHQPLPTYGDIVSRCKVIDVLDKGKHAGLFSTLVRDQSRYAISKFTVPLFPHDPSYGERESLV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peroxisomal multifunctional enzyme type 2 Bifunctional enzyme acting on the peroxisomal beta-oxidation pathway for fatty acids. Catalyzes the formation of 3-ketoacyl-CoA intermediates from both straight-chain and 2-methyl-branched-chain fatty acids.confidentP51659

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005778 [CC]peroxisomal membraneprobableGO:0005737, GO:0005575, GO:0031090, GO:0043227, GO:0016020, GO:0005777, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0042579, GO:0044444, GO:0044424, GO:0044464, GO:0044439, GO:0044438, GO:0031903, GO:0043226, GO:0044422, GO:0043231
GO:0036111 [BP]very long-chain fatty-acyl-CoA metabolic processprobableGO:0035383, GO:0051186, GO:0006637, GO:0006732, GO:0009987, GO:0044237, GO:0071704, GO:0008150, GO:0008152, GO:0006793, GO:0035337
GO:0036112 [BP]medium-chain fatty-acyl-CoA metabolic processprobableGO:0035383, GO:0051186, GO:0006637, GO:0006732, GO:0009987, GO:0044237, GO:0071704, GO:0008150, GO:0008152, GO:0006793, GO:0035337
GO:0006635 [BP]fatty acid beta-oxidationprobableGO:0034440, GO:0006631, GO:0019752, GO:0044248, GO:0009062, GO:0044281, GO:0044282, GO:0044242, GO:0044712, GO:1901575, GO:0030258, GO:0016042, GO:0071704, GO:0006629, GO:0009987, GO:0044710, GO:0032787, GO:0008150, GO:0008152, GO:0072329, GO:0043436, GO:0019395, GO:0044255, GO:0009056, GO:0055114, GO:0044238, GO:0006082, GO:0046395, GO:0016054, GO:0044237
GO:0044594 [MF]17-beta-hydroxysteroid dehydrogenase (NAD+) activityprobableGO:0016229, GO:0016614, GO:0016616, GO:0033764, GO:0003824, GO:0003674, GO:0016491
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0008209 [BP]androgen metabolic processprobableGO:0042445, GO:0044710, GO:0006629, GO:0044238, GO:0009987, GO:0044237, GO:0010817, GO:0071704, GO:0008150, GO:0008202, GO:0008152, GO:0065007, GO:0065008, GO:0034754, GO:1901360
GO:0016836 [MF]hydro-lyase activityprobableGO:0016835, GO:0016829, GO:0003674, GO:0003824
GO:0008210 [BP]estrogen metabolic processprobableGO:0042445, GO:0044710, GO:0006629, GO:0044238, GO:0009987, GO:0044237, GO:0010817, GO:0071704, GO:0008150, GO:0008202, GO:0008152, GO:0065007, GO:0065008, GO:0034754, GO:1901360

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1S9C, chain A
Confidence level:very confident
Coverage over the Query: 17-76
View the alignment between query and template
View the model in PyMOL