Diaphorina citri psyllid: psy11128


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210--
MKLVIHVQLLLFIFFSQTVVRKVGDVNIDGFNPSAEEADEGTDEAVESGVDIVLNHRLCETFAFGDKKGYTAYLKDYMKKLVAKLEEKAPDQIETFKTNMNKVMKELLGRFKDLQFFTVNFKEYQAEHMVDLLIHSSVRRHSVIPMNGNLPIYCRCCSGYECMGSILGISTILKIIIYWTRLVVTLHLKYLVELIELIGTAWVLGRAKDLGF
ccEEEEEccEEEEEEEEEEEEEcccccccccccccccccccccccEEEEccEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccccccEEEEcccccccccEEEEEEEccccccccccccccccEEEECcccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc
*KLVIHVQLLLFIFFSQTVVRKVGDVNIDGFNP************VESGVDIVLNHRLCETFAFGDKKGYTAYLKDYMKKLVAKLEEKAPDQIETFKTNMNKVMKELLGRFKDLQFFTVNFKEYQAEHMVDLLIHSSVRRHSVIPMNGNLPIYCRCCSGYECMGSILGISTILKIIIYWTRLVVTLHLKYLVELIELIGTAWVLGRAKDL**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLVIHVQLLLFIFFSQTVVRKVGDVNIDGFNPSAEEADEGTDEAVESGVDIVLNHRLCETFAFGDKKGYTAYLKDYMKKLVAKLEEKAPDQIETFKTNMNKVMKELLGRFKDLQFFTVNFKEYQAEHMVDLLIHSSVRRHSVIPMNGNLPIYCRCCSGYECMGSILGISTILKIIIYWTRLVVTLHLKYLVELIELIGTAWVLGRAKDLGF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Translationally-controlled tumor protein homolog Involved in calcium binding and microtubule stabilization.confidentQ9VGS2
Translationally-controlled tumor protein homolog Involved in calcium binding and microtubule stabilization.confidentQ7QCK2
Translationally-controlled tumor protein homolog Involved in calcium binding and microtubule stabilization.confidentQ293Y0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005088 [MF]Ras guanyl-nucleotide exchange factor activityprobableGO:0005083, GO:0005085, GO:0030695, GO:0003674, GO:0060589, GO:0030234
GO:0045298 [CC]tubulin complexprobableGO:0043234, GO:0005856, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0045793 [BP]positive regulation of cell sizeprobableGO:0071840, GO:0009987, GO:0016043, GO:0090066, GO:0008361, GO:0065007, GO:0044763, GO:0044699, GO:0008150, GO:0065008, GO:0032535
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0017016 [MF]Ras GTPase bindingprobableGO:0019899, GO:0031267, GO:0051020, GO:0003674, GO:0005488, GO:0005515
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005509 [MF]calcium ion bindingprobableGO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0040018 [BP]positive regulation of multicellular organism growthprobableGO:0040014, GO:0051240, GO:0050789, GO:0065007, GO:0051239, GO:0048518, GO:0008150, GO:0040008, GO:0045927

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2KWB, chain A
Confidence level:very confident
Coverage over the Query: 5-155
View the alignment between query and template
View the model in PyMOL