Query         psy11140
Match_columns 89
No_of_seqs    109 out of 302
Neff          5.9 
Searched_HMMs 46136
Date          Fri Aug 16 19:01:17 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy11140.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/11140hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF08016 PKD_channel:  Polycyst 100.0 2.9E-30 6.2E-35  199.8  11.2   84    2-85    115-198 (425)
  2 KOG3599|consensus               99.9 2.2E-27 4.7E-32  197.4   9.3   83    3-85    371-453 (798)
  3 PLN03223 Polycystin cation cha  99.9 3.6E-24 7.8E-29  183.9  10.8   76   10-85   1086-1163(1634)
  4 smart00419 HTH_CRP helix_turn_  87.0     1.2 2.5E-05   23.7   3.2   29   19-47     18-46  (48)
  5 PF05848 CtsR:  Firmicute trans  81.3     2.2 4.7E-05   30.0   3.3   22   22-43     94-115 (152)
  6 PF13545 HTH_Crp_2:  Crp-like h  78.9     2.8 6.1E-05   24.5   2.9   29   20-48     39-67  (76)
  7 PF13463 HTH_27:  Winged helix   70.7     9.7 0.00021   21.6   3.7   33   19-51     28-65  (68)
  8 cd00092 HTH_CRP helix_turn_hel  67.5      10 0.00022   21.3   3.3   26   18-43     34-59  (67)
  9 PF12793 SgrR_N:  Sugar transpo  64.5     6.8 0.00015   25.9   2.4   22   20-41     30-51  (115)
 10 TIGR02337 HpaR homoprotocatech  63.8      12 0.00025   23.9   3.4   33   19-51     52-89  (118)
 11 smart00420 HTH_DEOR helix_turn  63.6       8 0.00017   20.4   2.2   24   19-42     24-47  (53)
 12 PRK13918 CRP/FNR family transc  63.0      12 0.00027   25.4   3.6   30   19-48    159-188 (202)
 13 PF13730 HTH_36:  Helix-turn-he  60.7     9.6 0.00021   21.0   2.3   22   18-39     34-55  (55)
 14 smart00345 HTH_GNTR helix_turn  56.1      13 0.00028   20.1   2.3   26   18-43     29-54  (60)
 15 COG2873 MET17 O-acetylhomoseri  56.0     7.9 0.00017   31.3   1.8   21   39-60    144-164 (426)
 16 PF09339 HTH_IclR:  IclR helix-  55.6      11 0.00025   20.8   2.0   24   18-41     27-50  (52)
 17 cd07377 WHTH_GntR Winged helix  55.4      15 0.00032   20.3   2.5   25   19-43     35-59  (66)
 18 smart00529 HTH_DTXR Helix-turn  54.9      18  0.0004   21.9   3.0   26   19-44      9-34  (96)
 19 PF08544 GHMP_kinases_C:  GHMP   53.5      21 0.00046   20.9   3.1   25   12-36     58-82  (85)
 20 TIGR03697 NtcA_cyano global ni  53.3      21 0.00046   23.9   3.4   30   19-48    153-182 (193)
 21 PF07848 PaaX:  PaaX-like prote  53.1      11 0.00025   22.8   1.8   26   17-42     31-56  (70)
 22 PRK10402 DNA-binding transcrip  52.1      20 0.00044   25.2   3.3   31   18-48    178-208 (226)
 23 PF09648 YycI:  YycH protein;    50.5      89  0.0019   22.2   6.7   54   24-87    164-218 (228)
 24 PF12802 MarR_2:  MarR family;   50.0      16 0.00034   20.3   2.0   25   18-42     30-54  (62)
 25 PF01047 MarR:  MarR family;  I  49.8      16 0.00034   20.2   2.0   24   19-42     27-50  (59)
 26 PF02631 RecX:  RecX family;  I  46.5      17 0.00036   23.5   2.0   22   20-41      5-26  (121)
 27 PRK11512 DNA-binding transcrip  46.2      36 0.00078   22.4   3.6   33   19-51     64-101 (144)
 28 PF05670 DUF814:  Domain of unk  44.8      34 0.00075   21.2   3.1   29   10-38      3-32  (90)
 29 PF05036 SPOR:  Sporulation rel  44.6      18  0.0004   20.5   1.8   25   12-36      2-28  (76)
 30 smart00418 HTH_ARSR helix_turn  43.3      28 0.00061   18.5   2.3   23   19-41     20-42  (66)
 31 PRK11161 fumarate/nitrate redu  43.3      37 0.00079   23.7   3.4   31   18-48    193-223 (235)
 32 PRK13626 transcriptional regul  43.0      20 0.00042   29.1   2.2   22   20-41     34-55  (552)
 33 PF01325 Fe_dep_repress:  Iron   42.3      24 0.00052   20.5   2.0   25   18-42     31-55  (60)
 34 smart00344 HTH_ASNC helix_turn  41.5      33 0.00072   21.2   2.7   24   18-41     26-49  (108)
 35 PRK03573 transcriptional regul  40.5      45 0.00097   21.8   3.3   33   19-51     56-93  (144)
 36 PF13412 HTH_24:  Winged helix-  39.2      33 0.00071   18.3   2.2   22   19-40     27-48  (48)
 37 TIGR01605 PYST-D Plasmodium yo  39.1     6.3 0.00014   23.2  -0.9   20   48-67     20-39  (55)
 38 PF01978 TrmB:  Sugar-specific   38.4      31 0.00067   19.8   2.1   23   19-41     32-54  (68)
 39 TIGR00315 cdhB CO dehydrogenas  37.3      61  0.0013   22.8   3.7   39   16-59    104-142 (162)
 40 PRK14165 winged helix-turn-hel  37.2      42  0.0009   24.6   3.0   25   18-42     30-54  (217)
 41 PRK09391 fixK transcriptional   37.1      50  0.0011   23.3   3.4   25   19-43    189-213 (230)
 42 smart00347 HTH_MARR helix_turn  36.9      68  0.0015   18.8   3.5   23   19-41     34-56  (101)
 43 PF10340 DUF2424:  Protein of u  36.0      43 0.00093   26.7   3.1   37   10-52    128-164 (374)
 44 PF00325 Crp:  Bacterial regula  35.0      46 0.00099   17.4   2.2   21   19-39     12-32  (32)
 45 COG4738 Predicted transcriptio  34.8      24 0.00053   24.0   1.3   19   24-42     56-74  (124)
 46 smart00550 Zalpha Z-DNA-bindin  33.6      50  0.0011   19.4   2.5   25   18-42     31-55  (68)
 47 PF08704 GCD14:  tRNA methyltra  33.5      40 0.00086   25.1   2.4   37   11-47    137-173 (247)
 48 PRK11633 cell division protein  32.6      70  0.0015   23.7   3.6   30    9-38    144-175 (226)
 49 PRK00215 LexA repressor; Valid  32.0 1.8E+02  0.0038   20.2   5.8   51   19-69     33-90  (205)
 50 PF00392 GntR:  Bacterial regul  31.6      40 0.00086   19.2   1.8   25   18-42     33-57  (64)
 51 PRK13412 fkp bifunctional fuco  31.4   1E+02  0.0022   27.7   4.8   45    5-52    920-964 (974)
 52 COG4533 ABC-type uncharacteriz  30.0      43 0.00093   28.2   2.3   23   20-42     34-56  (564)
 53 TIGR01889 Staph_reg_Sar staphy  29.5 1.1E+02  0.0025   19.2   3.8   33   19-51     53-90  (109)
 54 cd00090 HTH_ARSR Arsenical Res  29.4      60  0.0013   17.6   2.3   24   19-42     30-53  (78)
 55 PRK14137 recX recombination re  28.6      51  0.0011   23.7   2.2   23   20-42     68-90  (195)
 56 PF03374 ANT:  Phage antirepres  27.7 1.6E+02  0.0035   18.4   4.4   56   26-85     38-95  (111)
 57 smart00346 HTH_ICLR helix_turn  26.4      70  0.0015   18.9   2.3   25   18-42     29-53  (91)
 58 PF12142 PPO1_DWL:  Polyphenol   26.4      75  0.0016   18.6   2.3   21   35-62      4-24  (54)
 59 TIGR01884 cas_HTH CRISPR locus  26.2      75  0.0016   22.3   2.7   25   19-43    167-191 (203)
 60 PF04937 DUF659:  Protein of un  25.8      85  0.0018   21.5   2.9   25   36-61     39-63  (153)
 61 PRK14136 recX recombination re  25.4      60  0.0013   25.4   2.2   22   20-41    190-211 (309)
 62 PF12101 DUF3577:  Protein of u  25.4 2.1E+02  0.0045   19.8   4.7   50   12-64     48-98  (137)
 63 PRK00117 recX recombination re  25.3      66  0.0014   21.5   2.2   23   20-42     39-61  (157)
 64 TIGR01610 phage_O_Nterm phage   25.1      72  0.0016   19.9   2.3   23   19-41     57-79  (95)
 65 KOG1818|consensus               25.1      52  0.0011   28.1   2.0   41   12-55    139-180 (634)
 66 PF15480 DUF4640:  Domain of un  24.9      40 0.00088   26.1   1.2   27   17-43     81-107 (292)
 67 COG2137 OraA Uncharacterized p  24.9      65  0.0014   22.9   2.2   23   20-42     48-70  (174)
 68 COG4463 CtsR Transcriptional r  24.5      59  0.0013   22.9   1.9    8   10-17     62-69  (153)
 69 cd04449 DEP_DEPDC5-like DEP (D  24.5      81  0.0018   19.3   2.3   23   21-43     47-69  (83)
 70 COG0320 LipA Lipoate synthase   24.1      96  0.0021   24.2   3.1   30    8-37    212-241 (306)
 71 PF05649 Peptidase_M13_N:  Pept  24.0      24 0.00053   26.0  -0.1   16   30-45    359-374 (390)
 72 PLN02150 terpene synthase/cycl  23.4      38 0.00082   21.6   0.7   26   15-40     13-38  (96)
 73 PF07864 DUF1651:  Protein of u  22.8      72  0.0016   19.2   1.8   18   22-39     51-68  (75)
 74 PF01726 LexA_DNA_bind:  LexA D  22.3      92   0.002   18.4   2.2   21   22-42     39-59  (65)
 75 TIGR03698 clan_AA_DTGF clan AA  22.2 1.3E+02  0.0027   19.2   3.0   32   47-78      1-33  (107)
 76 PF01022 HTH_5:  Bacterial regu  22.1      98  0.0021   16.6   2.2   23   18-40     24-46  (47)
 77 PRK14134 recX recombination re  22.1      78  0.0017   23.9   2.3   22   20-41     89-110 (283)
 78 PF07574 SMC_Nse1:  Nse1 non-SM  22.0      68  0.0015   22.7   1.9   22   20-41    163-184 (200)
 79 PF12894 Apc4_WD40:  Anaphase-p  21.8 1.6E+02  0.0034   16.3   3.0   17   48-64     14-30  (47)
 80 PRK00286 xseA exodeoxyribonucl  21.7      94   0.002   24.4   2.7   41    2-42     77-126 (438)
 81 COG3147 DedD Uncharacterized p  21.5      90   0.002   23.4   2.4   28   11-38    148-177 (226)
 82 PF06970 RepA_N:  Replication i  21.1 1.2E+02  0.0026   18.5   2.6   35   16-51     16-54  (76)
 83 TIGR02431 pcaR_pcaU beta-ketoa  21.0      98  0.0021   22.2   2.5   27   18-44     33-59  (248)
 84 PF04703 FaeA:  FaeA-like prote  21.0      93   0.002   18.4   2.0   23   19-41     25-47  (62)
 85 PRK13777 transcriptional regul  20.9 1.6E+02  0.0034   21.0   3.5   32   20-51     70-106 (185)
 86 PRK06450 threonine synthase; V  20.2      96  0.0021   23.8   2.4   28   24-51    210-237 (338)

No 1  
>PF08016 PKD_channel:  Polycystin cation channel;  InterPro: IPR013122 Polycystic kidney diseases (PKD) are disorders characterised by large numbers of cysts distributed throughout grossly-enlarged kidneys. Cyst development is associated with impairment of kidney function, and ultimately kidney failure and death []. Most cases of autosomal dominant PKD result from mutations in the PKD1 gene that cause premature protein termination.  A second gene for autosomal dominant polycystic kidney disease has been identified by positional cloning []. The predicted 968-amino acid sequence of the PKD2 gene product (polycystin-2) contains 6 transmembrane domains, with intracellular N- and C-termini. Polycystin-2 shares some similarity with the family of voltage-activated calcium (and sodium) channels, and contains a potential calcium-binding domain. Polycystin-2 is strongly expressed in ovary, foetal and adult kidney, testis, and small intestine. Polycystin-1 requires the presence of this protein for stable expression and is believed to interact with it via its C terminus. All mutations between exons 1 and 11 result in a truncated polycystin-2 that lacks a calcium-binding EF-hand domain and the cytoplasmic domains required for the interaction of polycystin-2 with polycystin-1 []. PKD2, although clinically milder than PKD1, has a deleterious impact on life expectancy. This entry contains proteins belonging to the polycystin family including Mucolipin and Polycystin-1 and -2 (PKD1 and PKD2). The domain contains the cation channel region of PKD1 and PKD2 proteins. PKD1 and PKD2 may function through a common signalling pathway that is necessary for normal tubulogenesis. The PKD2 gene product has six transmembrane spans with intracellular amino- and carboxyl-termini []. Mucolipin is a cationic channel which probably plays a role in the endocytic pathway and in the control of membrane trafficking of proteins and lipids. It could play a major role in the calcium ion transport regulating lysosomal exocytosis [, , ].
Probab=99.97  E-value=2.9e-30  Score=199.80  Aligned_cols=84  Identities=29%  Similarity=0.483  Sum_probs=82.0

Q ss_pred             cccceeeeeCCCCeEEEcCCCHHHHHHHHHhhhhCCcccCCccEEEEEEeeeeCCCCeEEEEEEEEEEcCccceeeeeEE
Q psy11140          2 SVGPKNIIYNGGGYVKDLGSSESNMAQGLSQMIIHKWLDERTRVILIECSLYNPNINAIIAVSLMIERLGSHNYLTDSEV   81 (89)
Q Consensus         2 ~~~G~~~~Y~ggGY~~~L~~~~~~a~~~l~~L~~~~WiD~~TRav~vEftlYN~n~nLF~~vtll~E~~~tG~~~~s~~v   81 (89)
                      ++.|++++|+||||+++|++++++|.++|++||+++|||++||||++||++||||+||||++++++|+||+|++.|+.+|
T Consensus       115 ~~~G~~~~Y~~gGY~~~L~~~~~~a~~~l~~L~~~~WiD~~Trav~vef~~YN~~~nlf~~v~l~~E~~~~G~~~~s~~i  194 (425)
T PF08016_consen  115 PYWGQFGTYGGGGYVVDLGRNKDEARSILQYLQQNNWIDRSTRAVFVEFTLYNPNTNLFSVVTLLFEFPPTGGVIPSASI  194 (425)
T ss_pred             ceeeeeeeeCCCcEEEECCCCHHHHHHHHHHHHhCcCcccCCceEEEEEEEEcCCCCeeEEEEEEEEEcCCCceeeecce
Confidence            57899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEee
Q psy11140         82 GIRG   85 (89)
Q Consensus        82 ~~~~   85 (89)
                      +++.
T Consensus       195 ~~~~  198 (425)
T PF08016_consen  195 QTFR  198 (425)
T ss_pred             eEEE
Confidence            9874


No 2  
>KOG3599|consensus
Probab=99.94  E-value=2.2e-27  Score=197.44  Aligned_cols=83  Identities=29%  Similarity=0.403  Sum_probs=80.6

Q ss_pred             ccceeeeeCCCCeEEEcCCCHHHHHHHHHhhhhCCcccCCccEEEEEEeeeeCCCCeEEEEEEEEEEcCccceeeeeEEE
Q psy11140          3 VGPKNIIYNGGGYVKDLGSSESNMAQGLSQMIIHKWLDERTRVILIECSLYNPNINAIIAVSLMIERLGSHNYLTDSEVG   82 (89)
Q Consensus         3 ~~G~~~~Y~ggGY~~~L~~~~~~a~~~l~~L~~~~WiD~~TRav~vEftlYN~n~nLF~~vtll~E~~~tG~~~~s~~v~   82 (89)
                      ..|.+++|+||||+++|+.+++++...+++|++++|||++||||||||++||||+||||+|+|++|+||+|+++|+.+++
T Consensus       371 ~~g~l~~Y~~gGY~~~l~~sr~es~~~i~~L~~~~WlD~~TrAvfidftlYNa~inlF~~v~L~vE~p~~G~~~ps~~l~  450 (798)
T KOG3599|consen  371 HWGLLASYGGGGYVVLLSLSRTESLKAISYLRENNWLDRGTRAVFIDFTLYNADINLFCVVTLRVEFPPTGGVLPSLQLE  450 (798)
T ss_pred             cccceeEecCCCEEEEecCchHhHHHHHHHHHHhccccCCCcEEEEeccccCCCCCeeEEEEEEEEecCcccccccceEE
Confidence            47899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             Eee
Q psy11140         83 IRG   85 (89)
Q Consensus        83 ~~~   85 (89)
                      .+-
T Consensus       451 S~~  453 (798)
T KOG3599|consen  451 SFK  453 (798)
T ss_pred             EEe
Confidence            873


No 3  
>PLN03223 Polycystin cation channel protein; Provisional
Probab=99.91  E-value=3.6e-24  Score=183.88  Aligned_cols=76  Identities=20%  Similarity=0.267  Sum_probs=73.0

Q ss_pred             eCCC-CeEEEcCCCHHHHHHHHHhhhhCCcccC-CccEEEEEEeeeeCCCCeEEEEEEEEEEcCccceeeeeEEEEee
Q psy11140         10 YNGG-GYVKDLGSSESNMAQGLSQMIIHKWLDE-RTRVILIECSLYNPNINAIIAVSLMIERLGSHNYLTDSEVGIRG   85 (89)
Q Consensus        10 Y~gg-GY~~~L~~~~~~a~~~l~~L~~~~WiD~-~TRav~vEftlYN~n~nLF~~vtll~E~~~tG~~~~s~~v~~~~   85 (89)
                      |++| ||+++|+.++++|.++|++|+++.|||+ +|||||+||++||||+||||+|++++|||++|++.|+++|+++-
T Consensus      1086 y~DGfgyv~DL~lSa~eA~~~L~~LKdnlWIDr~~TRAVFVEFTVYNANVNLFSvVtLLfEF~~TGGV~~s~~IqTfR 1163 (1634)
T PLN03223       1086 YADGFPYFFDINLSAAEAQTWLDYMIYGLMIDDVKTRKVTAQVVVYNAELGYFGNVMVFFEFTDGGKIEVTHRLNTIR 1163 (1634)
T ss_pred             CCCCceEEEECCCCHHHHHHHHHHHHhCCCcccccceeEEEEEEEEcCCCCeEEEEEEEEEEcCCCceeeeeeEEEEE
Confidence            5544 9999999999999999999999999999 99999999999999999999999999999999999999999874


No 4  
>smart00419 HTH_CRP helix_turn_helix, cAMP Regulatory protein.
Probab=87.01  E-value=1.2  Score=23.70  Aligned_cols=29  Identities=14%  Similarity=0.257  Sum_probs=23.9

Q ss_pred             cCCCHHHHHHHHHhhhhCCcccCCccEEE
Q psy11140         19 LGSSESNMAQGLSQMIIHKWLDERTRVIL   47 (89)
Q Consensus        19 L~~~~~~a~~~l~~L~~~~WiD~~TRav~   47 (89)
                      ++.++..+...|+.|.+.+||+...+.+.
T Consensus        18 l~~s~~tv~~~l~~L~~~g~l~~~~~~~~   46 (48)
T smart00419       18 LGLTRETVSRTLKRLEKEGLISREGGRIV   46 (48)
T ss_pred             HCCCHHHHHHHHHHHHHCCCEEEeCCEEE
Confidence            46678899999999999999987766543


No 5  
>PF05848 CtsR:  Firmicute transcriptional repressor of class III stress genes (CtsR);  InterPro: IPR008463 This family consists of several Firmicute transcriptional repressor of class III stress gene (CtsR) proteins. CtsR of Listeria monocytogenes negatively regulates the clpC, clpP and clpE genes belonging to the CtsR regulon [].; PDB: 3H0D_A.
Probab=81.30  E-value=2.2  Score=30.05  Aligned_cols=22  Identities=14%  Similarity=0.290  Sum_probs=17.4

Q ss_pred             CHHHHHHHHHhhhhCCcccCCc
Q psy11140         22 SESNMAQGLSQMIIHKWLDERT   43 (89)
Q Consensus        22 ~~~~a~~~l~~L~~~~WiD~~T   43 (89)
                      +..+|...++.|.++++|++.-
T Consensus        94 s~~~a~~ii~~L~e~~~it~RE  115 (152)
T PF05848_consen   94 SQQDAEDIIQRLLEEGLITERE  115 (152)
T ss_dssp             -HHHHHHHHHHHHHTTSS-HHH
T ss_pred             CHHHHHHHHHHHHHCCCCCHHH
Confidence            4688999999999999998643


No 6  
>PF13545 HTH_Crp_2:  Crp-like helix-turn-helix domain; PDB: 3LA2_A 3LA3_B 3LA7_A 3B02_A 3E97_A 2H6C_B 1OMI_A 2BGC_H 2BEO_A 2GAU_A ....
Probab=78.86  E-value=2.8  Score=24.51  Aligned_cols=29  Identities=17%  Similarity=0.264  Sum_probs=22.6

Q ss_pred             CCCHHHHHHHHHhhhhCCcccCCccEEEE
Q psy11140         20 GSSESNMAQGLSQMIIHKWLDERTRVILI   48 (89)
Q Consensus        20 ~~~~~~a~~~l~~L~~~~WiD~~TRav~v   48 (89)
                      |.++...-..|+.|++.+||+..-+-+.|
T Consensus        39 g~sr~tv~r~l~~l~~~g~I~~~~~~i~I   67 (76)
T PF13545_consen   39 GVSRETVSRILKRLKDEGIIEVKRGKIII   67 (76)
T ss_dssp             TSCHHHHHHHHHHHHHTTSEEEETTEEEE
T ss_pred             CCCHHHHHHHHHHHHHCCCEEEcCCEEEE
Confidence            45667888999999999999876555443


No 7  
>PF13463 HTH_27:  Winged helix DNA-binding domain; PDB: 3GFL_A 2YR2_B 3GFM_A 3GFJ_A 3GF2_A 3GEZ_A 2GXG_A 3GFI_A 2EB7_A.
Probab=70.71  E-value=9.7  Score=21.57  Aligned_cols=33  Identities=15%  Similarity=0.202  Sum_probs=22.9

Q ss_pred             cCCCHHHHHHHHHhhhhCCcccC-----CccEEEEEEe
Q psy11140         19 LGSSESNMAQGLSQMIIHKWLDE-----RTRVILIECS   51 (89)
Q Consensus        19 L~~~~~~a~~~l~~L~~~~WiD~-----~TRav~vEft   51 (89)
                      ++.++......|+.|.+.+||.+     .-|...+.+|
T Consensus        28 ~~~~~~~vs~~i~~L~~~glv~~~~~~~d~R~~~~~LT   65 (68)
T PF13463_consen   28 LGISKSTVSRIIKKLEEKGLVEKERDPHDKRSKRYRLT   65 (68)
T ss_dssp             TT--HHHHHHHHHHHHHTTSEEEEEESSCTTSEEEEE-
T ss_pred             HCcCHHHHHHHHHHHHHCCCEEecCCCCcCCeeEEEeC
Confidence            56778889999999999999933     3454666554


No 8  
>cd00092 HTH_CRP helix_turn_helix, cAMP Regulatory protein C-terminus; DNA binding domain of prokaryotic regulatory proteins belonging to the catabolite activator protein family.
Probab=67.46  E-value=10  Score=21.31  Aligned_cols=26  Identities=15%  Similarity=0.265  Sum_probs=21.9

Q ss_pred             EcCCCHHHHHHHHHhhhhCCcccCCc
Q psy11140         18 DLGSSESNMAQGLSQMIIHKWLDERT   43 (89)
Q Consensus        18 ~L~~~~~~a~~~l~~L~~~~WiD~~T   43 (89)
                      .++.++..+...|+.|++.+||....
T Consensus        34 ~~g~s~~tv~r~l~~L~~~g~i~~~~   59 (67)
T cd00092          34 YLGLTRETVSRTLKELEEEGLISRRG   59 (67)
T ss_pred             HHCCCHHHHHHHHHHHHHCCCEEecC
Confidence            35677889999999999999998754


No 9  
>PF12793 SgrR_N:  Sugar transport-related sRNA regulator N-term
Probab=64.47  E-value=6.8  Score=25.90  Aligned_cols=22  Identities=23%  Similarity=0.194  Sum_probs=19.5

Q ss_pred             CCCHHHHHHHHHhhhhCCcccC
Q psy11140         20 GSSESNMAQGLSQMIIHKWLDE   41 (89)
Q Consensus        20 ~~~~~~a~~~l~~L~~~~WiD~   41 (89)
                      .-+..+++..|+.|++.+||+=
T Consensus        30 ~cS~Rn~r~lLkkm~~~gWi~W   51 (115)
T PF12793_consen   30 FCSRRNARTLLKKMQEEGWITW   51 (115)
T ss_pred             CCCHHHHHHHHHHHHHCCCeee
Confidence            4677899999999999999974


No 10 
>TIGR02337 HpaR homoprotocatechuate degradation operon regulator, HpaR. This Helix-Turn-Helix transcriptional regulator is a member of the MarR family (pfam01047) and is found in association with operons for the degradation of 4-hydroxyphenylacetic acid via homoprotocatechuate.
Probab=63.84  E-value=12  Score=23.91  Aligned_cols=33  Identities=9%  Similarity=0.058  Sum_probs=26.1

Q ss_pred             cCCCHHHHHHHHHhhhhCCcccCCc-----cEEEEEEe
Q psy11140         19 LGSSESNMAQGLSQMIIHKWLDERT-----RVILIECS   51 (89)
Q Consensus        19 L~~~~~~a~~~l~~L~~~~WiD~~T-----Rav~vEft   51 (89)
                      ++.++......++.|.+.+||.+..     |...+..|
T Consensus        52 ~~~~~~tvs~~l~~Le~~GlI~r~~~~~D~R~~~v~LT   89 (118)
T TIGR02337        52 ACILRPSLTGILARLERDGLVTRLKASNDQRRVYISLT   89 (118)
T ss_pred             hCCCchhHHHHHHHHHHCCCEEeccCCCCCCeeEEEEC
Confidence            4566778899999999999999855     76666543


No 11 
>smart00420 HTH_DEOR helix_turn_helix, Deoxyribose operon repressor.
Probab=63.55  E-value=8  Score=20.43  Aligned_cols=24  Identities=25%  Similarity=0.329  Sum_probs=20.9

Q ss_pred             cCCCHHHHHHHHHhhhhCCcccCC
Q psy11140         19 LGSSESNMAQGLSQMIIHKWLDER   42 (89)
Q Consensus        19 L~~~~~~a~~~l~~L~~~~WiD~~   42 (89)
                      |+.+...+...|+.|.+.+||.+.
T Consensus        24 l~~s~~tv~~~l~~L~~~g~i~~~   47 (53)
T smart00420       24 LGVSEMTIRRDLNKLEEQGLLTRV   47 (53)
T ss_pred             HCCCHHHHHHHHHHHHHCCCEEEe
Confidence            567788999999999999999764


No 12 
>PRK13918 CRP/FNR family transcriptional regulator; Provisional
Probab=63.01  E-value=12  Score=25.39  Aligned_cols=30  Identities=10%  Similarity=0.227  Sum_probs=24.5

Q ss_pred             cCCCHHHHHHHHHhhhhCCcccCCccEEEE
Q psy11140         19 LGSSESNMAQGLSQMIIHKWLDERTRVILI   48 (89)
Q Consensus        19 L~~~~~~a~~~l~~L~~~~WiD~~TRav~v   48 (89)
                      ||.+++..-..|++|++.++|+..-+.+.|
T Consensus       159 lG~tretvsR~l~~l~~~g~I~~~~~~i~I  188 (202)
T PRK13918        159 VGSVRETVTKVIGELSREGYIRSGYGKIQL  188 (202)
T ss_pred             hCccHHHHHHHHHHHHHCCCEEcCCCEEEE
Confidence            467778888999999999999987666544


No 13 
>PF13730 HTH_36:  Helix-turn-helix domain
Probab=60.67  E-value=9.6  Score=21.03  Aligned_cols=22  Identities=18%  Similarity=0.368  Sum_probs=19.3

Q ss_pred             EcCCCHHHHHHHHHhhhhCCcc
Q psy11140         18 DLGSSESNMAQGLSQMIIHKWL   39 (89)
Q Consensus        18 ~L~~~~~~a~~~l~~L~~~~Wi   39 (89)
                      .+|.++....+.|+.|++.+||
T Consensus        34 ~~g~s~~Tv~~~i~~L~~~G~I   55 (55)
T PF13730_consen   34 DLGVSRRTVQRAIKELEEKGLI   55 (55)
T ss_pred             HHCcCHHHHHHHHHHHHHCcCC
Confidence            4577788999999999999997


No 14 
>smart00345 HTH_GNTR helix_turn_helix gluconate operon transcriptional repressor.
Probab=56.08  E-value=13  Score=20.11  Aligned_cols=26  Identities=23%  Similarity=0.409  Sum_probs=21.8

Q ss_pred             EcCCCHHHHHHHHHhhhhCCcccCCc
Q psy11140         18 DLGSSESNMAQGLSQMIIHKWLDERT   43 (89)
Q Consensus        18 ~L~~~~~~a~~~l~~L~~~~WiD~~T   43 (89)
                      .++-++......++.|.+.+||++..
T Consensus        29 ~~~vs~~tv~~~l~~L~~~g~i~~~~   54 (60)
T smart00345       29 QLGVSRTTVREALSRLEAEGLVQRRP   54 (60)
T ss_pred             HHCCCHHHHHHHHHHHHHCCCEEEec
Confidence            45677889999999999999997644


No 15 
>COG2873 MET17 O-acetylhomoserine sulfhydrylase [Amino acid transport and metabolism]
Probab=56.02  E-value=7.9  Score=31.33  Aligned_cols=21  Identities=29%  Similarity=0.708  Sum_probs=18.2

Q ss_pred             ccCCccEEEEEEeeeeCCCCeE
Q psy11140         39 LDERTRVILIECSLYNPNINAI   60 (89)
Q Consensus        39 iD~~TRav~vEftlYN~n~nLF   60 (89)
                      ||.+|||||+| |+=||..|+.
T Consensus       144 I~~nTkavf~E-tigNP~~~v~  164 (426)
T COG2873         144 IDENTKAVFAE-TIGNPGLDVL  164 (426)
T ss_pred             hCcccceEEEE-eccCCCcccc
Confidence            78999999999 8889888753


No 16 
>PF09339 HTH_IclR:  IclR helix-turn-helix domain;  InterPro: IPR005471 The many bacterial transcription regulation proteins which bind DNA through a 'helix-turn-helix' motif can be classified into subfamilies on the basis of sequence similarities. One of these subfamilies, called 'iclR', groups several proteins including:  gylR, a possible activator protein for the gylABX glycerol operon in Streptomyces.   iclR, the repressor of the acetate operon (also known as glyoxylate bypass operon) in Escherichia coli and Salmonella typhimurium.    These proteins have a Helix-Turn-Helix motif at the N terminus that is similar to that of other DNA-binding proteins [].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1MKM_A 3MQ0_A 3R4K_A 2G7U_C 2O0Y_C 2XRO_F 2XRN_B 2IA2_D.
Probab=55.58  E-value=11  Score=20.81  Aligned_cols=24  Identities=17%  Similarity=0.364  Sum_probs=20.2

Q ss_pred             EcCCCHHHHHHHHHhhhhCCcccC
Q psy11140         18 DLGSSESNMAQGLSQMIIHKWLDE   41 (89)
Q Consensus        18 ~L~~~~~~a~~~l~~L~~~~WiD~   41 (89)
                      .++.++..+...|+.|.+.+|+.+
T Consensus        27 ~~gl~~stv~r~L~tL~~~g~v~~   50 (52)
T PF09339_consen   27 ALGLPKSTVHRLLQTLVEEGYVER   50 (52)
T ss_dssp             HHTS-HHHHHHHHHHHHHTTSEEE
T ss_pred             HHCcCHHHHHHHHHHHHHCcCeec
Confidence            357788999999999999999975


No 17 
>cd07377 WHTH_GntR Winged helix-turn-helix (WHTH) DNA-binding domain of the GntR family of transcriptional regulators. This CD represents the winged HTH DNA-binding domain of the GntR (named after the gluconate operon repressor in Bacillus subtilis) family of bacterial transcriptional regulators and their putative homologs found in eukaryota and archaea. The GntR family has over 6000 members distributed among almost all bacterial species, which is comprised of FadR, HutC, MocR, YtrA, AraR, PlmA, and other subfamilies for the regulation of the most varied biological process. The monomeric proteins of the GntR family are characterized by two function domains: a small highly conserved winged helix-turn-helix prokaryotic DNA binding domain in the N-terminus, and a very diverse regulatory ligand-binding domain in the C-terminus for effector-binding/oligomerization, which provides the basis for the subfamily classifications.  Binding of the effector to GntR-like transcriptional regulators is 
Probab=55.40  E-value=15  Score=20.27  Aligned_cols=25  Identities=20%  Similarity=0.408  Sum_probs=21.2

Q ss_pred             cCCCHHHHHHHHHhhhhCCcccCCc
Q psy11140         19 LGSSESNMAQGLSQMIIHKWLDERT   43 (89)
Q Consensus        19 L~~~~~~a~~~l~~L~~~~WiD~~T   43 (89)
                      ++-++......|+.|.+.+||++..
T Consensus        35 ~~is~~~v~~~l~~L~~~G~i~~~~   59 (66)
T cd07377          35 LGVSRTTVREALRELEAEGLVERRP   59 (66)
T ss_pred             HCCCHHHHHHHHHHHHHCCCEEecC
Confidence            5667888999999999999998653


No 18 
>smart00529 HTH_DTXR Helix-turn-helix diphteria tox regulatory element. iron dependent repressor
Probab=54.92  E-value=18  Score=21.89  Aligned_cols=26  Identities=15%  Similarity=0.132  Sum_probs=22.7

Q ss_pred             cCCCHHHHHHHHHhhhhCCcccCCcc
Q psy11140         19 LGSSESNMAQGLSQMIIHKWLDERTR   44 (89)
Q Consensus        19 L~~~~~~a~~~l~~L~~~~WiD~~TR   44 (89)
                      |+-++......++.|.+.+||.+...
T Consensus         9 l~is~stvs~~l~~L~~~glI~r~~~   34 (96)
T smart00529        9 LNVSPPTVTQMLKKLEKDGLVEYEPY   34 (96)
T ss_pred             hCCChHHHHHHHHHHHHCCCEEEcCC
Confidence            56778889999999999999999763


No 19 
>PF08544 GHMP_kinases_C:  GHMP kinases C terminal ;  InterPro: IPR013750 This domain is found in homoserine kinases (2.7.1.39 from EC), galactokinases (2.7.1.6 from EC) and mevalonate kinases (2.7.1.36 from EC). These kinases make up the GHMP kinase superfamily of ATP-dependent enzymes []. These enzymes are involved in the biosynthesis of isoprenes and amino acids as well as in carbohydrate metabolism. The C-terminal domain of homoserine kinase has a central alpha-beta plait fold and an insertion of four helices, which, together with the N-terminal fold, create a novel nucleotide binding fold [].; PDB: 2R3V_C 4EMD_A 4DXL_A 4ED4_A 2GS8_A 1K47_E 3GON_A 3K17_B 1PIE_A 2AJ4_A ....
Probab=53.45  E-value=21  Score=20.87  Aligned_cols=25  Identities=24%  Similarity=0.247  Sum_probs=21.2

Q ss_pred             CCCeEEEcCCCHHHHHHHHHhhhhC
Q psy11140         12 GGGYVKDLGSSESNMAQGLSQMIIH   36 (89)
Q Consensus        12 ggGY~~~L~~~~~~a~~~l~~L~~~   36 (89)
                      +|+.++-|..+.+.+.++.+.|++.
T Consensus        58 ~G~~v~~l~~~~~~~~~v~~~l~~~   82 (85)
T PF08544_consen   58 GGPTVFALCKDEDDAERVAEALREH   82 (85)
T ss_dssp             SSSEEEEEESSHHHHHHHHHHHHHH
T ss_pred             CCCeEEEEECCHHHHHHHHHHHHHh
Confidence            4899999998999999998888653


No 20 
>TIGR03697 NtcA_cyano global nitrogen regulator NtcA, cyanobacterial. Members of this protein family, found in the cyanobacteria, are the global nitrogen regulator NtcA. This DNA-binding transcriptional regulator is required for expressing many different ammonia-repressible genes. The consensus NtcA-binding site is G T A N(8)T A C.
Probab=53.28  E-value=21  Score=23.87  Aligned_cols=30  Identities=17%  Similarity=0.313  Sum_probs=23.8

Q ss_pred             cCCCHHHHHHHHHhhhhCCcccCCccEEEE
Q psy11140         19 LGSSESNMAQGLSQMIIHKWLDERTRVILI   48 (89)
Q Consensus        19 L~~~~~~a~~~l~~L~~~~WiD~~TRav~v   48 (89)
                      ||.+++..-+.|++|++.++|+..-+-+.|
T Consensus       153 lG~tretvsR~l~~l~~~g~I~~~~~~i~I  182 (193)
T TIGR03697       153 IGSTRVTITRLLGDLRKKKLISIHKKKITV  182 (193)
T ss_pred             hCCcHHHHHHHHHHHHHCCCEEecCCEEEE
Confidence            356667788889999999999877766554


No 21 
>PF07848 PaaX:  PaaX-like protein;  InterPro: IPR012906 This entry describes the N-terminal region of proteins that are similar to, and nclude, the product of the paaX gene of Escherichia coli (P76086 from SWISSPROT). PaaX is a transcriptional regulator that is always found in association with operons believed to be involved in the degradation of phenylacetic acid []. The gene product has been shown to bind to the promoter sites and repress their transcription []. ; PDB: 3KFW_X 3L09_B.
Probab=53.07  E-value=11  Score=22.83  Aligned_cols=26  Identities=31%  Similarity=0.620  Sum_probs=20.9

Q ss_pred             EEcCCCHHHHHHHHHhhhhCCcccCC
Q psy11140         17 KDLGSSESNMAQGLSQMIIHKWLDER   42 (89)
Q Consensus        17 ~~L~~~~~~a~~~l~~L~~~~WiD~~   42 (89)
                      ..+|.+...++..|..|++.+||+..
T Consensus        31 ~~~Gv~e~avR~alsRl~~~G~L~~~   56 (70)
T PF07848_consen   31 AAFGVSESAVRTALSRLVRRGWLESE   56 (70)
T ss_dssp             CCTT--HHHHHHHHHHHHHTTSEEEE
T ss_pred             HHcCCChHHHHHHHHHHHHcCceeee
Confidence            35788889999999999999999764


No 22 
>PRK10402 DNA-binding transcriptional activator YeiL; Provisional
Probab=52.12  E-value=20  Score=25.20  Aligned_cols=31  Identities=32%  Similarity=0.357  Sum_probs=25.8

Q ss_pred             EcCCCHHHHHHHHHhhhhCCcccCCccEEEE
Q psy11140         18 DLGSSESNMAQGLSQMIIHKWLDERTRVILI   48 (89)
Q Consensus        18 ~L~~~~~~a~~~l~~L~~~~WiD~~TRav~v   48 (89)
                      .||.+++..-..|+.|++.++|+...+-+.|
T Consensus       178 ~lG~sretvsR~L~~L~~~G~I~~~~~~i~I  208 (226)
T PRK10402        178 YLGVSYRHLLYVLAQFIQDGYLKKSKRGYLI  208 (226)
T ss_pred             HHCCcHHHHHHHHHHHHHCCCEEeeCCEEEE
Confidence            4677888888999999999999988776544


No 23 
>PF09648 YycI:  YycH protein;  InterPro: IPR018604 The YycFG two-component system is the only signal transduction system in Bacillus subtilis known to be essential for cell viability. This system is highly conserved in low-G+C Gram-positive bacteria, regulating important processes such as cell wall homeostasis, cell membrane integrity, and cell division. Four other genes, yycHIJK, are organised within the same operon with yycF and yycG in B. subtilis.   YycI and YycH proteins interact to control the activity of the YycG kinase. Both YycI and YycH proteins are localized outside the cytoplasm and attached to the membrane by an N-terminal transmembrane sequence. Bacterial two-hybrid data showed that the YycH, YycI, and the kinase YycG form a ternary complex. The data suggest that YycH and YycI control the activity of YycG in the periplasm and that this control is crucial in regulating important cellular processes [, ]. ; PDB: 2O3O_G.
Probab=50.48  E-value=89  Score=22.19  Aligned_cols=54  Identities=15%  Similarity=0.268  Sum_probs=40.9

Q ss_pred             HHHHHHHHhhhhCCcccCCccEEEEEEeeeeCCCCeEEEEEEE-EEEcCccceeeeeEEEEeecc
Q psy11140         24 SNMAQGLSQMIIHKWLDERTRVILIECSLYNPNINAIIAVSLM-IERLGSHNYLTDSEVGIRGKS   87 (89)
Q Consensus        24 ~~a~~~l~~L~~~~WiD~~TRav~vEftlYN~n~nLF~~vtll-~E~~~tG~~~~s~~v~~~~~~   87 (89)
                      =.+.+.|..|.+++=|.+.++..=+++.-|          +++ ..-...+-++|.++|.+.++.
T Consensus       164 Isa~~Al~~Ly~~~~i~~~s~I~~i~LGYy----------~~~~~~~~~~~v~~P~W~I~v~~~~  218 (228)
T PF09648_consen  164 ISAQEALETLYQNNEIPNNSKITWIELGYY----------SLLQWTVADSQVYVPVWRIEVKNGD  218 (228)
T ss_dssp             --HHHHHHHHHHTT-S-TTEEEEEEEEEEE------------EEEEETTEEEEEEEEEEEEEEEE
T ss_pred             cCHHHHHHHHHHcCcCCCCCEEEEEEEeEe----------EeeccccCceEEEEEEEEEEEEcCC
Confidence            457788899999999999999999999988          222 356777889999999998764


No 24 
>PF12802 MarR_2:  MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP4_B 3KP2_A 3KP5_A 3KP3_B 3KP7_A 3NQO_B 3K0L_B ....
Probab=50.02  E-value=16  Score=20.33  Aligned_cols=25  Identities=16%  Similarity=0.266  Sum_probs=20.3

Q ss_pred             EcCCCHHHHHHHHHhhhhCCcccCC
Q psy11140         18 DLGSSESNMAQGLSQMIIHKWLDER   42 (89)
Q Consensus        18 ~L~~~~~~a~~~l~~L~~~~WiD~~   42 (89)
                      .++.++......++.|.+.+||.+.
T Consensus        30 ~l~~~~~~vs~~v~~L~~~Glv~r~   54 (62)
T PF12802_consen   30 RLGISKSTVSRIVKRLEKKGLVERE   54 (62)
T ss_dssp             HHTS-HHHHHHHHHHHHHTTSEEEE
T ss_pred             HHCcCHHHHHHHHHHHHHCCCEEEe
Confidence            3567888999999999999999763


No 25 
>PF01047 MarR:  MarR family;  InterPro: IPR000835 The MarR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 135 amino acids present in transcription regulators of the MarR/SlyA family, involved in the development of antibiotic resistance. This family of transcription regulators is named after Escherichia coli MarR, a repressor of genes which activate the multiple antibiotic resistance and oxidative stress regulons, and after slyA from Salmonella typhimurium and E. coli, a transcription regulator that is required for virulence and survival in the macrophage environment. Regulators with the MarR-type HTH domain are present in bacteria and archaea and control a variety of biological functions, including resistance to multiple antibiotics, household disinfectants, organic solvents, oxidative stress agents and regulation of the virulence factor synthesis in pathogens of humans and plants. Many of the MarR-like regulators respond to aromatic compounds [, , ]. The crystal structures of MarR, MexR and SlyA have been determined and show a winged HTH DNA-binding core flanked by helices involved in dimerisation. The DNA-binding domains are ascribed to the superfamily of winged helix proteins, containing a three (four)-helix (H) bundle and a three-stranded antiparallel beta-sheet (B) in the topology: H1-(H1')-H2-B1-H3-H4-B2-B3-H5-H6. Helices 3 and 4 comprise the helix-turn-helix motif and the beta-sheet is called the wing. Helix 4 is termed the recognition helix, like in other HTHs where it binds the DNA major groove. The helices 1, 5 and 6 are involved in dimerisation, as most MarR-like transcription regulators form dimers [, ]. ; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent, 0005622 intracellular; PDB: 1JGS_A 2NYX_D 2PEX_B 2PFB_A 3BPX_A 3BPV_A 2BV6_A 3BJA_A 3E6M_B 2ETH_A ....
Probab=49.78  E-value=16  Score=20.25  Aligned_cols=24  Identities=17%  Similarity=0.290  Sum_probs=19.8

Q ss_pred             cCCCHHHHHHHHHhhhhCCcccCC
Q psy11140         19 LGSSESNMAQGLSQMIIHKWLDER   42 (89)
Q Consensus        19 L~~~~~~a~~~l~~L~~~~WiD~~   42 (89)
                      ++.++......++.|.+.+||.+.
T Consensus        27 ~~~~~~~~t~~i~~L~~~g~I~r~   50 (59)
T PF01047_consen   27 LGISRSTVTRIIKRLEKKGLIERE   50 (59)
T ss_dssp             HTS-HHHHHHHHHHHHHTTSEEEE
T ss_pred             HCCChhHHHHHHHHHHHCCCEEec
Confidence            466788899999999999999764


No 26 
>PF02631 RecX:  RecX family;  InterPro: IPR003783 RecX is a putative bacterial regulatory protein []. The gene encoding RecX is found downstream of recA, and it is suggested that the RecX protein might be regulator of RecA activity by interaction with the RecA protein or filament [].; GO: 0006282 regulation of DNA repair; PDB: 3DFG_A 3D5L_B 3C1D_B 3E3V_A.
Probab=46.49  E-value=17  Score=23.46  Aligned_cols=22  Identities=18%  Similarity=0.373  Sum_probs=16.9

Q ss_pred             CCCHHHHHHHHHhhhhCCcccC
Q psy11140         20 GSSESNMAQGLSQMIIHKWLDE   41 (89)
Q Consensus        20 ~~~~~~a~~~l~~L~~~~WiD~   41 (89)
                      +.+.+....+|..|++.+|||.
T Consensus         5 g~~~e~I~~vi~~l~~~gyidD   26 (121)
T PF02631_consen    5 GFSEEAIEEVIDRLKELGYIDD   26 (121)
T ss_dssp             T--HHHHHHHHHHHHHTTSS-H
T ss_pred             CCCHHHHHHHHHHHHHcCCCCH
Confidence            3467788999999999999986


No 27 
>PRK11512 DNA-binding transcriptional repressor MarR; Provisional
Probab=46.18  E-value=36  Score=22.42  Aligned_cols=33  Identities=15%  Similarity=0.432  Sum_probs=26.3

Q ss_pred             cCCCHHHHHHHHHhhhhCCcccCCc-----cEEEEEEe
Q psy11140         19 LGSSESNMAQGLSQMIIHKWLDERT-----RVILIECS   51 (89)
Q Consensus        19 L~~~~~~a~~~l~~L~~~~WiD~~T-----Rav~vEft   51 (89)
                      ++.++......++.|.+.+||.+..     |...+..|
T Consensus        64 l~i~~~tvsr~l~~Le~~GlI~R~~~~~DrR~~~l~LT  101 (144)
T PRK11512         64 LSVDLGALTRMLDRLVCKGWVERLPNPNDKRGVLVKLT  101 (144)
T ss_pred             HCCCHHHHHHHHHHHHHCCCEEeccCcccCCeeEeEEC
Confidence            4677888999999999999998754     66666543


No 28 
>PF05670 DUF814:  Domain of unknown function (DUF814);  InterPro: IPR008532 This domain occurs in proteins that have been annotated as Fibronectin/fibrinogen binding protein by similarity. This annotation comes from O34693 from SWISSPROT where the N-terminal region is involved in this activity []. Hence the activity of this C-terminal domain is unknown. This domain contains a conserved motif D/E-X-W/Y-X-H that may be functionally important.
Probab=44.76  E-value=34  Score=21.18  Aligned_cols=29  Identities=7%  Similarity=-0.010  Sum_probs=23.7

Q ss_pred             eCCCCeEEEcCCCHHHHHHH-HHhhhhCCc
Q psy11140         10 YNGGGYVKDLGSSESNMAQG-LSQMIIHKW   38 (89)
Q Consensus        10 Y~ggGY~~~L~~~~~~a~~~-l~~L~~~~W   38 (89)
                      ....||.+..|+|..+.... ++.++.+++
T Consensus         3 ~s~~g~~i~vGrn~~eNe~L~~k~~~~~D~   32 (90)
T PF05670_consen    3 ISSDGFKIIVGRNAKENEMLTKKYARPNDL   32 (90)
T ss_pred             EecCCeEEEEeCCHHHHHHHHHHhhhhcce
Confidence            35789999999999999888 777777754


No 29 
>PF05036 SPOR:  Sporulation related domain;  InterPro: IPR007730 This 70 residue domain is composed of two 35 residue repeats that are found in bacterial proteins involved in sporulation and cell division, such as FtsN, CwlM and RlpA. This repeat might be involved in binding peptidoglycan. FtsN is an essential cell division protein with a simple bitopic topology: a short N-terminal cytoplasmic segment fused to a large carboxy periplasmic domain through a single transmembrane domain. The repeats lie at the periplasmic C terminus, which has an RNP-like fold []. FtsN localises to the septum ring complex. The CwlM protein is a cell wall hydrolase, where the C-terminal region, including the repeats, determines substrate specificity []. RlpA is a rare lipoprotein A protein that may be important for cell division. Its N-terminal cysteine may be attached to thioglyceride and N-fatty acyl residues [].; PDB: 1X60_A 1UTA_A.
Probab=44.62  E-value=18  Score=20.49  Aligned_cols=25  Identities=32%  Similarity=0.480  Sum_probs=18.2

Q ss_pred             CCCeEEEcC--CCHHHHHHHHHhhhhC
Q psy11140         12 GGGYVKDLG--SSESNMAQGLSQMIIH   36 (89)
Q Consensus        12 ggGY~~~L~--~~~~~a~~~l~~L~~~   36 (89)
                      +++|.+.++  .+.++|...++.|+..
T Consensus         2 ~~~y~vQv~s~~~~~~A~~~~~~l~~~   28 (76)
T PF05036_consen    2 SSGYYVQVGSFSSEENAERLLAKLKKK   28 (76)
T ss_dssp             --EEEEEEEEES-HHHHHHHHHHHHHH
T ss_pred             CCcEEEEEEEcCCHHHHHHHHHHHHhc
Confidence            467888776  6778888888888877


No 30 
>smart00418 HTH_ARSR helix_turn_helix, Arsenical Resistance Operon Repressor.
Probab=43.33  E-value=28  Score=18.53  Aligned_cols=23  Identities=22%  Similarity=0.335  Sum_probs=20.2

Q ss_pred             cCCCHHHHHHHHHhhhhCCcccC
Q psy11140         19 LGSSESNMAQGLSQMIIHKWLDE   41 (89)
Q Consensus        19 L~~~~~~a~~~l~~L~~~~WiD~   41 (89)
                      |+.++..+...|+.|.+.+|+..
T Consensus        20 l~is~~~v~~~l~~L~~~g~i~~   42 (66)
T smart00418       20 LGLSQSTVSHHLKKLREAGLVES   42 (66)
T ss_pred             HCCCHHHHHHHHHHHHHCCCeee
Confidence            56778899999999999999974


No 31 
>PRK11161 fumarate/nitrate reduction transcriptional regulator; Provisional
Probab=43.26  E-value=37  Score=23.69  Aligned_cols=31  Identities=19%  Similarity=0.213  Sum_probs=25.3

Q ss_pred             EcCCCHHHHHHHHHhhhhCCcccCCccEEEE
Q psy11140         18 DLGSSESNMAQGLSQMIIHKWLDERTRVILI   48 (89)
Q Consensus        18 ~L~~~~~~a~~~l~~L~~~~WiD~~TRav~v   48 (89)
                      .||.+++..-..|+.|++.+||+..-+.+.|
T Consensus       193 ~lG~sr~tvsR~l~~l~~~g~I~~~~~~i~i  223 (235)
T PRK11161        193 YLGLTVETISRLLGRFQKSGMLAVKGKYITI  223 (235)
T ss_pred             HhCCcHHHHHHHHHHHHHCCCEEecCCEEEE
Confidence            3567778888889999999999987776654


No 32 
>PRK13626 transcriptional regulator SgrR; Provisional
Probab=42.97  E-value=20  Score=29.06  Aligned_cols=22  Identities=27%  Similarity=0.338  Sum_probs=19.6

Q ss_pred             CCCHHHHHHHHHhhhhCCcccC
Q psy11140         20 GSSESNMAQGLSQMIIHKWLDE   41 (89)
Q Consensus        20 ~~~~~~a~~~l~~L~~~~WiD~   41 (89)
                      .-++.+++..|+.|++.+||+=
T Consensus        34 ~cs~R~~~~~l~~~~~~gwl~w   55 (552)
T PRK13626         34 NCSRRHMRTLLNTMQQRGWLTW   55 (552)
T ss_pred             cCChhHHHHHHHHHHHCCCeee
Confidence            5678899999999999999984


No 33 
>PF01325 Fe_dep_repress:  Iron dependent repressor, N-terminal DNA binding domain;  InterPro: IPR022687 The DtxR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 65 residues present in metalloregulators of the DtxR/MntR family. The family is named after Corynebacterium diphtheriae DtxR, an iron-specific diphtheria toxin repressor, and Bacillus subtilis MntR, a manganese transport regulator. Iron-responsive metalloregulators such as DtxR and IdeR occur in Gram-positive bacteria of the high GC branch, while manganese-responsive metalloregulators like MntR are described in diverse genera of Gram-positive and Gram-negative bacteria and also in Archaea [].The metalloregulators like DtxR/MntR contain the DNA-binding DtxR-type HTH domain usually in the N-terminal part. The C-terminal part contains a dimerisation domain with two metal-binding sites, although the primary metal-binding site is less conserved in the Mn(II)-regulators. Fe(II)-regulated proteins contain an SH3-like domain as a C-terminal extension, which is absent in Mn(II)-regulated MntR [, ]. Metal-ion dependent regulators orchestrate the virulence of several important human pathogens. The DtxR protein regulates the expression of diphtheria toxinin response to environmental iron concentrations. Furthermore, DtxR and IdeR control iron uptake []. Homeostasis of manganese, which is an essential nutrient, is regulated by MntR. A typical DtxR-type metalloregulator binds two divalent metal effectors per monomer, upon which allosteric changes occur that moderate binding to the cognate DNA operators. Iron-bound DtxR homodimers bind to an interrupted palindrome of 19 bp, protecting a sequence of ~30 bp. The crystal structures of iron-regulated and manganese-regulated repressors show that the DNA binding domain contains three alpha-helices and a pair of antiparallel beta-strands. Helices 2 and 3 comprise the helix-turn-helix motif and the beta-strands are called the wing []. This wHTH topology is similar to the lysR-type HTH (see PDOC00043 from PROSITEDOC). Most DtxR-type metalloregulators bind as dimers to the DNA major groove. Several proteins are known to contain a DtxR-type HTH domain. These include- Corynebacterium diphtheriae DtxR, a diphtheria toxin repressor [], which regulates the expression of the high-affinity iron uptake system, other iron-sensitive genes, and the bacteriophage tox gene. Metal-bound DtxR represses transcription by binding the tox operator; if iron is limiting, conformational changes of the wHTH disrupt DNA-binding and the diphtheria toxin is produced. Mycobacterium tuberculosis IdeR, an iron-dependent regulator that is essential for this pathogen. The regulator represses genes for iron acquisition and activates iron storage genes, and is a positive regulator of oxidative stress responses []. Bacillus subtilis MntR, a manganese transport regulator, binds Mn2+ as an effector and is a transcriptional repressor of transporters for the import of manganese. Treponema pallidum troR, a metal-dependent transcriptional repressor. Archaeoglobus fulgidus MDR1 (troR), a metal-dependent transcriptional repressor, which negatively regulates its own transcription. This entry covers the entire DtxR-type HTH domain.; GO: 0005506 iron ion binding; PDB: 3HRT_B 3HRS_A 3HRU_B 2X4H_D 1ON1_B 2HYF_C 2F5E_A 3R60_B 1ON2_B 2F5F_A ....
Probab=42.29  E-value=24  Score=20.52  Aligned_cols=25  Identities=16%  Similarity=0.244  Sum_probs=20.9

Q ss_pred             EcCCCHHHHHHHHHhhhhCCcccCC
Q psy11140         18 DLGSSESNMAQGLSQMIIHKWLDER   42 (89)
Q Consensus        18 ~L~~~~~~a~~~l~~L~~~~WiD~~   42 (89)
                      .|+.++..+..+++.|.+.++++..
T Consensus        31 ~L~vs~~tvt~ml~~L~~~GlV~~~   55 (60)
T PF01325_consen   31 RLGVSPPTVTEMLKRLAEKGLVEYE   55 (60)
T ss_dssp             HHTS-HHHHHHHHHHHHHTTSEEEE
T ss_pred             HHCCChHHHHHHHHHHHHCCCEEec
Confidence            4678889999999999999999763


No 34 
>smart00344 HTH_ASNC helix_turn_helix ASNC type. AsnC: an autogenously regulated activator of asparagine synthetase A transcription in Escherichia coli
Probab=41.45  E-value=33  Score=21.23  Aligned_cols=24  Identities=13%  Similarity=0.165  Sum_probs=21.2

Q ss_pred             EcCCCHHHHHHHHHhhhhCCcccC
Q psy11140         18 DLGSSESNMAQGLSQMIIHKWLDE   41 (89)
Q Consensus        18 ~L~~~~~~a~~~l~~L~~~~WiD~   41 (89)
                      .++.+.......++.|.+++||.+
T Consensus        26 ~l~~s~~tv~~~l~~L~~~g~i~~   49 (108)
T smart00344       26 KVGLSPSTVHNRVKRLEEEGVIKG   49 (108)
T ss_pred             HHCcCHHHHHHHHHHHHHCCCeec
Confidence            357788999999999999999985


No 35 
>PRK03573 transcriptional regulator SlyA; Provisional
Probab=40.50  E-value=45  Score=21.80  Aligned_cols=33  Identities=15%  Similarity=0.286  Sum_probs=26.0

Q ss_pred             cCCCHHHHHHHHHhhhhCCcccCC-----ccEEEEEEe
Q psy11140         19 LGSSESNMAQGLSQMIIHKWLDER-----TRVILIECS   51 (89)
Q Consensus        19 L~~~~~~a~~~l~~L~~~~WiD~~-----TRav~vEft   51 (89)
                      ++.++......+..|.+.+||.+.     -|+..|..|
T Consensus        56 l~~~~~tvt~~v~~Le~~GlV~r~~~~~DrR~~~l~LT   93 (144)
T PRK03573         56 IGIEQPSLVRTLDQLEEKGLISRQTCASDRRAKRIKLT   93 (144)
T ss_pred             hCCChhhHHHHHHHHHHCCCEeeecCCCCcCeeeeEEC
Confidence            466778889999999999999764     377776654


No 36 
>PF13412 HTH_24:  Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A ....
Probab=39.25  E-value=33  Score=18.34  Aligned_cols=22  Identities=23%  Similarity=0.308  Sum_probs=17.8

Q ss_pred             cCCCHHHHHHHHHhhhhCCccc
Q psy11140         19 LGSSESNMAQGLSQMIIHKWLD   40 (89)
Q Consensus        19 L~~~~~~a~~~l~~L~~~~WiD   40 (89)
                      ++-+.......|+.|.+.+||.
T Consensus        27 ~~is~~tv~~~l~~L~~~g~I~   48 (48)
T PF13412_consen   27 LGISRSTVNRYLKKLEEKGLIE   48 (48)
T ss_dssp             HTS-HHHHHHHHHHHHHTTSEE
T ss_pred             hCCCHHHHHHHHHHHHHCcCcC
Confidence            5667788999999999999873


No 37 
>TIGR01605 PYST-D Plasmodium yoelii subtelomeric family PYST-D. This model represents a paralogous family of Plasmodium yoelii genes preferentially located in the subtelomeric regions of the chromosomes. These genes are generally very short (ca. 50 residues). There are no obvious homologs to these genes in any other organism.
Probab=39.05  E-value=6.3  Score=23.21  Aligned_cols=20  Identities=35%  Similarity=0.482  Sum_probs=15.3

Q ss_pred             EEEeeeeCCCCeEEEEEEEE
Q psy11140         48 IECSLYNPNINAIIAVSLMI   67 (89)
Q Consensus        48 vEftlYN~n~nLF~~vtll~   67 (89)
                      +++-.||.|+||.++..-++
T Consensus        20 lhlifyn~ntnlIyV~~rmf   39 (55)
T TIGR01605        20 LHLIFYNSNTNIIYVFSRMF   39 (55)
T ss_pred             hHhhhhhcccceEeeehHHh
Confidence            46678999999988865443


No 38 
>PF01978 TrmB:  Sugar-specific transcriptional regulator TrmB;  InterPro: IPR002831 TrmB, is a protein of 38,800 apparent molecular weight, that is involved in the maltose-specific regulation of the trehalose/maltose ABC transport operon in Thermococcus litoralis. TrmB has been shown to be a maltose-specific repressor, and this inhibition is counteracted by maltose and trehalose. TrmB binds maltose and trehalose half-maximally at 20 uM and 0.5 mM sugar concentration, respectively []. Other members of this family are annotated as either transcriptional regulators or hypothetical proteins. ; PDB: 2D1H_A 3QPH_A 1SFX_A.
Probab=38.40  E-value=31  Score=19.84  Aligned_cols=23  Identities=22%  Similarity=0.304  Sum_probs=20.4

Q ss_pred             cCCCHHHHHHHHHhhhhCCcccC
Q psy11140         19 LGSSESNMAQGLSQMIIHKWLDE   41 (89)
Q Consensus        19 L~~~~~~a~~~l~~L~~~~WiD~   41 (89)
                      ++.++.++...|+.|.+.+|+.+
T Consensus        32 l~i~~~~v~~~L~~L~~~GlV~~   54 (68)
T PF01978_consen   32 LGISRSTVYRALKSLEEKGLVER   54 (68)
T ss_dssp             HTSSHHHHHHHHHHHHHTTSEEE
T ss_pred             HCcCHHHHHHHHHHHHHCCCEEE
Confidence            56778999999999999999965


No 39 
>TIGR00315 cdhB CO dehydrogenase/acetyl-CoA synthase complex, epsilon subunit. Nomenclature follows the description for Methanosarcina thermophila. The complex is also found in Archaeoglobus fulgidus, not considered a methanogen, but is otherwise generally associated with methanogenesis.
Probab=37.34  E-value=61  Score=22.75  Aligned_cols=39  Identities=28%  Similarity=0.278  Sum_probs=33.4

Q ss_pred             EEEcCCCHHHHHHHHHhhhhCCcccCCccEEEEEEeeeeCCCCe
Q psy11140         16 VKDLGSSESNMAQGLSQMIIHKWLDERTRVILIECSLYNPNINA   59 (89)
Q Consensus        16 ~~~L~~~~~~a~~~l~~L~~~~WiD~~TRav~vEftlYN~n~nL   59 (89)
                      ++-+|.+..-+-+.|+.||...  |  +|.|-++ -.|+||.++
T Consensus       104 vlfvG~~~y~~~~~ls~lk~f~--~--~~~i~l~-~~y~pnA~~  142 (162)
T TIGR00315       104 VLFLGIIYYYLSQMLSSLKHFS--H--IVTIAID-KYYQPNADY  142 (162)
T ss_pred             EEEeCCcchHHHHHHHHHHhhc--C--cEEEEec-CCCCCCCce
Confidence            6778888888899999999887  3  8888888 999999876


No 40 
>PRK14165 winged helix-turn-helix domain-containing protein/riboflavin kinase; Provisional
Probab=37.24  E-value=42  Score=24.65  Aligned_cols=25  Identities=20%  Similarity=0.247  Sum_probs=21.7

Q ss_pred             EcCCCHHHHHHHHHhhhhCCcccCC
Q psy11140         18 DLGSSESNMAQGLSQMIIHKWLDER   42 (89)
Q Consensus        18 ~L~~~~~~a~~~l~~L~~~~WiD~~   42 (89)
                      .|+.++..+...|+.|.+.+||.+.
T Consensus        30 ~L~iS~~Tvsr~Lk~LEe~GlI~R~   54 (217)
T PRK14165         30 HTGTSSKTAARILKQLEDEGYITRT   54 (217)
T ss_pred             HHCcCHHHHHHHHHHHHHCCCEEEE
Confidence            3567889999999999999999774


No 41 
>PRK09391 fixK transcriptional regulator FixK; Provisional
Probab=37.09  E-value=50  Score=23.33  Aligned_cols=25  Identities=20%  Similarity=0.219  Sum_probs=21.0

Q ss_pred             cCCCHHHHHHHHHhhhhCCcccCCc
Q psy11140         19 LGSSESNMAQGLSQMIIHKWLDERT   43 (89)
Q Consensus        19 L~~~~~~a~~~l~~L~~~~WiD~~T   43 (89)
                      ||-+++..-+.|+.|++.++|+...
T Consensus       189 lGisretlsR~L~~L~~~GlI~~~~  213 (230)
T PRK09391        189 LGLTIETVSRALSQLQDRGLIGLSG  213 (230)
T ss_pred             HCCCHHHHHHHHHHHHHCCcEEecC
Confidence            4667788888999999999998654


No 42 
>smart00347 HTH_MARR helix_turn_helix multiple antibiotic resistance protein.
Probab=36.94  E-value=68  Score=18.78  Aligned_cols=23  Identities=22%  Similarity=0.293  Sum_probs=19.3

Q ss_pred             cCCCHHHHHHHHHhhhhCCcccC
Q psy11140         19 LGSSESNMAQGLSQMIIHKWLDE   41 (89)
Q Consensus        19 L~~~~~~a~~~l~~L~~~~WiD~   41 (89)
                      ++.++......|+.|.+.+||.+
T Consensus        34 ~~~s~~~i~~~l~~L~~~g~v~~   56 (101)
T smart00347       34 LGVSPSTVTRVLDRLEKKGLIRR   56 (101)
T ss_pred             HCCCchhHHHHHHHHHHCCCeEe
Confidence            45667788899999999999964


No 43 
>PF10340 DUF2424:  Protein of unknown function (DUF2424);  InterPro: IPR019436 Sterol homeostasis in eukaryotic cells relies on the reciprocal interconversion of free sterols and steryl esters. In Saccharomyces cerevisiae (Baker's yeast) sterol acetylation requires the acetyltransferase Atf2, whereas deacetylation requires Say1, a membrane-anchored deacetylase with a putative active site in the ER lumen. Lack of Say1 results in the secretion of acetylated sterols into the culture medium, indicating that the substrate specificity of Say1 determines whether acetylated sterols are secreted from the cells or whether they are deacetylated and retained. In S. cerevisiae cells lacking Say1 or Atf2 are sensitive against the plant-derived allylbenzene eugenol and both Say1 and Atf2 affect pregnenolone toxicity, indicating that lipid acetylation acts as a detoxification pathway []. Homologues of Say1 are present in the mammalian genome and can functionally substitute for Say1 in yeast demonstrating that part of this pathway has been evolutionarily conserved [].
Probab=36.00  E-value=43  Score=26.67  Aligned_cols=37  Identities=19%  Similarity=0.466  Sum_probs=25.4

Q ss_pred             eCCCCeEEEcCCCHHHHHHHHHhhhhCCcccCCccEEEEEEee
Q psy11140         10 YNGGGYVKDLGSSESNMAQGLSQMIIHKWLDERTRVILIECSL   52 (89)
Q Consensus        10 Y~ggGY~~~L~~~~~~a~~~l~~L~~~~WiD~~TRav~vEftl   52 (89)
                      +.||||...+...+-+....+.++.+      ....+++|.++
T Consensus       128 lHGGGY~l~~~p~qi~~L~~i~~~l~------~~SILvLDYsL  164 (374)
T PF10340_consen  128 LHGGGYFLGTTPSQIEFLLNIYKLLP------EVSILVLDYSL  164 (374)
T ss_pred             EcCCeeEecCCHHHHHHHHHHHHHcC------CCeEEEEeccc
Confidence            45999999988776666666666643      23677777554


No 44 
>PF00325 Crp:  Bacterial regulatory proteins, crp family;  InterPro: IPR001808 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif. These proteins are very diverse, but for convenience may be grouped into subfamilies on the basis of sequence similarity. This family groups together a range of proteins, including anr, crp, clp, cysR, fixK, flp, fnr, fnrN, hlyX and ntcA [, ]. Within this family, the HTH motif is situated towards the C terminus.; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent, 0005622 intracellular; PDB: 2OZ6_A 1CGP_B 2GZW_C 1O3T_B 3ROU_A 2CGP_A 3RDI_A 1I5Z_A 3IYD_H 3FWE_B ....
Probab=34.99  E-value=46  Score=17.36  Aligned_cols=21  Identities=14%  Similarity=0.260  Sum_probs=17.3

Q ss_pred             cCCCHHHHHHHHHhhhhCCcc
Q psy11140         19 LGSSESNMAQGLSQMIIHKWL   39 (89)
Q Consensus        19 L~~~~~~a~~~l~~L~~~~Wi   39 (89)
                      ||.+.+..-..+..|++.+.|
T Consensus        12 lG~t~ETVSR~l~~l~~~glI   32 (32)
T PF00325_consen   12 LGLTRETVSRILKKLERQGLI   32 (32)
T ss_dssp             HTS-HHHHHHHHHHHHHTTSE
T ss_pred             hCCcHHHHHHHHHHHHHcCCC
Confidence            677888999999999998875


No 45 
>COG4738 Predicted transcriptional regulator [Transcription]
Probab=34.79  E-value=24  Score=24.03  Aligned_cols=19  Identities=21%  Similarity=0.532  Sum_probs=14.8

Q ss_pred             HHHHHHHHhhhhCCcccCC
Q psy11140         24 SNMAQGLSQMIIHKWLDER   42 (89)
Q Consensus        24 ~~a~~~l~~L~~~~WiD~~   42 (89)
                      .+.--..+.|++++|+|..
T Consensus        56 PEVSiAMr~Lre~gWV~~R   74 (124)
T COG4738          56 PEVSIAMRYLRENGWVDER   74 (124)
T ss_pred             chhHHHHHHHHHccccchH
Confidence            4445667999999999964


No 46 
>smart00550 Zalpha Z-DNA-binding domain in adenosine deaminases. Helix-turn-helix-containing domain. Also known as Zab.
Probab=33.62  E-value=50  Score=19.41  Aligned_cols=25  Identities=12%  Similarity=0.141  Sum_probs=21.7

Q ss_pred             EcCCCHHHHHHHHHhhhhCCcccCC
Q psy11140         18 DLGSSESNMAQGLSQMIIHKWLDER   42 (89)
Q Consensus        18 ~L~~~~~~a~~~l~~L~~~~WiD~~   42 (89)
                      .||-++......|..|++.+++.+.
T Consensus        31 ~lgl~~~~v~r~L~~L~~~G~V~~~   55 (68)
T smart00550       31 NLGLPKKEVNRVLYSLEKKGKVCKQ   55 (68)
T ss_pred             HHCCCHHHHHHHHHHHHHCCCEEec
Confidence            4678888999999999999999763


No 47 
>PF08704 GCD14:  tRNA methyltransferase complex GCD14 subunit;  InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA []. ; GO: 0016429 tRNA (adenine-N1-)-methyltransferase activity, 0030488 tRNA methylation; PDB: 2YVL_C 1YB2_A 2B25_B 1O54_A 2PWY_B 1I9G_A 3LGA_B 3LHD_C 3MB5_A.
Probab=33.47  E-value=40  Score=25.12  Aligned_cols=37  Identities=16%  Similarity=0.231  Sum_probs=30.9

Q ss_pred             CCCCeEEEcCCCHHHHHHHHHhhhhCCcccCCccEEE
Q psy11140         11 NGGGYVKDLGSSESNMAQGLSQMIIHKWLDERTRVIL   47 (89)
Q Consensus        11 ~ggGY~~~L~~~~~~a~~~l~~L~~~~WiD~~TRav~   47 (89)
                      ..||.+.-+..+-+|....++.|++++|.|-.|--++
T Consensus       137 ~~gG~i~~fsP~ieQv~~~~~~L~~~gf~~i~~~Evl  173 (247)
T PF08704_consen  137 KPGGRICCFSPCIEQVQKTVEALREHGFTDIETVEVL  173 (247)
T ss_dssp             EEEEEEEEEESSHHHHHHHHHHHHHTTEEEEEEEEEE
T ss_pred             cCCceEEEECCCHHHHHHHHHHHHHCCCeeeEEEEEE
Confidence            3578888888899999999999999999987654443


No 48 
>PRK11633 cell division protein DedD; Provisional
Probab=32.60  E-value=70  Score=23.70  Aligned_cols=30  Identities=17%  Similarity=0.388  Sum_probs=25.4

Q ss_pred             eeCCCCeEEEcC--CCHHHHHHHHHhhhhCCc
Q psy11140          9 IYNGGGYVKDLG--SSESNMAQGLSQMIIHKW   38 (89)
Q Consensus         9 ~Y~ggGY~~~L~--~~~~~a~~~l~~L~~~~W   38 (89)
                      ...+++|++.||  ++.+++......|+..+.
T Consensus       144 ~~~~~~~vVQlgaf~n~~~A~~l~~kL~~~G~  175 (226)
T PRK11633        144 APTGKAYVVQLGALKNADKVNEIVAKLRLSGY  175 (226)
T ss_pred             CCCCCcEEEEecccCCHHHHHHHHHHHHHCCC
Confidence            356889999998  678999999999998875


No 49 
>PRK00215 LexA repressor; Validated
Probab=32.00  E-value=1.8e+02  Score=20.21  Aligned_cols=51  Identities=18%  Similarity=0.193  Sum_probs=32.9

Q ss_pred             cCC-CHHHHHHHHHhhhhCCcccC---CccEEEE---EEeeeeCCCCeEEEEEEEEEE
Q psy11140         19 LGS-SESNMAQGLSQMIIHKWLDE---RTRVILI---ECSLYNPNINAIIAVSLMIER   69 (89)
Q Consensus        19 L~~-~~~~a~~~l~~L~~~~WiD~---~TRav~v---EftlYN~n~nLF~~vtll~E~   69 (89)
                      ++. ++..+...|+.|.+.+||.+   ..|++.+   .+..-+...+-+..+-++-+.
T Consensus        33 ~~~~~~~tv~~~l~~L~~~g~i~~~~~~~r~~~l~~~~~~~~~~~~~~~~~iPv~~~v   90 (205)
T PRK00215         33 LGLRSPSAVHEHLKALERKGFIRRDPGRSRAIEVAAPAQLELPEEEPEAVGLPLVGRV   90 (205)
T ss_pred             hCCCChHHHHHHHHHHHHCCCEEeCCCCcceEEeccccccccccccCCceeeeeEEEE
Confidence            565 88999999999999999944   5677777   333322222234445555444


No 50 
>PF00392 GntR:  Bacterial regulatory proteins, gntR family;  InterPro: IPR000524 Many bacterial transcription regulation proteins bind DNA through a helix-turn-helix (HTH) motif, which can be classified into subfamilies on the basis of sequence similarities. The HTH GntR family has many members distributed among diverse bacterial groups that regulate various biological processes. It was named GntR after the Bacillus subtilis repressor of the gluconate operon []. Family members include GntR, HutC, KorA, NtaR, FadR, ExuR, FarR, DgoR and PhnF. The crystal structure of the FadR protein has been determined []. In general, these proteins contain a DNA-binding HTH domain at the N terminus, and an effector-binding or oligomerisation domain at the C terminus (IPR011711 from INTERPRO). The DNA-binding domain is well conserved in structure for the whole of the GntR family, consisting of a 3-helical bundle core with a small beta-sheet (wing); the GntR winged helix structure is similar to that found in several other transcriptional regulator families. The regions outside the DNA-binding domain are more variable and are consequently used to define GntR subfamilies []. This entry represents the N-terminal DNA-binding domain of the GntR family.; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent, 0005622 intracellular; PDB: 1HW1_B 1H9T_A 1HW2_A 1H9G_A 1E2X_A 3IHU_A 3C7J_A 2RA5_A 3BY6_C 3IC7_A ....
Probab=31.62  E-value=40  Score=19.22  Aligned_cols=25  Identities=16%  Similarity=0.360  Sum_probs=20.5

Q ss_pred             EcCCCHHHHHHHHHhhhhCCcccCC
Q psy11140         18 DLGSSESNMAQGLSQMIIHKWLDER   42 (89)
Q Consensus        18 ~L~~~~~~a~~~l~~L~~~~WiD~~   42 (89)
                      .++-++..+++.+..|.+.+||...
T Consensus        33 ~~~vsr~tvr~al~~L~~~g~i~~~   57 (64)
T PF00392_consen   33 RYGVSRTTVREALRRLEAEGLIERR   57 (64)
T ss_dssp             HHTS-HHHHHHHHHHHHHTTSEEEE
T ss_pred             HhccCCcHHHHHHHHHHHCCcEEEE
Confidence            3567789999999999999999764


No 51 
>PRK13412 fkp bifunctional fucokinase/L-fucose-1-P-guanylyltransferase; Provisional
Probab=31.39  E-value=1e+02  Score=27.70  Aligned_cols=45  Identities=18%  Similarity=0.172  Sum_probs=30.0

Q ss_pred             ceeeeeCCCCeEEEcCCCHHHHHHHHHhhhhCCcccCCccEEEEEEee
Q psy11140          5 PKNIIYNGGGYVKDLGSSESNMAQGLSQMIIHKWLDERTRVILIECSL   52 (89)
Q Consensus         5 G~~~~Y~ggGY~~~L~~~~~~a~~~l~~L~~~~WiD~~TRav~vEftl   52 (89)
                      +++.==||||++.-|..+.+.+.++.+.|++..   ..-++.+++|.+
T Consensus       920 aKLTGAGGGGcvI~Lak~~~~a~~I~~~L~~~~---~~~~~~~~~~~l  964 (974)
T PRK13412        920 YKLPGAGGGGYLYMVAKDPGAAERIRKILTENA---PNPRARFVDMSL  964 (974)
T ss_pred             EEecccCcccEEEEEECChhhHHHHHHHHHhcc---cCCceeEEEEEE
Confidence            344444789999999888877777777776632   234456666665


No 52 
>COG4533 ABC-type uncharacterized transport system, periplasmic component [General function prediction only]
Probab=29.99  E-value=43  Score=28.20  Aligned_cols=23  Identities=26%  Similarity=0.183  Sum_probs=20.1

Q ss_pred             CCCHHHHHHHHHhhhhCCcccCC
Q psy11140         20 GSSESNMAQGLSQMIIHKWLDER   42 (89)
Q Consensus        20 ~~~~~~a~~~l~~L~~~~WiD~~   42 (89)
                      .-+..+++..|+.|++.+|||-.
T Consensus        34 fCS~Rh~R~lL~q~q~~gWL~W~   56 (564)
T COG4533          34 FCSRRHARTLLRQMQEAGWLTWQ   56 (564)
T ss_pred             ccCHHHHHHHHHHHHHcCCEEec
Confidence            45678999999999999999854


No 53 
>TIGR01889 Staph_reg_Sar staphylococcal accessory regulator family. This model represents a family of transcriptional regulatory proteins in Staphylococcus aureus and Staphylococcus epidermidis. Some members contain two tandem copies of this region. This family is related to the MarR transcriptional regulator family described by pfam model pfam01047.
Probab=29.55  E-value=1.1e+02  Score=19.17  Aligned_cols=33  Identities=12%  Similarity=0.264  Sum_probs=25.4

Q ss_pred             cCCCHHHHHHHHHhhhhCCcccCC-----ccEEEEEEe
Q psy11140         19 LGSSESNMAQGLSQMIIHKWLDER-----TRVILIECS   51 (89)
Q Consensus        19 L~~~~~~a~~~l~~L~~~~WiD~~-----TRav~vEft   51 (89)
                      ++.++......++.|.+.+||-+.     -|++.+.+|
T Consensus        53 l~~~~stvs~~i~~Le~kg~I~r~~~~~D~R~~~i~lT   90 (109)
T TIGR01889        53 ILIKQSALVKIIKKLSKKGYLSKERSEDDERKVIISIN   90 (109)
T ss_pred             HCCCHHHHHHHHHHHHHCCCEeccCCcccCCeEEEEEC
Confidence            466788899999999999999753     366666543


No 54 
>cd00090 HTH_ARSR Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.
Probab=29.45  E-value=60  Score=17.58  Aligned_cols=24  Identities=25%  Similarity=0.386  Sum_probs=20.2

Q ss_pred             cCCCHHHHHHHHHhhhhCCcccCC
Q psy11140         19 LGSSESNMAQGLSQMIIHKWLDER   42 (89)
Q Consensus        19 L~~~~~~a~~~l~~L~~~~WiD~~   42 (89)
                      ++.+...+...++.|.+.+||-..
T Consensus        30 ~~i~~~~i~~~l~~L~~~g~i~~~   53 (78)
T cd00090          30 LGLSQSTVSRHLKKLEEAGLVESR   53 (78)
T ss_pred             HCcCHhHHHHHHHHHHHCCCeEEE
Confidence            566778889999999999999753


No 55 
>PRK14137 recX recombination regulator RecX; Provisional
Probab=28.58  E-value=51  Score=23.69  Aligned_cols=23  Identities=13%  Similarity=0.182  Sum_probs=19.7

Q ss_pred             CCCHHHHHHHHHhhhhCCcccCC
Q psy11140         20 GSSESNMAQGLSQMIIHKWLDER   42 (89)
Q Consensus        20 ~~~~~~a~~~l~~L~~~~WiD~~   42 (89)
                      +.+.+....+|..|++.+|||..
T Consensus        68 g~~~e~Ie~vI~rL~e~gyLDD~   90 (195)
T PRK14137         68 SEDEALVTEVLERVQELGYQDDA   90 (195)
T ss_pred             CCCHHHHHHHHHHHHHcCCCCHH
Confidence            55678888999999999999874


No 56 
>PF03374 ANT:  Phage antirepressor protein KilAC domain;  InterPro: IPR005039 This entry is represented by Bacteriophage P1, Ant1 C-terminal domain, which represents the processed Ant2 chain. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. Prophages P1 and P7 exist as unit copy DNA plasmids in the bacterial cell. Maintenance of the prophage state requires the continuous expression of two repressors: (i) C1 is a protein which negatively regulates the expression of lytic genes including the C1 inactivator gene coi, and (ii) C4 is an antisense RNA which specifically inhibits the synthesis of an anti-repressor Ant.; GO: 0003677 DNA binding
Probab=27.71  E-value=1.6e+02  Score=18.37  Aligned_cols=56  Identities=13%  Similarity=-0.006  Sum_probs=32.0

Q ss_pred             HHHHHHhhhhCCcccCC--ccEEEEEEeeeeCCCCeEEEEEEEEEEcCccceeeeeEEEEee
Q psy11140         26 MAQGLSQMIIHKWLDER--TRVILIECSLYNPNINAIIAVSLMIERLGSHNYLTDSEVGIRG   85 (89)
Q Consensus        26 a~~~l~~L~~~~WiD~~--TRav~vEftlYN~n~nLF~~vtll~E~~~tG~~~~s~~v~~~~   85 (89)
                      .....+.|++++||.+.  .+-.-   .-.-.+..+|.+-.-..+.+. |...++.+.-+-.
T Consensus        38 ~~~l~~~Lr~~g~l~~~~~~~~~p---~q~~~~~G~~~~k~~~~~~~~-g~~~~~~~~~iT~   95 (111)
T PF03374_consen   38 RNKLFQWLREKGWLYRRGKGRNLP---YQKYIDAGYFEVKETTYTHSD-GEGKTSSQTRITP   95 (111)
T ss_pred             HHHHHHHHHhCCceEECCCCCccc---ChhhhccceEEEeeeEeecCC-CCcEEEEEEEEeh
Confidence            34667889999999883  12111   112244557777666666555 5555555544433


No 57 
>smart00346 HTH_ICLR helix_turn_helix isocitrate lyase regulation.
Probab=26.40  E-value=70  Score=18.89  Aligned_cols=25  Identities=20%  Similarity=0.268  Sum_probs=21.3

Q ss_pred             EcCCCHHHHHHHHHhhhhCCcccCC
Q psy11140         18 DLGSSESNMAQGLSQMIIHKWLDER   42 (89)
Q Consensus        18 ~L~~~~~~a~~~l~~L~~~~WiD~~   42 (89)
                      .++.++......|+.|.+.+||.+.
T Consensus        29 ~l~i~~~tv~r~l~~L~~~g~l~~~   53 (91)
T smart00346       29 RLGLSKSTAHRLLNTLQELGYVEQD   53 (91)
T ss_pred             HhCCCHHHHHHHHHHHHHCCCeeec
Confidence            3567789999999999999999764


No 58 
>PF12142 PPO1_DWL:  Polyphenol oxidase middle domain;  InterPro: IPR022739  This domain is found in bacteria and eukaryotes and is approximately 50 amino acids in length. It is found in association with PF00264 from PFAM and PF12143 from PFAM. Most members are annotated as being polyphenol oxidases, and many are from plants or plastids. There is a conserved DWL sequence motif. ; GO: 0004097 catechol oxidase activity, 0055114 oxidation-reduction process; PDB: 1BT3_A 1BUG_B 1BT1_B 1BT2_B 2P3X_A.
Probab=26.39  E-value=75  Score=18.60  Aligned_cols=21  Identities=19%  Similarity=0.392  Sum_probs=13.4

Q ss_pred             hCCcccCCccEEEEEEeeeeCCCCeEEE
Q psy11140         35 IHKWLDERTRVILIECSLYNPNINAIIA   62 (89)
Q Consensus        35 ~~~WiD~~TRav~vEftlYN~n~nLF~~   62 (89)
                      +..|||.       +|.+|+.|.++..+
T Consensus         4 D~dWLns-------~F~FYDen~~lVrv   24 (54)
T PF12142_consen    4 DPDWLNS-------SFLFYDENGQLVRV   24 (54)
T ss_dssp             -HHHHT--------EEEEE-TTS-EEEE
T ss_pred             ccccccC-------eeEEECCCCCEEEE
Confidence            3457763       78999999998765


No 59 
>TIGR01884 cas_HTH CRISPR locus-related DNA-binding protein. Most but not all examples of this family are associated with CRISPR loci, a combination of DNA repeats and characteristic proteins encoded near the repeat cluster. The C-terminal region of this protein is homologous to DNA-binding helix-turn-helix domains with predicted transcriptional regulatory activity.
Probab=26.19  E-value=75  Score=22.29  Aligned_cols=25  Identities=20%  Similarity=0.356  Sum_probs=21.2

Q ss_pred             cCCCHHHHHHHHHhhhhCCcccCCc
Q psy11140         19 LGSSESNMAQGLSQMIIHKWLDERT   43 (89)
Q Consensus        19 L~~~~~~a~~~l~~L~~~~WiD~~T   43 (89)
                      ++.++......|+.|.+.+||.+..
T Consensus       167 l~is~stv~r~L~~Le~~GlI~r~~  191 (203)
T TIGR01884       167 LGKSLSTISRHLRELEKKGLVEQKG  191 (203)
T ss_pred             HCcCHHHHHHHHHHHHHCCCEEEEc
Confidence            4667788999999999999998764


No 60 
>PF04937 DUF659:  Protein of unknown function (DUF 659);  InterPro: IPR007021 These are transposase-like proteins with no known function.
Probab=25.82  E-value=85  Score=21.55  Aligned_cols=25  Identities=24%  Similarity=0.591  Sum_probs=20.6

Q ss_pred             CCcccCCccEEEEEEeeeeCCCCeEE
Q psy11140         36 HKWLDERTRVILIECSLYNPNINAII   61 (89)
Q Consensus        36 ~~WiD~~TRav~vEftlYN~n~nLF~   61 (89)
                      .+|-|+.-|.+ +-|.+|.|.--.|-
T Consensus        39 DgWtd~~~~~l-Inf~v~~~~g~~Fl   63 (153)
T PF04937_consen   39 DGWTDRKGRSL-INFMVYCPEGTVFL   63 (153)
T ss_pred             ecCcCCCCCeE-EEEEEEcccccEEE
Confidence            48999999988 57999999876663


No 61 
>PRK14136 recX recombination regulator RecX; Provisional
Probab=25.44  E-value=60  Score=25.36  Aligned_cols=22  Identities=14%  Similarity=0.342  Sum_probs=19.0

Q ss_pred             CCCHHHHHHHHHhhhhCCcccC
Q psy11140         20 GSSESNMAQGLSQMIIHKWLDE   41 (89)
Q Consensus        20 ~~~~~~a~~~l~~L~~~~WiD~   41 (89)
                      +...+....+|.+|++.+|||.
T Consensus       190 G~~ee~IE~VIerLke~gYLDD  211 (309)
T PRK14136        190 ADESDSVEPLLDALEREGWLSD  211 (309)
T ss_pred             CCCHHHHHHHHHHHHHcCCcCH
Confidence            4566788899999999999986


No 62 
>PF12101 DUF3577:  Protein of unknown function (DUF3577);  InterPro: IPR021960  This family of proteins is functionally uncharacterised. This protein is found in bacteria. Proteins in this family are typically between 143 to 307 amino acids in length. 
Probab=25.42  E-value=2.1e+02  Score=19.84  Aligned_cols=50  Identities=10%  Similarity=0.009  Sum_probs=40.0

Q ss_pred             CCCe-EEEcCCCHHHHHHHHHhhhhCCcccCCccEEEEEEeeeeCCCCeEEEEE
Q psy11140         12 GGGY-VKDLGSSESNMAQGLSQMIIHKWLDERTRVILIECSLYNPNINAIIAVS   64 (89)
Q Consensus        12 ggGY-~~~L~~~~~~a~~~l~~L~~~~WiD~~TRav~vEftlYN~n~nLF~~vt   64 (89)
                      ...| .+|+--.-++|...++.+++.   .+.-|-|++-|.+=++.++.|+--+
T Consensus        48 ~~ey~~fD~~V~G~eA~~Lv~r~~~a---v~~~~KVli~FrlgDl~~d~f~~~~   98 (137)
T PF12101_consen   48 NPEYRYFDCRVVGEEAKELVRRCQKA---VDEDKKVLIGFRLGDLWADTFTYKK   98 (137)
T ss_pred             CccEEEEEEEEecHHHHHHHHHHHhh---cccCCcEEEEEEecCCceeeEEecc
Confidence            4456 367777779999999999988   2467889999999999999887533


No 63 
>PRK00117 recX recombination regulator RecX; Reviewed
Probab=25.26  E-value=66  Score=21.53  Aligned_cols=23  Identities=26%  Similarity=0.306  Sum_probs=20.0

Q ss_pred             CCCHHHHHHHHHhhhhCCcccCC
Q psy11140         20 GSSESNMAQGLSQMIIHKWLDER   42 (89)
Q Consensus        20 ~~~~~~a~~~l~~L~~~~WiD~~   42 (89)
                      |.+.+.....|..|.+.+|||..
T Consensus        39 g~~~~~i~~vl~~l~~~~~ldD~   61 (157)
T PRK00117         39 GFSEEVIEAVLDRLKEEGLLDDE   61 (157)
T ss_pred             CCCHHHHHHHHHHHHHcCCCCHH
Confidence            56778889999999999999874


No 64 
>TIGR01610 phage_O_Nterm phage replication protein O, N-terminal domain. This model represents the N-terminal region of the phage lambda replication protein O and homologous regions of other phage proteins.
Probab=25.13  E-value=72  Score=19.89  Aligned_cols=23  Identities=9%  Similarity=0.226  Sum_probs=19.6

Q ss_pred             cCCCHHHHHHHHHhhhhCCcccC
Q psy11140         19 LGSSESNMAQGLSQMIIHKWLDE   41 (89)
Q Consensus        19 L~~~~~~a~~~l~~L~~~~WiD~   41 (89)
                      ++.+++.....|+.|.+.+||-+
T Consensus        57 ~g~sr~tVsr~L~~Le~~GlI~r   79 (95)
T TIGR01610        57 TGLSRTHVSDAIKSLARRRIIFR   79 (95)
T ss_pred             HCcCHHHHHHHHHHHHHCCCeee
Confidence            46677888899999999999974


No 65 
>KOG1818|consensus
Probab=25.11  E-value=52  Score=28.12  Aligned_cols=41  Identities=22%  Similarity=0.264  Sum_probs=30.1

Q ss_pred             CCCeEEEcCCCHHHHHHHHHhhhhCCccc-CCccEEEEEEeeeeC
Q psy11140         12 GGGYVKDLGSSESNMAQGLSQMIIHKWLD-ERTRVILIECSLYNP   55 (89)
Q Consensus        12 ggGY~~~L~~~~~~a~~~l~~L~~~~WiD-~~TRav~vEftlYN~   55 (89)
                      +||+++......   ...+.....-+|+| .----+-+.|++.|-
T Consensus       139 ~~g~~Fpe~~e~---d~mf~~~~~pdW~D~~~C~rCr~~F~~~~r  180 (634)
T KOG1818|consen  139 GGGHVFPELDEN---DAMFDAETAPDWIDSEECLRCRVKFGLTNR  180 (634)
T ss_pred             cCCccccccccc---hhhhcccCCcccccccccceeeeeeeeccc
Confidence            789986554433   33899999999999 455566778888873


No 66 
>PF15480 DUF4640:  Domain of unknown function (DUF4640)
Probab=24.94  E-value=40  Score=26.05  Aligned_cols=27  Identities=22%  Similarity=0.304  Sum_probs=22.6

Q ss_pred             EEcCCCHHHHHHHHHhhhhCCcccCCc
Q psy11140         17 KDLGSSESNMAQGLSQMIIHKWLDERT   43 (89)
Q Consensus        17 ~~L~~~~~~a~~~l~~L~~~~WiD~~T   43 (89)
                      +++|.+..++.+.+..=.++.|+|.+.
T Consensus        81 iDv~sd~sDS~~nwdln~~nqW~Dk~p  107 (292)
T PF15480_consen   81 IDVGSDNSDSIANWDLNGDNQWTDKYP  107 (292)
T ss_pred             eccCCCchhhhhhhhccccccccccCh
Confidence            788888888888877777999999864


No 67 
>COG2137 OraA Uncharacterized protein conserved in bacteria [General function prediction only]
Probab=24.86  E-value=65  Score=22.90  Aligned_cols=23  Identities=17%  Similarity=0.280  Sum_probs=18.4

Q ss_pred             CCCHHHHHHHHHhhhhCCcccCC
Q psy11140         20 GSSESNMAQGLSQMIIHKWLDER   42 (89)
Q Consensus        20 ~~~~~~a~~~l~~L~~~~WiD~~   42 (89)
                      +.+...-..+|..|++.+|||..
T Consensus        48 ~~~~~~Ie~Vi~~l~~~~~ldD~   70 (174)
T COG2137          48 EFSEEIIEEVIDRLAEEGYLDDT   70 (174)
T ss_pred             cCCHHHHHHHHHHHHHcCcccHH
Confidence            34556678899999999999963


No 68 
>COG4463 CtsR Transcriptional repressor of class III stress genes [Transcription]
Probab=24.46  E-value=59  Score=22.90  Aligned_cols=8  Identities=50%  Similarity=1.331  Sum_probs=6.0

Q ss_pred             eCCCCeEE
Q psy11140         10 YNGGGYVK   17 (89)
Q Consensus        10 Y~ggGY~~   17 (89)
                      =|||||+.
T Consensus        62 RGGGGYIR   69 (153)
T COG4463          62 RGGGGYIR   69 (153)
T ss_pred             cCCCceEE
Confidence            36899984


No 69 
>cd04449 DEP_DEPDC5-like DEP (Dishevelled, Egl-10, and Pleckstrin) domain found in DEPDC5-like proteins. DEPDC5, in human also known as KIAA0645, is a DEP domain containing protein of unknown function.
Probab=24.45  E-value=81  Score=19.31  Aligned_cols=23  Identities=0%  Similarity=0.063  Sum_probs=20.6

Q ss_pred             CCHHHHHHHHHhhhhCCcccCCc
Q psy11140         21 SSESNMAQGLSQMIIHKWLDERT   43 (89)
Q Consensus        21 ~~~~~a~~~l~~L~~~~WiD~~T   43 (89)
                      .++++|....+.|.++++|.+-+
T Consensus        47 ~~r~eAv~lgq~Ll~~g~I~hv~   69 (83)
T cd04449          47 DTREEAVELGQELMNEGLIEHVS   69 (83)
T ss_pred             CCHHHHHHHHHHHHHCCCEEecC
Confidence            57899999999999999998755


No 70 
>COG0320 LipA Lipoate synthase [Coenzyme metabolism]
Probab=24.11  E-value=96  Score=24.24  Aligned_cols=30  Identities=13%  Similarity=0.221  Sum_probs=26.8

Q ss_pred             eeeCCCCeEEEcCCCHHHHHHHHHhhhhCC
Q psy11140          8 IIYNGGGYVKDLGSSESNMAQGLSQMIIHK   37 (89)
Q Consensus         8 ~~Y~ggGY~~~L~~~~~~a~~~l~~L~~~~   37 (89)
                      ..+...|-++.||.+.++-.+.+++|++++
T Consensus       212 ~i~TKSgiMlGLGEt~~Ev~e~m~DLr~~g  241 (306)
T COG0320         212 DIPTKSGLMVGLGETDEEVIEVMDDLRSAG  241 (306)
T ss_pred             CcccccceeeecCCcHHHHHHHHHHHHHcC
Confidence            356788999999999999999999999875


No 71 
>PF05649 Peptidase_M13_N:  Peptidase family M13 This is family M13 in the peptidase classification. ;  InterPro: IPR008753 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M13 (neprilysin family, clan MA(E)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA and the predicted active site residues for members of this family and thermolysin occur in the motif HEXXH []. M13 peptidases are well-studied proteases found in a wide range of organisms including mammals and bacteria. In mammals they participate in processes such as cardiovascular development, blood-pressure regulation, nervous control of respiration, and regulation of the function of neuropeptides in the central nervous system. In bacteria they may be used for digestion of milk [, ]. The family includes eukaryotic and prokaryotic oligopeptidases, as well as some of the proteins responsible for the molecular basis of the blood group antigens e.g. Kell [].  Neprilysin (3.4.24.11 from EC), is another member of this group, it is variously known as common acute lymphoblastic leukemia antigen (CALLA), enkephalinase (gp100) and neutral endopeptidase metalloendopeptidase (NEP). It is a plasma membrane-bound mammalian enzyme that is able to digest biologically-active peptides, including enkephalins []. The zinc ligands of neprilysin are known and are analogous to those in thermolysin, a related peptidase [, ]. Neprilysins, like thermolysin, are inhibited by phosphoramidon, which appears to selectively inhibit this family in mammals. The enzymes are all oligopeptidases, digesting oligo- and polypeptides, but not proteins []. Neprilysin consists of a short cytoplasmic domain, a membrane-spanning region and a large extracellular domain. The cytoplasmic domain contains a conformationally-restrained octapeptide, which is thought to act as a stop transfer sequence that prevents proteolysis and secretion [, ].; GO: 0008237 metallopeptidase activity, 0006508 proteolysis; PDB: 3DWB_A 3ZUK_A 2QPJ_A 1R1I_A 1R1J_A 1Y8J_A 1R1H_A 1DMT_A 2YB9_A.
Probab=23.99  E-value=24  Score=25.98  Aligned_cols=16  Identities=31%  Similarity=0.569  Sum_probs=10.7

Q ss_pred             HHhhhhCCcccCCccE
Q psy11140         30 LSQMIIHKWLDERTRV   45 (89)
Q Consensus        30 l~~L~~~~WiD~~TRa   45 (89)
                      ...|+++.|||+.||.
T Consensus       359 ~~~i~~~~Wld~~tk~  374 (390)
T PF05649_consen  359 RERIEESDWLDEETKK  374 (390)
T ss_dssp             HHHHCT-TTS-HHHHH
T ss_pred             HHHHhhCCCCCHHHHH
Confidence            3456788999999985


No 72 
>PLN02150 terpene synthase/cyclase family protein
Probab=23.39  E-value=38  Score=21.59  Aligned_cols=26  Identities=23%  Similarity=0.395  Sum_probs=22.3

Q ss_pred             eEEEcCCCHHHHHHHHHhhhhCCccc
Q psy11140         15 YVKDLGSSESNMAQGLSQMIIHKWLD   40 (89)
Q Consensus        15 Y~~~L~~~~~~a~~~l~~L~~~~WiD   40 (89)
                      |..+-|.+.++|.+.|+.|.++.|=|
T Consensus        13 YMke~g~seeeA~~~i~~li~~~WK~   38 (96)
T PLN02150         13 YMKQHGVTKEEAVSELKKMIRDNYKI   38 (96)
T ss_pred             HhccCCCCHHHHHHHHHHHHHHHHHH
Confidence            45566888999999999999999976


No 73 
>PF07864 DUF1651:  Protein of unknown function (DUF1651);  InterPro: IPR012447  The proteins in this entry have not been characterised.
Probab=22.76  E-value=72  Score=19.16  Aligned_cols=18  Identities=6%  Similarity=0.178  Sum_probs=16.0

Q ss_pred             CHHHHHHHHHhhhhCCcc
Q psy11140         22 SESNMAQGLSQMIIHKWL   39 (89)
Q Consensus        22 ~~~~a~~~l~~L~~~~Wi   39 (89)
                      ..++|.+.-+.|++.+|=
T Consensus        51 ~~~~A~e~W~~L~~~GW~   68 (75)
T PF07864_consen   51 TREEARELWKELQKTGWR   68 (75)
T ss_pred             EHHHHHHHHHHHHHcCCE
Confidence            359999999999999993


No 74 
>PF01726 LexA_DNA_bind:  LexA DNA binding domain;  InterPro: IPR006199 This is the DNA binding domain of the LexA SOS regulon repressor which prevents expression of DNA repair proteins in bacteria. The aligned region contains a variant form of the helix-turn-helix DNA binding motif []. This domain usually at the N terminus is found associated with IPR006198 from INTERPRO the auto-proteolytic domain of LexA 3.4.21.88 from EC.; GO: 0004252 serine-type endopeptidase activity, 0006508 proteolysis; PDB: 1LEA_A 1JHH_A 3JSP_A 1JHF_A 3JSO_B 1LEB_A 3K2Z_A.
Probab=22.29  E-value=92  Score=18.38  Aligned_cols=21  Identities=14%  Similarity=0.226  Sum_probs=18.3

Q ss_pred             CHHHHHHHHHhhhhCCcccCC
Q psy11140         22 SESNMAQGLSQMIIHKWLDER   42 (89)
Q Consensus        22 ~~~~a~~~l~~L~~~~WiD~~   42 (89)
                      +...+...|+.|.+.+||.+.
T Consensus        39 S~~tv~~~L~~Le~kG~I~r~   59 (65)
T PF01726_consen   39 STSTVQRHLKALERKGYIRRD   59 (65)
T ss_dssp             SHHHHHHHHHHHHHTTSEEEG
T ss_pred             ChHHHHHHHHHHHHCcCccCC
Confidence            478899999999999999763


No 75 
>TIGR03698 clan_AA_DTGF clan AA aspartic protease, AF_0612 family. Members of this protein family are clan AA aspartic proteases, related to family TIGR02281. These proteins resemble retropepsins, pepsin-like proteases of retroviruses such as HIV. Members of this family are found in archaea and bacteria.
Probab=22.23  E-value=1.3e+02  Score=19.18  Aligned_cols=32  Identities=16%  Similarity=0.191  Sum_probs=25.7

Q ss_pred             EEEEeeeeCCCCeEEEEEEEEEEcCccce-eee
Q psy11140         47 LIECSLYNPNINAIIAVSLMIERLGSHNY-LTD   78 (89)
Q Consensus        47 ~vEftlYN~n~nLF~~vtll~E~~~tG~~-~~s   78 (89)
                      ++++.+.||+-.-+..|.+++..-++|-+ +|.
T Consensus         1 ~~~v~~~~p~~~~~~~v~~LVDTGat~~~~l~~   33 (107)
T TIGR03698         1 TLDVELSNPKNPEFMEVRALVDTGFSGFLLVPP   33 (107)
T ss_pred             CEEEEEeCCCCCCceEEEEEEECCCCeEEecCH
Confidence            47889999954448899999999999886 664


No 76 
>PF01022 HTH_5:  Bacterial regulatory protein, arsR family;  InterPro: IPR001845 Bacterial transcription regulatory proteins that bind DNA via a helix-turn-helix (HTH) motif can be grouped into families on the basis of sequence similarities. One such group, termed arsR, includes several proteins that appear to dissociate from DNA in the presence of metal ions: arsR, which functions as a transcriptional repressor of an arsenic resistance operon; smtB from Synechococcus sp. (strain PCC 7942), which acts as a transcriptional repressor of the smtA gene that codes for a metallothionein; cadC, a protein required for cadmium-resistance; and hypothetical protein yqcJ from Bacillus subtilis. The HTH motif is thought to be located in the central part of these proteins []. The motif is characterised by a number of well-conserved residues: at its N-terminal extremity is a cysteine residue; a second Cys is found in arsR and cadC, but not in smtA; and at the C terminus lie one or two histidines. These residues may be involved in metal-binding (Zn in smtB; metal-oxyanions such as arsenite, antimonite and arsenate for arsR; and cadmium for cadC) []. It is believed that binding of a metal ion could induce a conformational change that would prevent the protein from binding DNA []. The crystal structure of the cyanobacterial smtB shows a fold of five alpha-helices (H) and a pair of antiparallel beta-strands (B) in the topology H1-H2-H3-H4-B1-B2-H5. Helices 3 and 4 comprise the helix-turn-helix motif and the beta-sheet is called the wing as in other wHTH, such as the dtxR-type or the merR-type. Helix 4 is termed the recognition helix, like in other HTHs where it binds the DNA major groove. Most arsR/smtB-like metalloregulators form homodimers []. The dimer interface is formed by helix 5 and an N-terminal part []. Two distinct metal-binding sites have been identified. The first site comprises cysteine thiolates located in the HTH in helix 3 and for some cases in the N terminus, called the alpha3(N) site []. The second metal-binding site is located in helix 5 (and C terminus) and is called the alpha5(C) site. The alpha3N site binds large thiophilic, toxic metals including Cd, Pb, and Bi, as in S. aureus cadC. ArsR lacks the N-terminal arm and its alpha3 site coordinates smaller thiophilic ions like As and Sb. The alpha5 site contains carboxylate and imidazole ligands and interacts preferentially with biologically required metal ions including Zn, Co, and Ni. ArsR-type metalloregulators contain one of these sites, both, or other potential metal-binding sites [, ]. Binding of metal ions to these sites leads to allosteric changes that can derepress the operator/promotor DNA. The metal-inducible operons contain one or two imperfect 12-2-12 inverted repeats, which can be recognised by multimeric arsR-type metalloregulators. ; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent, 0005622 intracellular; PDB: 3CUO_A 1U2W_C 3F72_C 3F6V_A 3JTH_B 2P4W_B 1KU9_B 2LKP_B 1SMT_A 1R22_B ....
Probab=22.10  E-value=98  Score=16.56  Aligned_cols=23  Identities=22%  Similarity=0.371  Sum_probs=18.4

Q ss_pred             EcCCCHHHHHHHHHhhhhCCccc
Q psy11140         18 DLGSSESNMAQGLSQMIIHKWLD   40 (89)
Q Consensus        18 ~L~~~~~~a~~~l~~L~~~~WiD   40 (89)
                      .++.++.....-|+.|++.++|.
T Consensus        24 ~l~~s~~~vs~hL~~L~~~glV~   46 (47)
T PF01022_consen   24 ELGLSQSTVSHHLKKLREAGLVE   46 (47)
T ss_dssp             HHTS-HHHHHHHHHHHHHTTSEE
T ss_pred             hccccchHHHHHHHHHHHCcCee
Confidence            35677888899999999999875


No 77 
>PRK14134 recX recombination regulator RecX; Provisional
Probab=22.09  E-value=78  Score=23.88  Aligned_cols=22  Identities=9%  Similarity=0.176  Sum_probs=19.4

Q ss_pred             CCCHHHHHHHHHhhhhCCcccC
Q psy11140         20 GSSESNMAQGLSQMIIHKWLDE   41 (89)
Q Consensus        20 ~~~~~~a~~~l~~L~~~~WiD~   41 (89)
                      +.+.+....+|+.|++.+|||.
T Consensus        89 ~~~~~~Ie~vI~~L~e~~yldD  110 (283)
T PRK14134         89 EYDEDAVNRVIRFLKEYNFIDD  110 (283)
T ss_pred             CCCHHHHHHHHHHHHHCCCCCH
Confidence            5667888899999999999986


No 78 
>PF07574 SMC_Nse1:  Nse1 non-SMC component of SMC5-6 complex;  InterPro: IPR011513  Saccharomyces cerevisiae Nse1 (Q07913 from SWISSPROT) forms part of a complex with SMC5-SMC6. This non-structural maintenance of chromosomes (SMC) complex plays an essential role in genomic stability, being involved in DNA repair and DNA metabolism [, ]. It is conserved in eukaryotes from yeast to human.; PDB: 3NW0_A.
Probab=22.01  E-value=68  Score=22.70  Aligned_cols=22  Identities=27%  Similarity=0.462  Sum_probs=16.2

Q ss_pred             CCCHHHHHHHHHhhhhCCcccC
Q psy11140         20 GSSESNMAQGLSQMIIHKWLDE   41 (89)
Q Consensus        20 ~~~~~~a~~~l~~L~~~~WiD~   41 (89)
                      +-++.++...|..|-+.+|+.+
T Consensus       163 ~L~~~eae~lL~~lv~~gWl~~  184 (200)
T PF07574_consen  163 GLSKSEAESLLDRLVEDGWLYR  184 (200)
T ss_dssp             ----HHHHHHHHHHHHTTSE-E
T ss_pred             cchHHHHHHHHHHHHHCCCcee
Confidence            4457899999999999999965


No 79 
>PF12894 Apc4_WD40:  Anaphase-promoting complex subunit 4 WD40 domain
Probab=21.82  E-value=1.6e+02  Score=16.28  Aligned_cols=17  Identities=18%  Similarity=0.499  Sum_probs=15.1

Q ss_pred             EEEeeeeCCCCeEEEEE
Q psy11140         48 IECSLYNPNINAIIAVS   64 (89)
Q Consensus        48 vEftlYN~n~nLF~~vt   64 (89)
                      |++..|+|..+|..+.+
T Consensus        14 v~~~~w~P~mdLiA~~t   30 (47)
T PF12894_consen   14 VSCMSWCPTMDLIALGT   30 (47)
T ss_pred             EEEEEECCCCCEEEEEE
Confidence            77899999999998876


No 80 
>PRK00286 xseA exodeoxyribonuclease VII large subunit; Reviewed
Probab=21.66  E-value=94  Score=24.45  Aligned_cols=41  Identities=20%  Similarity=0.237  Sum_probs=28.6

Q ss_pred             cccceeeeeCCCC-eEEE---c-----CCCHHHHHHHHHhhhhCCcccCC
Q psy11140          2 SVGPKNIIYNGGG-YVKD---L-----GSSESNMAQGLSQMIIHKWLDER   42 (89)
Q Consensus         2 ~~~G~~~~Y~ggG-Y~~~---L-----~~~~~~a~~~l~~L~~~~WiD~~   42 (89)
                      -|.|.+.+|...| |.+.   +     |.-..+-.+..+.|.+.+|+|..
T Consensus        77 ~v~g~~~~y~~~g~~ql~v~~i~~~g~G~l~~~~~~lk~~L~~eGlfd~~  126 (438)
T PRK00286         77 LVRGKVSLYEPRGDYQLIVEEIEPAGIGALAAAFEQLKEKLAAEGLFDPE  126 (438)
T ss_pred             EEEEEEEEECCCCCEEEEEEEeeeCCccHHHHHHHHHHHHHHHCCCCChh
Confidence            4789999999666 6532   2     22235556677889999999965


No 81 
>COG3147 DedD Uncharacterized protein conserved in bacteria [Function unknown]
Probab=21.46  E-value=90  Score=23.39  Aligned_cols=28  Identities=14%  Similarity=0.305  Sum_probs=23.2

Q ss_pred             CCCCeEEEcC--CCHHHHHHHHHhhhhCCc
Q psy11140         11 NGGGYVKDLG--SSESNMAQGLSQMIIHKW   38 (89)
Q Consensus        11 ~ggGY~~~L~--~~~~~a~~~l~~L~~~~W   38 (89)
                      .+++|++.||  .+.+.+.+.+..||..++
T Consensus       148 ~~~a~~VQLgAl~n~dranel~~~Lr~~G~  177 (226)
T COG3147         148 TGQAFVVQLGALKNADRANELVAKLRGAGY  177 (226)
T ss_pred             CCcceeehhhhhhhHHHHHHHHHHHHhCCC
Confidence            3689999998  567889999999998764


No 82 
>PF06970 RepA_N:  Replication initiator protein A (RepA) N-terminus;  InterPro: IPR010724 This entry represents the N terminus (approximately 80 residues) of replication initiator protein A (RepA), a DNA replication initiator in plasmids []. Most proteins in this entry are bacterial, but archaeal and eukaryotic members are also included.
Probab=21.12  E-value=1.2e+02  Score=18.52  Aligned_cols=35  Identities=23%  Similarity=0.331  Sum_probs=19.2

Q ss_pred             EEEcCCCHHHHHHHHHhh----hhCCcccCCccEEEEEEe
Q psy11140         16 VKDLGSSESNMAQGLSQM----IIHKWLDERTRVILIECS   51 (89)
Q Consensus        16 ~~~L~~~~~~a~~~l~~L----~~~~WiD~~TRav~vEft   51 (89)
                      ..+|+.+..-....|.+-    ++++|+|..-+ |++.|+
T Consensus        16 y~~Ls~~Ak~lY~ll~dR~~lS~kn~wiDe~G~-vYi~~s   54 (76)
T PF06970_consen   16 YKKLSNDAKILYSLLLDRLRLSLKNGWIDENGN-VYIIFS   54 (76)
T ss_pred             cccCCHHHHHHHHHHHHHHHhhhhcCcCCCCCC-EEEEee
Confidence            355665544333333322    37899999865 444443


No 83 
>TIGR02431 pcaR_pcaU beta-ketoadipate pathway transcriptional regulators, PcaR/PcaU/PobR family. Member of this family are IclR-type transcriptional regulators with similar DNA binding sites, able to bind at least three different metabolites related to protocatechuate metabolism. Beta-ketoadipate is the inducer for PcaR, p-hydroxybenzoate for PobR, and protocatechuate for PcaU.
Probab=21.02  E-value=98  Score=22.18  Aligned_cols=27  Identities=11%  Similarity=0.151  Sum_probs=22.8

Q ss_pred             EcCCCHHHHHHHHHhhhhCCcccCCcc
Q psy11140         18 DLGSSESNMAQGLSQMIIHKWLDERTR   44 (89)
Q Consensus        18 ~L~~~~~~a~~~l~~L~~~~WiD~~TR   44 (89)
                      .++.++..+...|+.|.+.+|+.+..+
T Consensus        33 ~lglpksT~~RlL~tL~~~G~l~~~~~   59 (248)
T TIGR02431        33 ATGLTRAAARRFLLTLVELGYVTSDGR   59 (248)
T ss_pred             HHCcCHHHHHHHHHHHHHCCCEEeCCC
Confidence            357788999999999999999987554


No 84 
>PF04703 FaeA:  FaeA-like protein; PDB: 2JT1_A 2HTJ_A.
Probab=20.96  E-value=93  Score=18.44  Aligned_cols=23  Identities=17%  Similarity=0.063  Sum_probs=19.4

Q ss_pred             cCCCHHHHHHHHHhhhhCCcccC
Q psy11140         19 LGSSESNMAQGLSQMIIHKWLDE   41 (89)
Q Consensus        19 L~~~~~~a~~~l~~L~~~~WiD~   41 (89)
                      ++-+..+++..|+.|.+.+.|.+
T Consensus        25 ~gls~~~aR~yL~~Le~eG~V~~   47 (62)
T PF04703_consen   25 LGLSIYQARYYLEKLEKEGKVER   47 (62)
T ss_dssp             HTS-HHHHHHHHHHHHHCTSEEE
T ss_pred             hCCCHHHHHHHHHHHHHCCCEEE
Confidence            56778999999999999999964


No 85 
>PRK13777 transcriptional regulator Hpr; Provisional
Probab=20.91  E-value=1.6e+02  Score=20.96  Aligned_cols=32  Identities=16%  Similarity=-0.014  Sum_probs=23.9

Q ss_pred             CCCHHHHHHHHHhhhhCCcccCC-----ccEEEEEEe
Q psy11140         20 GSSESNMAQGLSQMIIHKWLDER-----TRVILIECS   51 (89)
Q Consensus        20 ~~~~~~a~~~l~~L~~~~WiD~~-----TRav~vEft   51 (89)
                      ..++......++.|.+.+||-+.     -|...|..|
T Consensus        70 ~l~~sTvtr~l~rLE~kGlI~R~~~~~DrR~~~I~LT  106 (185)
T PRK13777         70 VMHVSTAFNFSKKLEERGYLTFSKKEDDKRNTYIELT  106 (185)
T ss_pred             CCCHhhHHHHHHHHHHCCCEEecCCCCCCCeeEEEEC
Confidence            34567788899999999999875     466666543


No 86 
>PRK06450 threonine synthase; Validated
Probab=20.19  E-value=96  Score=23.82  Aligned_cols=28  Identities=7%  Similarity=0.278  Sum_probs=23.6

Q ss_pred             HHHHHHHHhhhhCCcccCCccEEEEEEe
Q psy11140         24 SNMAQGLSQMIIHKWLDERTRVILIECS   51 (89)
Q Consensus        24 ~~a~~~l~~L~~~~WiD~~TRav~vEft   51 (89)
                      .-...-+++|...+|||+.+|.+.+|-.
T Consensus       210 ~Gi~~g~~el~~~G~i~~~prii~Vq~~  237 (338)
T PRK06450        210 LGVYSGFKHLLDSGVISEMPKIVAVQTE  237 (338)
T ss_pred             HHHHHHHHHHHhcCCccCCCeEEEEeeC
Confidence            4556778889999999999999999963


Done!