AmiGO: BLAST Results


BLAST match view associations BLAST with E1C6F6 E1C6F6 E1C6F6 Uncharacterized protein	protein from Gallus gallus	7.3e-08
BLAST match view associations BLAST with Pkd1l3 Pkd1l3 Pkd1l3 polycystic kidney disease 1 like 3	protein from Mus musculus	2.2e-07
BLAST match view associations BLAST with Gga.19764 Gga.19764 Gga.19764 Uncharacterized protein	protein from Gallus gallus	5.7e-07
BLAST match view associations BLAST with PKD2L1 PKD2L1 PKD2L1 Polycystic kidney disease 2-like 1 protein	protein from Homo sapiens	8.0e-07
BLAST match view associations BLAST with PKD2L1 PKD2L1 PKD2L1 Uncharacterized protein	protein from Canis lupus familiaris	8.0e-07
BLAST match view associations BLAST with F1MLH0 F1MLH0 F1MLH0 Uncharacterized protein	protein from Bos taurus	8.5e-07
BLAST match view associations BLAST with Pkd1l2 Pkd1l2 Pkd1l2 polycystic kidney disease 1 like 2	protein from Mus musculus	8.5e-07
BLAST match view associations BLAST with pkd2 pkd2 pkd2 polycystic kidney disease 2	gene_product from Danio rerio	1.2e-06
BLAST match view associations BLAST with Pkd2l1 Pkd2l1 Pkd2l1 polycystic kidney disease 2-like 1	gene from Rattus norvegicus	1.6e-06
BLAST match view associations BLAST with PKD2 PKD2 PKD2 Uncharacterized protein	protein from Sus scrofa	1.6e-06
BLAST match view associations BLAST with PKD2L1 PKD2L1 PKD2L1 Uncharacterized protein	protein from Gallus gallus	1.8e-06
BLAST match view associations BLAST with PKD1L2 PKD1L2 PKD1L2 Uncharacterized protein	protein from Canis lupus familiaris	2.2e-06
BLAST match view associations BLAST with PKD2L1 PKD2L1 PKD2L1 Uncharacterized protein	protein from Bos taurus	3.3e-06
BLAST match view associations BLAST with PKD2L1 PKD2L1 PKD2L1 Uncharacterized protein	protein from Sus scrofa	3.5e-06
BLAST match view associations BLAST with PKD1L2 PKD1L2 PKD1L2 Polycystic kidney disease protein 1-like 2	protein from Homo sapiens	3.7e-06
BLAST match view associations BLAST with Pkd1l3 Pkd1l3 Pkd1l3 polycystic kidney disease 1-like 3	gene from Rattus norvegicus	4.0e-06
BLAST match view associations BLAST with LOC504986 LOC504986 LOC504986 Uncharacterized protein	protein from Bos taurus	5.2e-06
BLAST match view associations BLAST with PKD1 PKD1 PKD1 Uncharacterized protein	protein from Sus scrofa	5.2e-06
BLAST match view associations BLAST with pkd-2 pkd-2 pkd-2	gene from Caenorhabditis elegans	6.3e-06
BLAST match view associations BLAST with pkd-2 pkd-2 pkd-2 Polycystin-2	protein from Caenorhabditis elegans	6.3e-06
BLAST match view associations BLAST with PKD1 PKD1 PKD1 Uncharacterized protein	protein from Canis lupus familiaris	6.5e-06
BLAST match view associations BLAST with lov-1 lov-1 lov-1	gene from Caenorhabditis elegans	1.0e-05
BLAST match view associations BLAST with lov-1 lov-1 lov-1 Location of vulva defective 1	protein from Caenorhabditis elegans	1.0e-05
BLAST match view associations BLAST with PKD2L2 PKD2L2 PKD2L2 Polycystic kidney disease 2-like 2 protein	protein from Homo sapiens	1.1e-05
BLAST match view associations BLAST with Pkd1 Pkd1 Pkd1 polycystic kidney disease 1 homolog (human)	gene from Rattus norvegicus	1.4e-05
BLAST match view associations BLAST with Pkd1 Pkd1 Pkd1 polycystic kidney disease 1 homolog	protein from Mus musculus	1.4e-05
BLAST match view associations BLAST with PKD1 PKD1 PKD1 Polycystin-1	protein from Homo sapiens	1.4e-05
BLAST match view associations BLAST with PKD2 PKD2 PKD2 Polycystin-2	protein from Bos taurus	1.9e-05
BLAST match view associations BLAST with PKD2 PKD2 PKD2 Uncharacterized protein	protein from Gallus gallus	2.3e-05
BLAST match view associations BLAST with PKD2L2 PKD2L2 PKD2L2 Uncharacterized protein	protein from Bos taurus	2.8e-05
BLAST match view associations BLAST with Pkd2l2 Pkd2l2 Pkd2l2 polycystic kidney disease 2-like 2	protein from Mus musculus	2.9e-05
BLAST match view associations BLAST with Pkd2 Pkd2 Pkd2 polycystic kidney disease 2 (autosomal dominant)	gene from Rattus norvegicus	3.1e-05
BLAST match view associations BLAST with PKD2 PKD2 PKD2 Polycystin-2	protein from Homo sapiens	3.1e-05
BLAST match view associations BLAST with pkd2l1 pkd2l1 pkd2l1 polycystic kidney disease 2-like 1	gene_product from Danio rerio	3.2e-05
BLAST match view associations BLAST with PKD1L3 PKD1L3 PKD1L3 Uncharacterized protein	protein from Canis lupus familiaris	3.3e-05
BLAST match view associations BLAST with PKD2 PKD2 PKD2 Uncharacterized protein	protein from Canis lupus familiaris	3.5e-05
BLAST match view associations BLAST with PKD2L2 PKD2L2 PKD2L2 Uncharacterized protein	protein from Canis lupus familiaris	6.2e-05
BLAST match view associations BLAST with Pkd2 Pkd2 Pkd2 polycystic kidney disease 2	protein from Mus musculus	8.3e-05
BLAST match view associations BLAST with Pkd2l2 Pkd2l2 Pkd2l2 polycystic kidney disease 2-like 2	gene from Rattus norvegicus	0.00012
BLAST match view associations BLAST with PKD2L2 PKD2L2 PKD2L2 Uncharacterized protein	protein from Gallus gallus	0.00070
Raw Blast Data

BLASTP 2.0MP-WashU [04-May-2006] [linux26-i686-ILP32F64 2006-05-09T11:47:08]

Copyright (C) 1996-2006 Washington University, Saint Louis, Missouri USA.
All Rights Reserved.

Reference:  Gish, W. (1996-2006) http://blast.wustl.edu

Query=  psy11140
        (89 letters)

Database:  go_20130330-seqdb.fasta
           368,745 sequences; 169,044,731 total letters.
Searching....10....20....30....40....50....60....70....80....90....100% done

                                                                     Smallest
                                                                       Sum
                                                              High  Probability
Sequences producing High-scoring Segment Pairs:              Score  P(N)      N

UNIPROTKB|E1C6F6 - symbol:E1C6F6 "Uncharacterized protein...   140  7.3e-08   1
MGI|MGI:2664670 - symbol:Pkd1l3 "polycystic kidney diseas...   135  2.2e-07   1
UNIPROTKB|F1N839 - symbol:Gga.19764 "Uncharacterized prot...   134  5.7e-07   1
UNIPROTKB|F1N838 - symbol:Gga.19764 "Uncharacterized prot...   134  5.7e-07   1
UNIPROTKB|Q9P0L9 - symbol:PKD2L1 "Polycystic kidney disea...   125  8.0e-07   1
UNIPROTKB|E2RIJ0 - symbol:PKD2L1 "Uncharacterized protein...   125  8.0e-07   1
UNIPROTKB|F1MLH0 - symbol:Bt.78082 "Uncharacterized prote...   130  8.5e-07   1
MGI|MGI:2664668 - symbol:Pkd1l2 "polycystic kidney diseas...   130  8.5e-07   1
ZFIN|ZDB-GENE-040827-4 - symbol:pkd2 "polycystic kidney d...   124  1.2e-06   1
RGD|1306261 - symbol:Pkd2l1 "polycystic kidney disease 2-...   122  1.6e-06   1
UNIPROTKB|F1RW49 - symbol:PKD2 "Uncharacterized protein" ...   123  1.6e-06   1
UNIPROTKB|F1N8N3 - symbol:PKD2L1 "Uncharacterized protein...   121  1.8e-06   1
UNIPROTKB|F1PCC0 - symbol:PKD1L2 "Uncharacterized protein...   126  2.2e-06   1
UNIPROTKB|F1N5R3 - symbol:PKD2L1 "Uncharacterized protein...   119  3.3e-06   1
UNIPROTKB|F1S8V0 - symbol:PKD2L1 "Uncharacterized protein...   119  3.5e-06   1
UNIPROTKB|Q7Z442 - symbol:PKD1L2 "Polycystic kidney disea...   124  3.7e-06   1
RGD|2324490 - symbol:Pkd1l3 "polycystic kidney disease 1-...   123  4.0e-06   1
UNIPROTKB|E1BC86 - symbol:LOC504986 "Uncharacterized prot...   125  5.2e-06   1
UNIPROTKB|F1RFB1 - symbol:PKD1 "Uncharacterized protein" ...   125  5.2e-06   1
WB|WBGene00004035 - symbol:pkd-2 species:6239 "Caenorhabd...   116  6.3e-06   1
UNIPROTKB|Q9U1S7 - symbol:pkd-2 "Polycystin-2" species:62...   116  6.3e-06   1
UNIPROTKB|F1Q0G0 - symbol:PKD1 "Uncharacterized protein" ...   124  6.5e-06   1
WB|WBGene00003058 - symbol:lov-1 species:6239 "Caenorhabd...   121  1.0e-05   1
UNIPROTKB|Q09624 - symbol:lov-1 "Location of vulva defect...   121  1.0e-05   1
UNIPROTKB|Q9NZM6 - symbol:PKD2L2 "Polycystic kidney disea...   113  1.1e-05   1
RGD|3333 - symbol:Pkd1 "polycystic kidney disease 1 homol...   121  1.4e-05   1
MGI|MGI:97603 - symbol:Pkd1 "polycystic kidney disease 1 ...   121  1.4e-05   1
UNIPROTKB|P98161 - symbol:PKD1 "Polycystin-1" species:960...   121  1.4e-05   1
UNIPROTKB|Q4GZT3 - symbol:PKD2 "Polycystin-2" species:991...   113  1.9e-05   1
UNIPROTKB|F1NT86 - symbol:PKD2 "Uncharacterized protein" ...   112  2.2e-05   1
UNIPROTKB|F1NDJ6 - symbol:PKD2 "Uncharacterized protein" ...   112  2.3e-05   1
UNIPROTKB|Q2TBW4 - symbol:PKD2L2 "Uncharacterized protein...   109  2.8e-05   1
MGI|MGI:1858231 - symbol:Pkd2l2 "polycystic kidney diseas...   109  2.9e-05   1
RGD|1559992 - symbol:Pkd2 "polycystic kidney disease 2 (a...   111  3.1e-05   1
UNIPROTKB|Q13563 - symbol:PKD2 "Polycystin-2" species:960...   111  3.1e-05   1
ZFIN|ZDB-GENE-030616-558 - symbol:pkd2l1 "polycystic kidn...   110  3.2e-05   1
UNIPROTKB|F1PHV2 - symbol:PKD1L3 "Uncharacterized protein...   113  3.3e-05   1
UNIPROTKB|F1PGE3 - symbol:PKD2 "Uncharacterized protein" ...   110  3.5e-05   1
UNIPROTKB|D4A828 - symbol:Pkd2l2 "Protein Pkd2l2" species...   108  3.8e-05   1
UNIPROTKB|E2RMB4 - symbol:PKD2L2 "Uncharacterized protein...   106  6.2e-05   1
MGI|MGI:1099818 - symbol:Pkd2 "polycystic kidney disease ...   107  8.3e-05   1
RGD|1310272 - symbol:Pkd2l2 "polycystic kidney disease 2-...    98  0.00012   1
UNIPROTKB|F1MAD3 - symbol:Pkd1 "Protein Pkd1" species:101...   112  0.00012   1
UNIPROTKB|F1NE51 - symbol:PKD2L2 "Uncharacterized protein...    96  0.00070   1


>UNIPROTKB|E1C6F6 [details] [associations]
            symbol:E1C6F6 "Uncharacterized protein" species:9031
            "Gallus gallus" [GO:0005509 "calcium ion binding" evidence=IEA]
            [GO:0007218 "neuropeptide signaling pathway" evidence=IEA]
            [GO:0030246 "carbohydrate binding" evidence=IEA] [GO:0016021
            "integral to membrane" evidence=IEA] InterPro:IPR000203
            InterPro:IPR000922 InterPro:IPR001024 InterPro:IPR001304
            InterPro:IPR003915 Pfam:PF00059 Pfam:PF01477 Pfam:PF01825
            Pfam:PF02140 PRINTS:PR01433 PROSITE:PS50041 PROSITE:PS50095
            PROSITE:PS50221 PROSITE:PS50228 SMART:SM00034 SMART:SM00303
            SMART:SM00308 GO:GO:0016021 GO:GO:0030246 GO:GO:0007218
            Gene3D:3.10.100.10 InterPro:IPR016186 InterPro:IPR016187
            SUPFAM:SSF56436 GO:GO:0005509 Gene3D:2.60.60.20 InterPro:IPR008976
            SUPFAM:SSF49723 InterPro:IPR022409 SMART:SM00089 InterPro:IPR002859
            Pfam:PF02010 InterPro:IPR013122 Pfam:PF08016 InterPro:IPR014010
            PROSITE:PS51111 GeneTree:ENSGT00700000104402 OMA:VQIFRNT
            EMBL:AADN02032315 EMBL:AADN02032316 EMBL:AADN02032317
            EMBL:AADN02032318 EMBL:AADN02032319 IPI:IPI00594712
            Ensembl:ENSGALT00000008727 Uniprot:E1C6F6
        Length = 2460

 Score = 140 (54.3 bits), Expect = 7.3e-08, P = 7.3e-08
 Identities = 29/76 (38%), Positives = 42/76 (55%)

Query:     6 KNIIYNGGGYVKDLGSSESNMAQGLSQMIIHKWLDERTRVILIECSLYNPNINAIIAVSL 65
             K  IY GGGYV  LG+   N ++ L  +  + WLD  TR + +E ++YN N+N    VSL
Sbjct:  2114 KLAIYGGGGYVIHLGTDPQNASRILQYLFNNVWLDTFTRAVFVEFTVYNANVNLFCIVSL 2173

Query:    66 MIERLGSHNYLTDSEV 81
             M E      + T +E+
Sbjct:  2174 MFETNALGAFFTSAEL 2189


>MGI|MGI:2664670 [details] [associations]
            symbol:Pkd1l3 "polycystic kidney disease 1 like 3"
            species:10090 "Mus musculus" [GO:0001581 "detection of chemical
            stimulus involved in sensory perception of sour taste"
            evidence=IDA] [GO:0005216 "ion channel activity" evidence=IEA]
            [GO:0005261 "cation channel activity" evidence=IDA] [GO:0005509
            "calcium ion binding" evidence=IEA] [GO:0005515 "protein binding"
            evidence=IPI] [GO:0006810 "transport" evidence=IEA] [GO:0006811
            "ion transport" evidence=IEA] [GO:0006812 "cation transport"
            evidence=IDA] [GO:0007218 "neuropeptide signaling pathway"
            evidence=IEA] [GO:0008324 "cation transmembrane transporter
            activity" evidence=IDA] [GO:0009986 "cell surface" evidence=IDA]
            [GO:0016020 "membrane" evidence=IEA] [GO:0016021 "integral to
            membrane" evidence=IEA] [GO:0030246 "carbohydrate binding"
            evidence=IEA] [GO:0033040 "sour taste receptor activity"
            evidence=IDA] [GO:0071468 "cellular response to acidity"
            evidence=IDA] InterPro:IPR000203 InterPro:IPR001024
            InterPro:IPR001304 InterPro:IPR003915 Pfam:PF01477 Pfam:PF01825
            PRINTS:PR01433 PROSITE:PS50041 PROSITE:PS50095 PROSITE:PS50221
            SMART:SM00034 SMART:SM00303 SMART:SM00308 MGI:MGI:2664670
            GO:GO:0016021 GO:GO:0006812 GO:GO:0030246 GO:GO:0007218
            Gene3D:3.10.100.10 InterPro:IPR016186 InterPro:IPR016187
            SUPFAM:SSF56436 PROSITE:PS00615 GO:GO:0005509 eggNOG:NOG12793
            GO:GO:0005216 GO:GO:0071468 Gene3D:2.60.60.20 InterPro:IPR008976
            SUPFAM:SSF49723 InterPro:IPR013122 Pfam:PF08016 CTD:342372
            HOVERGEN:HBG066396 KO:K04989 OrthoDB:EOG4S1T68 GO:GO:0001581
            EMBL:AY164486 EMBL:DQ382344 EMBL:DQ382345 EMBL:DQ382346
            EMBL:DQ382347 EMBL:DQ382348 EMBL:DQ382349 EMBL:DQ382350
            EMBL:AC125162 IPI:IPI00742441 IPI:IPI00885299 IPI:IPI00885503
            IPI:IPI00885704 IPI:IPI00885885 IPI:IPI00885891 IPI:IPI00886173
            IPI:IPI00886257 RefSeq:NP_001034789.2 RefSeq:NP_853522.2
            UniGene:Mm.436810 STRING:Q2EG98 MEROPS:T06.004 PhosphoSite:Q2EG98
            PRIDE:Q2EG98 Ensembl:ENSMUST00000057344 Ensembl:ENSMUST00000109242
            GeneID:244646 KEGG:mmu:244646 UCSC:uc009niu.1
            GeneTree:ENSGT00700000104402 InParanoid:Q2EG98 OMA:PPQVTSD
            ChiTaRS:PKD1L3 NextBio:386343 Bgee:Q2EG98 CleanEx:MM_PKD1L3
            Genevestigator:Q2EG98 Uniprot:Q2EG98
        Length = 2201

 Score = 135 (52.6 bits), Expect = 2.2e-07, P = 2.2e-07
 Identities = 25/72 (34%), Positives = 44/72 (61%)

Query:    10 YNGGGYVKDLGSSESNMAQGLSQMIIHKWLDERTRVILIECSLYNPNINAIIAVSLMIER 69
             Y+GGGYV  LG + S   + L  +   +WLD  T+ + +E +++N N+N + AV+L++E 
Sbjct:  1820 YSGGGYVVRLGRNHSAATRVLQHLEQRRWLDHCTKALFVEFTVFNANVNLLCAVTLILES 1879

Query:    70 LGSHNYLTDSEV 81
              G   +LT  ++
Sbjct:  1880 SGVGTFLTSLQL 1891


>UNIPROTKB|F1N839 [details] [associations]
            symbol:Gga.19764 "Uncharacterized protein" species:9031
            "Gallus gallus" [GO:0007218 "neuropeptide signaling pathway"
            evidence=IEA] [GO:0030246 "carbohydrate binding" evidence=IEA]
            [GO:0016021 "integral to membrane" evidence=IEA] InterPro:IPR001611
            InterPro:IPR000203 InterPro:IPR000434 InterPro:IPR001024
            InterPro:IPR001304 Pfam:PF00059 Pfam:PF01477 Pfam:PF01825
            PRINTS:PR00500 PROSITE:PS50041 PROSITE:PS50095 PROSITE:PS50221
            PROSITE:PS51450 SMART:SM00034 SMART:SM00303 SMART:SM00308
            InterPro:IPR002889 GO:GO:0016021 GO:GO:0030246 GO:GO:0007218
            Gene3D:3.10.100.10 InterPro:IPR016186 InterPro:IPR016187
            SUPFAM:SSF56436 InterPro:IPR000483 InterPro:IPR003591 SMART:SM00369
            SMART:SM00082 Gene3D:2.60.60.20 InterPro:IPR008976 SUPFAM:SSF49723
            Gene3D:2.60.40.670 InterPro:IPR022409 InterPro:IPR000601
            Pfam:PF00801 SMART:SM00089 SUPFAM:SSF49299 PROSITE:PS50093
            InterPro:IPR002859 Pfam:PF02010 Pfam:PF01822 PROSITE:PS51212
            InterPro:IPR013122 Pfam:PF08016 InterPro:IPR014010 PROSITE:PS51111
            GeneTree:ENSGT00700000104402 InterPro:IPR006228 TIGRFAMs:TIGR00864
            EMBL:AADN02023661 IPI:IPI00597057 Ensembl:ENSGALT00000009166
            Uniprot:F1N839
        Length = 4275

 Score = 134 (52.2 bits), Expect = 5.7e-07, P = 5.7e-07
 Identities = 26/69 (37%), Positives = 45/69 (65%)

Query:    10 YNGGGYVKDLGSS-ESNMAQGLSQMIIHKWLDERTRVILIECSLYNPNINAIIAVSLMIE 68
             Y+ GGY+++LG+S E   AQ L+ +  H W+D  +RV+ +E   YNP+++   A++L +E
Sbjct:  3766 YDSGGYIQELGTSLEEGRAQ-LNYLQQHTWIDNMSRVVFVELMQYNPSVDLHAAITLQLE 3824

Query:    69 RLGSHNYLT 77
              LG+   +T
Sbjct:  3825 FLGAGQAVT 3833


>UNIPROTKB|F1N838 [details] [associations]
            symbol:Gga.19764 "Uncharacterized protein" species:9031
            "Gallus gallus" [GO:0007218 "neuropeptide signaling pathway"
            evidence=IEA] [GO:0030246 "carbohydrate binding" evidence=IEA]
            [GO:0016021 "integral to membrane" evidence=IEA] [GO:0001502
            "cartilage condensation" evidence=IEA] [GO:0001822 "kidney
            development" evidence=IEA] [GO:0001892 "embryonic placenta
            development" evidence=IEA] [GO:0002133 "polycystin complex"
            evidence=IEA] [GO:0005261 "cation channel activity" evidence=IEA]
            [GO:0005634 "nucleus" evidence=IEA] [GO:0005737 "cytoplasm"
            evidence=IEA] [GO:0005886 "plasma membrane" evidence=IEA]
            [GO:0006611 "protein export from nucleus" evidence=IEA] [GO:0006816
            "calcium ion transport" evidence=IEA] [GO:0007050 "cell cycle
            arrest" evidence=IEA] [GO:0007259 "JAK-STAT cascade" evidence=IEA]
            [GO:0007507 "heart development" evidence=IEA] [GO:0018105
            "peptidyl-serine phosphorylation" evidence=IEA] [GO:0031512 "motile
            primary cilium" evidence=IEA] [GO:0032092 "positive regulation of
            protein binding" evidence=IEA] [GO:0042994 "cytoplasmic
            sequestering of transcription factor" evidence=IEA] [GO:0050982
            "detection of mechanical stimulus" evidence=IEA] [GO:0060674
            "placenta blood vessel development" evidence=IEA]
            InterPro:IPR001611 InterPro:IPR000203 InterPro:IPR000434
            InterPro:IPR001024 InterPro:IPR001304 Pfam:PF00059 Pfam:PF01477
            Pfam:PF01825 PRINTS:PR00500 PROSITE:PS50041 PROSITE:PS50095
            PROSITE:PS50221 PROSITE:PS51450 SMART:SM00034 SMART:SM00303
            SMART:SM00308 InterPro:IPR002889 GO:GO:0016021 GO:GO:0005886
            GO:GO:0005634 GO:GO:0005737 GO:GO:0032092 GO:GO:0030246
            GO:GO:0007218 Gene3D:3.10.100.10 InterPro:IPR016186
            InterPro:IPR016187 SUPFAM:SSF56436 InterPro:IPR000483
            InterPro:IPR003591 SMART:SM00369 SMART:SM00082 GO:GO:0007050
            GO:GO:0018105 GO:GO:0005261 GO:GO:0006816 GO:GO:0016337
            GO:GO:0006611 GO:GO:0042994 GO:GO:0007259 GO:GO:0031512
            Gene3D:2.60.60.20 InterPro:IPR008976 SUPFAM:SSF49723
            Gene3D:2.60.40.670 InterPro:IPR022409 InterPro:IPR000601
            Pfam:PF00801 SMART:SM00089 SUPFAM:SSF49299 PROSITE:PS50093
            InterPro:IPR002859 Pfam:PF02010 Pfam:PF01822 PROSITE:PS51212
            InterPro:IPR013122 Pfam:PF08016 GO:GO:0050982 InterPro:IPR014010
            PROSITE:PS51111 GeneTree:ENSGT00700000104402 OMA:GQCNTDL
            GO:GO:0002133 InterPro:IPR006228 TIGRFAMs:TIGR00864
            EMBL:AADN02023661 IPI:IPI00588585 Ensembl:ENSGALT00000009168
            Uniprot:F1N838
        Length = 4277

 Score = 134 (52.2 bits), Expect = 5.7e-07, P = 5.7e-07
 Identities = 26/69 (37%), Positives = 45/69 (65%)

Query:    10 YNGGGYVKDLGSS-ESNMAQGLSQMIIHKWLDERTRVILIECSLYNPNINAIIAVSLMIE 68
             Y+ GGY+++LG+S E   AQ L+ +  H W+D  +RV+ +E   YNP+++   A++L +E
Sbjct:  3769 YDSGGYIQELGTSLEEGRAQ-LNYLQQHTWIDNMSRVVFVELMQYNPSVDLHAAITLQLE 3827

Query:    69 RLGSHNYLT 77
              LG+   +T
Sbjct:  3828 FLGAGQAVT 3836


>UNIPROTKB|Q9P0L9 [details] [associations]
            symbol:PKD2L1 "Polycystic kidney disease 2-like 1 protein"
            species:9606 "Homo sapiens" [GO:0008092 "cytoskeletal protein
            binding" evidence=IPI] [GO:0016021 "integral to membrane"
            evidence=NAS] [GO:0005515 "protein binding" evidence=IPI]
            [GO:0015269 "calcium-activated potassium channel activity"
            evidence=IDA] [GO:0071805 "potassium ion transmembrane transport"
            evidence=IDA] [GO:0005272 "sodium channel activity" evidence=IDA]
            [GO:0035725 "sodium ion transmembrane transport" evidence=IDA]
            [GO:0005509 "calcium ion binding" evidence=ISS] [GO:0042802
            "identical protein binding" evidence=ISS] [GO:0001581 "detection of
            chemical stimulus involved in sensory perception of sour taste"
            evidence=ISS] [GO:0006812 "cation transport" evidence=ISS]
            [GO:0008324 "cation transmembrane transporter activity"
            evidence=ISS] [GO:0033040 "sour taste receptor activity"
            evidence=ISS] [GO:0005227 "calcium activated cation channel
            activity" evidence=IDA] [GO:0005783 "endoplasmic reticulum"
            evidence=ISS] [GO:0009986 "cell surface" evidence=ISS] [GO:0071468
            "cellular response to acidity" evidence=ISS] [GO:0043231
            "intracellular membrane-bounded organelle" evidence=IDA]
            [GO:0005886 "plasma membrane" evidence=IMP] [GO:0005261 "cation
            channel activity" evidence=IDA] [GO:0051393 "alpha-actinin binding"
            evidence=IPI] [GO:0051371 "muscle alpha-actinin binding"
            evidence=IPI] InterPro:IPR003915 InterPro:IPR011992 PRINTS:PR01433
            Prosite:PS00018 GO:GO:0005783 GO:GO:0016021 GO:GO:0005886
            GO:GO:0009986 EMBL:CH471066 GO:GO:0005509 Gene3D:1.10.238.10
            GO:GO:0005272 GO:GO:0042802 EMBL:AL139819 GO:GO:0071468
            GO:GO:0015269 InterPro:IPR013122 Pfam:PF08016 GO:GO:0001581
            EMBL:AF073481 EMBL:AF153474 EMBL:AF153459 EMBL:AF153460
            EMBL:AF153461 EMBL:AF153462 EMBL:AF153463 EMBL:AF153464
            EMBL:AF153465 EMBL:AF153466 EMBL:AF153467 EMBL:AF153468
            EMBL:AF153469 EMBL:AF153470 EMBL:AF153471 EMBL:AF153472
            EMBL:AF153473 EMBL:BC025665 EMBL:AF094827 EMBL:AF053316
            IPI:IPI00103744 IPI:IPI00219270 IPI:IPI00219271 IPI:IPI00219272
            RefSeq:NP_001240766.1 RefSeq:NP_057196.2 UniGene:Hs.159241 PDB:3TE3
            PDB:4GIF PDBsum:3TE3 PDBsum:4GIF ProteinModelPortal:Q9P0L9
            SMR:Q9P0L9 STRING:Q9P0L9 DMDM:23821938 PaxDb:Q9P0L9 PRIDE:Q9P0L9
            DNASU:9033 Ensembl:ENST00000318222 Ensembl:ENST00000338519
            Ensembl:ENST00000353274 GeneID:9033 KEGG:hsa:9033 UCSC:uc001kqx.1
            CTD:9033 GeneCards:GC10M102037 HGNC:HGNC:9011 HPA:CAB022621
            MIM:604532 neXtProt:NX_Q9P0L9 PharmGKB:PA33344 eggNOG:NOG325704
            HOGENOM:HOG000230858 HOVERGEN:HBG014945 InParanoid:Q9P0L9 KO:K04990
            OMA:GFHIFRT OrthoDB:EOG4D52X2 PhylomeDB:Q9P0L9 ChEMBL:CHEMBL1628480
            GenomeRNAi:9033 NextBio:33843 ArrayExpress:Q9P0L9 Bgee:Q9P0L9
            CleanEx:HS_PKD2L1 Genevestigator:Q9P0L9 GermOnline:ENSG00000107593
            GO:GO:0033040 Uniprot:Q9P0L9
        Length = 805

 Score = 125 (49.1 bits), Expect = 8.0e-07, P = 8.0e-07
 Identities = 25/59 (42%), Positives = 34/59 (57%)

Query:    10 YNGGGYVKDLGSSESNMAQGLSQMIIHKWLDERTRVILIECSLYNPNINAIIAVSLMIE 68
             Y+GGGY  DL  S    A+ L  +    WLD  TRV+ I+ S+YN NIN    + L++E
Sbjct:   265 YSGGGYYLDLPGSRQGSAEALRALQEGLWLDRGTRVVFIDFSVYNANINLFCVLRLVVE 323


>UNIPROTKB|E2RIJ0 [details] [associations]
            symbol:PKD2L1 "Uncharacterized protein" species:9615 "Canis
            lupus familiaris" [GO:0071468 "cellular response to acidity"
            evidence=IEA] [GO:0051371 "muscle alpha-actinin binding"
            evidence=IEA] [GO:0042802 "identical protein binding" evidence=IEA]
            [GO:0033040 "sour taste receptor activity" evidence=IEA]
            [GO:0015269 "calcium-activated potassium channel activity"
            evidence=IEA] [GO:0009986 "cell surface" evidence=IEA] [GO:0005886
            "plasma membrane" evidence=IEA] [GO:0005783 "endoplasmic reticulum"
            evidence=IEA] [GO:0005509 "calcium ion binding" evidence=IEA]
            [GO:0005272 "sodium channel activity" evidence=IEA]
            InterPro:IPR002048 InterPro:IPR003915 InterPro:IPR011992
            PRINTS:PR01433 PROSITE:PS50222 GO:GO:0005783 GO:GO:0005886
            GO:GO:0009986 GO:GO:0005509 Gene3D:1.10.238.10 GO:GO:0005272
            GO:GO:0071468 GO:GO:0015269 InterPro:IPR013122 Pfam:PF08016
            OMA:GFHIFRT GO:GO:0033040 GeneTree:ENSGT00700000104221
            EMBL:AAEX03015467 Ensembl:ENSCAFT00000015327 Uniprot:E2RIJ0
        Length = 806

 Score = 125 (49.1 bits), Expect = 8.0e-07, P = 8.0e-07
 Identities = 25/59 (42%), Positives = 34/59 (57%)

Query:    10 YNGGGYVKDLGSSESNMAQGLSQMIIHKWLDERTRVILIECSLYNPNINAIIAVSLMIE 68
             Y+GGGY  DL  S    A+ L  +    WLD  TRV+ I+ S+YN NIN    + L++E
Sbjct:   265 YSGGGYYLDLPGSRQASAEALQDLQEGLWLDRGTRVVFIDFSVYNANINLFCVLRLVVE 323


>UNIPROTKB|F1MLH0 [details] [associations]
            symbol:Bt.78082 "Uncharacterized protein" species:9913 "Bos
            taurus" [GO:0016021 "integral to membrane" evidence=IEA]
            [GO:0030246 "carbohydrate binding" evidence=IEA] [GO:0007218
            "neuropeptide signaling pathway" evidence=IEA] [GO:0005509 "calcium
            ion binding" evidence=IEA] InterPro:IPR000203 InterPro:IPR000922
            InterPro:IPR001024 InterPro:IPR001304 InterPro:IPR003915
            Pfam:PF00059 Pfam:PF01477 Pfam:PF01825 Pfam:PF02140 PRINTS:PR01433
            PROSITE:PS50041 PROSITE:PS50095 PROSITE:PS50221 PROSITE:PS50228
            SMART:SM00034 SMART:SM00303 SMART:SM00308 GO:GO:0016021
            GO:GO:0030246 GO:GO:0007218 Gene3D:3.10.100.10 InterPro:IPR016186
            InterPro:IPR016187 SUPFAM:SSF56436 GO:GO:0005509 Gene3D:2.60.60.20
            InterPro:IPR008976 SUPFAM:SSF49723 InterPro:IPR002859 Pfam:PF02010
            InterPro:IPR013122 Pfam:PF08016 InterPro:IPR014010 PROSITE:PS51111
            GeneTree:ENSGT00700000104402 EMBL:DAAA02046106 EMBL:DAAA02046107
            EMBL:DAAA02046108 EMBL:DAAA02046109 IPI:IPI00709677
            Ensembl:ENSBTAT00000061305 OMA:VQIFRNT Uniprot:F1MLH0
        Length = 2458

 Score = 130 (50.8 bits), Expect = 8.5e-07, P = 8.5e-07
 Identities = 23/63 (36%), Positives = 37/63 (58%)

Query:     6 KNIIYNGGGYVKDLGSSESNMAQGLSQMIIHKWLDERTRVILIECSLYNPNINAIIAVSL 65
             K  +Y GGGYV  LG+   + ++ L  +  + WLD  TR + +E ++YN N+N    V+L
Sbjct:  2096 KLTVYRGGGYVVSLGTDRQSASRTLQYLFDNTWLDSLTRAVFVEFTVYNANVNLFCIVTL 2155

Query:    66 MIE 68
              +E
Sbjct:  2156 TLE 2158


>MGI|MGI:2664668 [details] [associations]
            symbol:Pkd1l2 "polycystic kidney disease 1 like 2"
            species:10090 "Mus musculus" [GO:0001965 "G-protein alpha-subunit
            binding" evidence=ISO] [GO:0005509 "calcium ion binding"
            evidence=IEA] [GO:0007218 "neuropeptide signaling pathway"
            evidence=IEA] [GO:0008150 "biological_process" evidence=ND]
            [GO:0016020 "membrane" evidence=IEA] [GO:0016021 "integral to
            membrane" evidence=IEA] [GO:0030246 "carbohydrate binding"
            evidence=IEA] InterPro:IPR000203 InterPro:IPR000922
            InterPro:IPR001024 InterPro:IPR001304 InterPro:IPR003915
            Pfam:PF00059 Pfam:PF01477 Pfam:PF01825 Pfam:PF02140 PRINTS:PR01433
            PROSITE:PS50041 PROSITE:PS50095 PROSITE:PS50221 PROSITE:PS50228
            SMART:SM00034 SMART:SM00303 SMART:SM00308 MGI:MGI:2664668
            GO:GO:0016021 GO:GO:0030246 GO:GO:0007218 Gene3D:3.10.100.10
            InterPro:IPR016186 InterPro:IPR016187 SUPFAM:SSF56436
            PROSITE:PS00615 GO:GO:0005509 eggNOG:NOG12793 Gene3D:2.60.60.20
            InterPro:IPR008976 SUPFAM:SSF49723 InterPro:IPR022409 SMART:SM00089
            PROSITE:PS50093 InterPro:IPR002859 Pfam:PF02010 HSSP:P22897
            InterPro:IPR013122 Pfam:PF08016 InterPro:IPR014010 PROSITE:PS51111
            CTD:114780 HOVERGEN:HBG108252 KO:K04988 OrthoDB:EOG44TP6Z
            EMBL:AY164484 IPI:IPI00318010 RefSeq:NP_083962.4 UniGene:Mm.159753
            ProteinModelPortal:Q7TN88 SMR:Q7TN88 STRING:Q7TN88
            PhosphoSite:Q7TN88 PRIDE:Q7TN88 GeneID:76645 KEGG:mmu:76645
            UCSC:uc012gli.1 HOGENOM:HOG000169076 InParanoid:Q7TN88
            NextBio:345536 CleanEx:MM_PKD1L2 Genevestigator:Q7TN88
            Uniprot:Q7TN88
        Length = 2461

 Score = 130 (50.8 bits), Expect = 8.5e-07, P = 8.5e-07
 Identities = 24/66 (36%), Positives = 38/66 (57%)

Query:     6 KNIIYNGGGYVKDLGSSESNMAQGLSQMIIHKWLDERTRVILIECSLYNPNINAIIAVSL 65
             K  +Y GGGYV  LG+   + ++ L  +  + WLD  TR + +E ++YN N+N    V+L
Sbjct:  2098 KLTLYGGGGYVVPLGTDHQSASRILQYLFDNSWLDALTRAVFVEFTVYNANVNLFCTVTL 2157

Query:    66 MIERLG 71
              +E  G
Sbjct:  2158 TLETSG 2163


>ZFIN|ZDB-GENE-040827-4 [details] [associations]
            symbol:pkd2 "polycystic kidney disease 2"
            species:7955 "Danio rerio" [GO:0005509 "calcium ion binding"
            evidence=IEA] [GO:0016020 "membrane" evidence=IEA] [GO:0016323
            "basolateral plasma membrane" evidence=IDA] [GO:0005929 "cilium"
            evidence=IDA] [GO:0048793 "pronephros development"
            evidence=IGI;IMP] [GO:0005783 "endoplasmic reticulum"
            evidence=ISS;IDA] [GO:0001947 "heart looping" evidence=IMP]
            [GO:0003143 "embryonic heart tube morphogenesis" evidence=IMP]
            [GO:0007368 "determination of left/right symmetry"
            evidence=IGI;IMP] [GO:0003146 "heart jogging" evidence=IMP]
            [GO:0016328 "lateral plasma membrane" evidence=ISS] [GO:0072019
            "proximal convoluted tubule development" evidence=IMP] [GO:0009953
            "dorsal/ventral pattern formation" evidence=IMP] [GO:0072114
            "pronephros morphogenesis" evidence=IMP] [GO:0032965 "regulation of
            collagen biosynthetic process" evidence=IMP] InterPro:IPR002048
            InterPro:IPR003915 InterPro:IPR011992 PRINTS:PR01433
            PROSITE:PS50222 ZFIN:ZDB-GENE-040827-4 GO:GO:0005783 GO:GO:0005929
            GO:GO:0005509 Gene3D:1.10.238.10 GO:GO:0016323 GO:GO:0001947
            GO:GO:0009953 GO:GO:0016328 GO:GO:0003146 InterPro:IPR013122
            Pfam:PF08016 HOVERGEN:HBG014945 GeneTree:ENSGT00700000104221
            CTD:5311 KO:K04986 OMA:AWSRDNP EMBL:CR788312 GO:GO:0072114
            GO:GO:0072019 EMBL:AY618926 IPI:IPI00486792 RefSeq:NP_001002310.1
            UniGene:Dr.92211 STRING:Q6IVV8 Ensembl:ENSDART00000020412
            GeneID:432387 KEGG:dre:432387 InParanoid:Q6IVV8 NextBio:20831024
            GO:GO:0032965 Uniprot:Q6IVV8
        Length = 904

 Score = 124 (48.7 bits), Expect = 1.2e-06, P = 1.2e-06
 Identities = 22/59 (37%), Positives = 34/59 (57%)

Query:    10 YNGGGYVKDLGSSESNMAQGLSQMIIHKWLDERTRVILIECSLYNPNINAIIAVSLMIE 68
             Y GGGY +DL  +    A  L ++  + WLD  TR + ++ S+YN N+N    V L++E
Sbjct:   322 YGGGGYYQDLSRTREKSANQLQELKNNLWLDRGTRAVFLDFSIYNGNVNLFCIVRLLVE 380


>RGD|1306261 [details] [associations]
            symbol:Pkd2l1 "polycystic kidney disease 2-like 1" species:10116
            "Rattus norvegicus" [GO:0001581 "detection of chemical stimulus
            involved in sensory perception of sour taste" evidence=ISO]
            [GO:0005227 "calcium activated cation channel activity"
            evidence=ISO] [GO:0005261 "cation channel activity" evidence=ISO]
            [GO:0005272 "sodium channel activity" evidence=ISO] [GO:0005509
            "calcium ion binding" evidence=IEA;ISO] [GO:0005783 "endoplasmic
            reticulum" evidence=ISO] [GO:0005886 "plasma membrane"
            evidence=ISO] [GO:0006812 "cation transport" evidence=ISO]
            [GO:0008092 "cytoskeletal protein binding" evidence=ISO]
            [GO:0015269 "calcium-activated potassium channel activity"
            evidence=ISO] [GO:0016020 "membrane" evidence=IEA] [GO:0034220 "ion
            transmembrane transport" evidence=ISO] [GO:0035725 "sodium ion
            transmembrane transport" evidence=ISO] [GO:0042802 "identical
            protein binding" evidence=ISO] [GO:0043231 "intracellular
            membrane-bounded organelle" evidence=ISO] [GO:0051371 "muscle
            alpha-actinin binding" evidence=ISO] [GO:0051393 "alpha-actinin
            binding" evidence=ISO] [GO:0071468 "cellular response to acidity"
            evidence=ISO] [GO:0071805 "potassium ion transmembrane transport"
            evidence=ISO] [GO:0009986 "cell surface" evidence=ISO] [GO:0008324
            "cation transmembrane transporter activity" evidence=ISO]
            [GO:0033040 "sour taste receptor activity" evidence=ISO]
            InterPro:IPR003915 InterPro:IPR011992 PRINTS:PR01433 RGD:1306261
            GO:GO:0016020 GO:GO:0005509 Gene3D:1.10.238.10 InterPro:IPR013122
            Pfam:PF08016 OMA:GFHIFRT IPI:IPI00361295 Ensembl:ENSRNOT00000016899
            Uniprot:D3ZVL7
        Length = 763

 Score = 122 (48.0 bits), Expect = 1.6e-06, P = 1.6e-06
 Identities = 25/59 (42%), Positives = 34/59 (57%)

Query:    10 YNGGGYVKDLGSSESNMAQGLSQMIIHKWLDERTRVILIECSLYNPNINAIIAVSLMIE 68
             Y+GGGY  DL  S    A+ L  +    WLD  TRV+ I+ S+YN NIN    + L++E
Sbjct:   265 YSGGGYYLDLPGSRQASAEALQGLQEGLWLDRGTRVVFIDFSVYNANINLFCILRLVVE 323


>UNIPROTKB|F1RW49 [details] [associations]
            symbol:PKD2 "Uncharacterized protein" species:9823 "Sus
            scrofa" [GO:0048763 "calcium-induced calcium release activity"
            evidence=IEA] [GO:0045944 "positive regulation of transcription
            from RNA polymerase II promoter" evidence=IEA] [GO:0045429
            "positive regulation of nitric oxide biosynthetic process"
            evidence=IEA] [GO:0045180 "basal cortex" evidence=IEA] [GO:0044441
            "cilium part" evidence=IEA] [GO:0044325 "ion channel binding"
            evidence=IEA] [GO:0043398 "HLH domain binding" evidence=IEA]
            [GO:0042994 "cytoplasmic sequestering of transcription factor"
            evidence=IEA] [GO:0042805 "actinin binding" evidence=IEA]
            [GO:0042803 "protein homodimerization activity" evidence=IEA]
            [GO:0042127 "regulation of cell proliferation" evidence=IEA]
            [GO:0035904 "aorta development" evidence=IEA] [GO:0035502
            "metanephric part of ureteric bud development" evidence=IEA]
            [GO:0031941 "filamentous actin" evidence=IEA] [GO:0031659 "positive
            regulation of cyclin-dependent protein serine/threonine kinase
            activity involved in G1/S" evidence=IEA] [GO:0031587 "positive
            regulation of inositol 1,4,5-trisphosphate-sensitive
            calcium-release channel activity" evidence=IEA] [GO:0031513
            "nonmotile primary cilium" evidence=IEA] [GO:0031512 "motile
            primary cilium" evidence=IEA] [GO:0030814 "regulation of cAMP
            metabolic process" evidence=IEA] [GO:0030027 "lamellipodium"
            evidence=IEA] [GO:0021915 "neural tube development" evidence=IEA]
            [GO:0021510 "spinal cord development" evidence=IEA] [GO:0009925
            "basal plasma membrane" evidence=IEA] [GO:0007507 "heart
            development" evidence=IEA] [GO:0007259 "JAK-STAT cascade"
            evidence=IEA] [GO:0007050 "cell cycle arrest" evidence=IEA]
            [GO:0005932 "microtubule basal body" evidence=IEA] [GO:0005911
            "cell-cell junction" evidence=IEA] [GO:0005887 "integral to plasma
            membrane" evidence=IEA] [GO:0005509 "calcium ion binding"
            evidence=IEA] [GO:0005267 "potassium channel activity"
            evidence=IEA] [GO:0005248 "voltage-gated sodium channel activity"
            evidence=IEA] [GO:0005245 "voltage-gated calcium channel activity"
            evidence=IEA] [GO:0005102 "receptor binding" evidence=IEA]
            [GO:0003127 "detection of nodal flow" evidence=IEA] [GO:0002133
            "polycystin complex" evidence=IEA] [GO:0001892 "embryonic placenta
            development" evidence=IEA] [GO:0001889 "liver development"
            evidence=IEA] [GO:0001658 "branching involved in ureteric bud
            morphogenesis" evidence=IEA] [GO:2000134 "negative regulation of
            G1/S transition of mitotic cell cycle" evidence=IEA] [GO:0090279
            "regulation of calcium ion import" evidence=IEA] [GO:0072686
            "mitotic spindle" evidence=IEA] [GO:0072284 "metanephric S-shaped
            body morphogenesis" evidence=IEA] [GO:0072235 "metanephric distal
            tubule development" evidence=IEA] [GO:0072219 "metanephric cortical
            collecting duct development" evidence=IEA] [GO:0072218 "metanephric
            ascending thin limb development" evidence=IEA] [GO:0072214
            "metanephric cortex development" evidence=IEA] [GO:0072208
            "metanephric smooth muscle tissue development" evidence=IEA]
            [GO:0072177 "mesonephric duct development" evidence=IEA]
            [GO:0072075 "metanephric mesenchyme development" evidence=IEA]
            [GO:0071556 "integral to lumenal side of endoplasmic reticulum
            membrane" evidence=IEA] [GO:0071498 "cellular response to fluid
            shear stress" evidence=IEA] [GO:0071470 "cellular response to
            osmotic stress" evidence=IEA] [GO:0071464 "cellular response to
            hydrostatic pressure" evidence=IEA] [GO:0071458 "integral to
            cytosolic side of endoplasmic reticulum membrane" evidence=IEA]
            [GO:0071158 "positive regulation of cell cycle arrest"
            evidence=IEA] [GO:0061441 "renal artery morphogenesis"
            evidence=IEA] [GO:0061371 "determination of heart left/right
            asymmetry" evidence=IEA] [GO:0061333 "renal tubule morphogenesis"
            evidence=IEA] [GO:0060674 "placenta blood vessel development"
            evidence=IEA] [GO:0060315 "negative regulation of
            ryanodine-sensitive calcium-release channel activity" evidence=IEA]
            [GO:0051209 "release of sequestered calcium ion into cytosol"
            evidence=IEA] [GO:0051117 "ATPase binding" evidence=IEA]
            [GO:0050982 "detection of mechanical stimulus" evidence=IEA]
            InterPro:IPR002048 InterPro:IPR003915 InterPro:IPR011992
            PRINTS:PR01433 PROSITE:PS50222 GO:GO:0007507 GO:GO:0071556
            GO:GO:0005887 GO:GO:0071158 GO:GO:0051209 GO:GO:0045944
            GO:GO:0005509 Gene3D:1.10.238.10 GO:GO:0001889 GO:GO:0007050
            GO:GO:0045180 GO:GO:0005911 GO:GO:0030027 GO:GO:0005267
            GO:GO:0042127 GO:GO:0031941 GO:GO:0031659 GO:GO:0071470
            GO:GO:0045429 GO:GO:0005932 GO:GO:0021510 GO:GO:0021915
            GO:GO:0001658 GO:GO:0009925 GO:GO:2000134 GO:GO:0001892
            GO:GO:0005248 GO:GO:0072686 GO:GO:0060315 GO:GO:0072075
            GO:GO:0031513 GO:GO:0061371 GO:GO:0005245 GO:GO:0042994
            GO:GO:0035502 GO:GO:0090279 GO:GO:0007259 GO:GO:0060674
            GO:GO:0071464 GO:GO:0003127 GO:GO:0031512 GO:GO:0030814
            GO:GO:0071498 GO:GO:0061333 GO:GO:0071458 GO:GO:0072177
            GO:GO:0072284 InterPro:IPR013122 Pfam:PF08016 GO:GO:0050982
            GO:GO:0072208 GO:GO:0044441 GeneTree:ENSGT00700000104221
            GO:GO:0002133 GO:GO:0072218 OMA:AWSRDNP GO:GO:0048763 GO:GO:0035904
            GO:GO:0072214 GO:GO:0072219 GO:GO:0072235 GO:GO:0031587
            GO:GO:0061441 EMBL:CU856168 EMBL:CU928800
            Ensembl:ENSSSCT00000010093 Uniprot:F1RW49
        Length = 970

 Score = 123 (48.4 bits), Expect = 1.6e-06, P = 1.6e-06
 Identities = 23/59 (38%), Positives = 33/59 (55%)

Query:    10 YNGGGYVKDLGSSESNMAQGLSQMIIHKWLDERTRVILIECSLYNPNINAIIAVSLMIE 68
             Y+G GY  DL  +    A  L+ +  H WLD  TR + I+ S+YN NIN    + L++E
Sbjct:   388 YSGAGYYLDLSRTREETAAQLAHLRKHAWLDRGTRAMFIDFSVYNANINLFCVIRLLVE 446


>UNIPROTKB|F1N8N3 [details] [associations]
            symbol:PKD2L1 "Uncharacterized protein" species:9031
            "Gallus gallus" [GO:0005272 "sodium channel activity" evidence=IEA]
            [GO:0005509 "calcium ion binding" evidence=IEA] [GO:0005783
            "endoplasmic reticulum" evidence=IEA] [GO:0005886 "plasma membrane"
            evidence=IEA] [GO:0009986 "cell surface" evidence=IEA] [GO:0015269
            "calcium-activated potassium channel activity" evidence=IEA]
            [GO:0033040 "sour taste receptor activity" evidence=IEA]
            [GO:0042802 "identical protein binding" evidence=IEA] [GO:0051371
            "muscle alpha-actinin binding" evidence=IEA] [GO:0071468 "cellular
            response to acidity" evidence=IEA] InterPro:IPR003915
            InterPro:IPR011992 PRINTS:PR01433 GO:GO:0005783 GO:GO:0005886
            GO:GO:0009986 GO:GO:0005509 Gene3D:1.10.238.10 GO:GO:0005272
            GO:GO:0071468 GO:GO:0015269 InterPro:IPR013122 Pfam:PF08016
            GO:GO:0001581 OMA:GFHIFRT GO:GO:0033040
            GeneTree:ENSGT00700000104221 EMBL:AADN02027786 IPI:IPI00576836
            Ensembl:ENSGALT00000009261 Uniprot:F1N8N3
        Length = 710

 Score = 121 (47.7 bits), Expect = 1.8e-06, P = 1.8e-06
 Identities = 26/60 (43%), Positives = 37/60 (61%)

Query:    10 YNGGGYVKDLGSSESNMAQGLSQMIIHK-WLDERTRVILIECSLYNPNINAIIAVSLMIE 68
             Y+GGGY  DL  +    A+ L Q++  K WLD  TRV+ I+ S+YN NIN    + L++E
Sbjct:   189 YSGGGYYIDLKLTREESAEAL-QILKEKLWLDRGTRVVFIDFSVYNANINLFCVLRLVVE 247


>UNIPROTKB|F1PCC0 [details] [associations]
            symbol:PKD1L2 "Uncharacterized protein" species:9615 "Canis
            lupus familiaris" [GO:0016021 "integral to membrane" evidence=IEA]
            [GO:0030246 "carbohydrate binding" evidence=IEA] [GO:0007218
            "neuropeptide signaling pathway" evidence=IEA] [GO:0005509 "calcium
            ion binding" evidence=IEA] InterPro:IPR000203 InterPro:IPR000922
            InterPro:IPR001024 InterPro:IPR001304 InterPro:IPR003915
            Pfam:PF00059 Pfam:PF01477 Pfam:PF01825 Pfam:PF02140 PRINTS:PR01433
            PROSITE:PS50041 PROSITE:PS50095 PROSITE:PS50221 PROSITE:PS50228
            SMART:SM00034 SMART:SM00303 SMART:SM00308 GO:GO:0016021
            GO:GO:0030246 GO:GO:0007218 Gene3D:3.10.100.10 InterPro:IPR016186
            InterPro:IPR016187 SUPFAM:SSF56436 GO:GO:0005509 Gene3D:2.60.60.20
            InterPro:IPR008976 SUPFAM:SSF49723 InterPro:IPR002859 Pfam:PF02010
            InterPro:IPR013122 Pfam:PF08016 InterPro:IPR014010 PROSITE:PS51111
            GeneTree:ENSGT00700000104402 OMA:VQIFRNT EMBL:AAEX03004042
            Ensembl:ENSCAFT00000031848 Uniprot:F1PCC0
        Length = 2452

 Score = 126 (49.4 bits), Expect = 2.2e-06, P = 2.2e-06
 Identities = 22/63 (34%), Positives = 37/63 (58%)

Query:     6 KNIIYNGGGYVKDLGSSESNMAQGLSQMIIHKWLDERTRVILIECSLYNPNINAIIAVSL 65
             K  +Y GGGYV  LG+   + ++ L  +  + WLD  TR + +E ++YN N+N    ++L
Sbjct:  2106 KLTVYRGGGYVVPLGTDRKSTSRILQYLFDNTWLDSLTRAVFVEFTVYNANVNLFCIITL 2165

Query:    66 MIE 68
              +E
Sbjct:  2166 TLE 2168


>UNIPROTKB|F1N5R3 [details] [associations]
            symbol:PKD2L1 "Uncharacterized protein" species:9913 "Bos
            taurus" [GO:0071468 "cellular response to acidity" evidence=IEA]
            [GO:0051371 "muscle alpha-actinin binding" evidence=IEA]
            [GO:0042802 "identical protein binding" evidence=IEA] [GO:0033040
            "sour taste receptor activity" evidence=IEA] [GO:0015269
            "calcium-activated potassium channel activity" evidence=IEA]
            [GO:0009986 "cell surface" evidence=IEA] [GO:0005886 "plasma
            membrane" evidence=IEA] [GO:0005783 "endoplasmic reticulum"
            evidence=IEA] [GO:0005509 "calcium ion binding" evidence=IEA]
            [GO:0005272 "sodium channel activity" evidence=IEA]
            InterPro:IPR002048 InterPro:IPR003915 InterPro:IPR011992
            PRINTS:PR01433 PROSITE:PS50222 GO:GO:0005783 GO:GO:0005886
            GO:GO:0009986 GO:GO:0005509 Gene3D:1.10.238.10 GO:GO:0005272
            GO:GO:0071468 GO:GO:0015269 InterPro:IPR013122 Pfam:PF08016
            OMA:GFHIFRT GO:GO:0033040 GeneTree:ENSGT00700000104221
            EMBL:DAAA02058966 IPI:IPI00693562 Ensembl:ENSBTAT00000014222
            Uniprot:F1N5R3
        Length = 773

 Score = 119 (46.9 bits), Expect = 3.3e-06, P = 3.3e-06
 Identities = 24/59 (40%), Positives = 33/59 (55%)

Query:    10 YNGGGYVKDLGSSESNMAQGLSQMIIHKWLDERTRVILIECSLYNPNINAIIAVSLMIE 68
             Y+GGGY  DL  S     + L  +    WLD  TRV+ I+ S+YN NIN    + L++E
Sbjct:   265 YSGGGYYLDLPGSRRACEEALKDLKEGLWLDRGTRVVFIDFSVYNANINLFCVLRLVVE 323


>UNIPROTKB|F1S8V0 [details] [associations]
            symbol:PKD2L1 "Uncharacterized protein" species:9823 "Sus
            scrofa" [GO:0071468 "cellular response to acidity" evidence=IEA]
            [GO:0051371 "muscle alpha-actinin binding" evidence=IEA]
            [GO:0042802 "identical protein binding" evidence=IEA] [GO:0033040
            "sour taste receptor activity" evidence=IEA] [GO:0015269
            "calcium-activated potassium channel activity" evidence=IEA]
            [GO:0009986 "cell surface" evidence=IEA] [GO:0005886 "plasma
            membrane" evidence=IEA] [GO:0005783 "endoplasmic reticulum"
            evidence=IEA] [GO:0005509 "calcium ion binding" evidence=IEA]
            [GO:0005272 "sodium channel activity" evidence=IEA]
            InterPro:IPR003915 InterPro:IPR011992 PRINTS:PR01433 GO:GO:0005783
            GO:GO:0005886 GO:GO:0009986 GO:GO:0005509 Gene3D:1.10.238.10
            GO:GO:0005272 GO:GO:0071468 GO:GO:0015269 InterPro:IPR013122
            Pfam:PF08016 OMA:GFHIFRT GO:GO:0033040 GeneTree:ENSGT00700000104221
            EMBL:CT827831 Ensembl:ENSSSCT00000011544 Uniprot:F1S8V0
        Length = 805

 Score = 119 (46.9 bits), Expect = 3.5e-06, P = 3.5e-06
 Identities = 23/59 (38%), Positives = 33/59 (55%)

Query:    10 YNGGGYVKDLGSSESNMAQGLSQMIIHKWLDERTRVILIECSLYNPNINAIIAVSLMIE 68
             Y+GGGY  D   S    A+ L  +    WLD  TRV+ ++ S+YN NIN    + L++E
Sbjct:   265 YSGGGYYLDFPGSRQASAEALRDLQEGLWLDRGTRVVFVDFSVYNANINLFCVLRLVVE 323


>UNIPROTKB|Q7Z442 [details] [associations]
            symbol:PKD1L2 "Polycystic kidney disease protein 1-like 2"
            species:9606 "Homo sapiens" [GO:0005509 "calcium ion binding"
            evidence=IEA] [GO:0007218 "neuropeptide signaling pathway"
            evidence=IEA] [GO:0030246 "carbohydrate binding" evidence=IEA]
            [GO:0006811 "ion transport" evidence=IEA] [GO:0016021 "integral to
            membrane" evidence=IEA] InterPro:IPR000203 InterPro:IPR000922
            InterPro:IPR001024 InterPro:IPR001304 InterPro:IPR003915
            Pfam:PF00059 Pfam:PF01477 Pfam:PF01825 Pfam:PF02140 PRINTS:PR01433
            PROSITE:PS50041 PROSITE:PS50095 PROSITE:PS50221 PROSITE:PS50228
            SMART:SM00034 SMART:SM00303 SMART:SM00308 EMBL:AY371495
            GO:GO:0016021 GO:GO:0030246 GO:GO:0007218 Gene3D:3.10.100.10
            InterPro:IPR016186 InterPro:IPR016187 SUPFAM:SSF56436
            PROSITE:PS00615 GO:GO:0005509 eggNOG:NOG12793 GO:GO:0005216
            EMBL:AC092718 Gene3D:2.60.60.20 InterPro:IPR008976 SUPFAM:SSF49723
            InterPro:IPR002859 Pfam:PF02010 InterPro:IPR013122 Pfam:PF08016
            InterPro:IPR014010 PROSITE:PS51111 EMBL:AY164483 EMBL:AB067466
            EMBL:AK098052 EMBL:AK127266 EMBL:AK131378 EMBL:AC131888
            EMBL:BC004562 EMBL:BC014157 IPI:IPI00060442 IPI:IPI00373872
            IPI:IPI00884899 IPI:IPI00884918 IPI:IPI00885146 IPI:IPI00885202
            IPI:IPI00983380 RefSeq:NP_001070248.1 RefSeq:NP_443124.3
            UniGene:Hs.413525 HSSP:Q9DEF9 STRING:Q7Z442 MEROPS:T06.003
            PhosphoSite:Q7Z442 DMDM:215274222 PaxDb:Q7Z442 PRIDE:Q7Z442
            DNASU:114780 Ensembl:ENST00000337114 Ensembl:ENST00000527937
            Ensembl:ENST00000531391 GeneID:114780 KEGG:hsa:114780
            UCSC:uc002fgf.1 UCSC:uc002fgh.1 UCSC:uc002fgi.3 UCSC:uc002fgj.3
            UCSC:uc002fgk.1 CTD:114780 GeneCards:GC16M081135 H-InvDB:HIX0013271
            HGNC:HGNC:21715 MIM:607894 neXtProt:NX_Q7Z442 PharmGKB:PA134874396
            HOVERGEN:HBG108252 KO:K04988 OrthoDB:EOG44TP6Z GenomeRNAi:114780
            NextBio:79149 ArrayExpress:Q7Z442 Bgee:Q7Z442 CleanEx:HS_PKD1L2
            Genevestigator:Q7Z442 Uniprot:Q7Z442
        Length = 2459

 Score = 124 (48.7 bits), Expect = 3.7e-06, P = 3.7e-06
 Identities = 24/72 (33%), Positives = 37/72 (51%)

Query:     6 KNIIYNGGGYVKDLGSSESNMAQGLSQMIIHKWLDERTRVILIECSLYNPNINAIIAVSL 65
             K  +Y GGGYV  LG+      + L  +  + WLD  TR + +E ++YN N+N    V+L
Sbjct:  2095 KLTVYRGGGYVVPLGTDRQKHVKILRYLFDNTWLDALTRAVFVESTVYNANVNLFCIVTL 2154

Query:    66 MIERLGSHNYLT 77
              +E      + T
Sbjct:  2155 TLETSALGTFFT 2166


>RGD|2324490 [details] [associations]
            symbol:Pkd1l3 "polycystic kidney disease 1-like 3" species:10116
            "Rattus norvegicus" [GO:0001581 "detection of chemical stimulus
            involved in sensory perception of sour taste" evidence=ISO]
            [GO:0005509 "calcium ion binding" evidence=IEA] [GO:0006812 "cation
            transport" evidence=ISO] [GO:0007218 "neuropeptide signaling
            pathway" evidence=IEA] [GO:0016021 "integral to membrane"
            evidence=IEA] [GO:0030246 "carbohydrate binding" evidence=IEA]
            [GO:0071468 "cellular response to acidity" evidence=ISO]
            [GO:0009986 "cell surface" evidence=ISO] [GO:0005261 "cation
            channel activity" evidence=ISO] [GO:0008324 "cation transmembrane
            transporter activity" evidence=ISO] [GO:0033040 "sour taste
            receptor activity" evidence=ISO] InterPro:IPR000203
            InterPro:IPR001024 InterPro:IPR001304 InterPro:IPR003915
            Pfam:PF00059 Pfam:PF01477 Pfam:PF01825 PRINTS:PR01433
            PROSITE:PS50095 PROSITE:PS50221 SMART:SM00034 SMART:SM00303
            SMART:SM00308 RGD:2324490 GO:GO:0016021 GO:GO:0009986 GO:GO:0030246
            GO:GO:0007218 Gene3D:3.10.100.10 InterPro:IPR016186
            InterPro:IPR016187 SUPFAM:SSF56436 GO:GO:0005509 GO:GO:0005261
            GO:GO:0071468 Gene3D:2.60.60.20 InterPro:IPR008976 SUPFAM:SSF49723
            InterPro:IPR013122 Pfam:PF08016 OrthoDB:EOG4S1T68
            GeneTree:ENSGT00700000104402 GO:GO:0033040 IPI:IPI00360539
            ProteinModelPortal:D4A3N8 Ensembl:ENSRNOT00000041395
            UCSC:RGD:2324490 Uniprot:D4A3N8
        Length = 2132

 Score = 123 (48.4 bits), Expect = 4.0e-06, P = 4.0e-06
 Identities = 23/68 (33%), Positives = 39/68 (57%)

Query:    10 YNGGGYVKDLGSSESNMAQGLSQMIIHKWLDERTRVILIECSLYNPNINAIIAVSLMIER 69
             Y+GGGYV  LG + S   + L  +    WLD  T+ + +E +++N N+N +  V+L++E 
Sbjct:  1790 YSGGGYVVRLGRNHSAATRVLQHLEQRHWLDHYTKALFVEFTVFNANVNLLCMVTLILES 1849

Query:    70 LGSHNYLT 77
              G   + T
Sbjct:  1850 SGVGTFFT 1857


>UNIPROTKB|E1BC86 [details] [associations]
            symbol:LOC504986 "Uncharacterized protein" species:9913
            "Bos taurus" [GO:0060674 "placenta blood vessel development"
            evidence=IEA] [GO:0050982 "detection of mechanical stimulus"
            evidence=IEA] [GO:0042994 "cytoplasmic sequestering of
            transcription factor" evidence=IEA] [GO:0032092 "positive
            regulation of protein binding" evidence=IEA] [GO:0031512 "motile
            primary cilium" evidence=IEA] [GO:0018105 "peptidyl-serine
            phosphorylation" evidence=IEA] [GO:0007507 "heart development"
            evidence=IEA] [GO:0007259 "JAK-STAT cascade" evidence=IEA]
            [GO:0007050 "cell cycle arrest" evidence=IEA] [GO:0006816 "calcium
            ion transport" evidence=IEA] [GO:0006611 "protein export from
            nucleus" evidence=IEA] [GO:0005886 "plasma membrane" evidence=IEA]
            [GO:0005737 "cytoplasm" evidence=IEA] [GO:0005634 "nucleus"
            evidence=IEA] [GO:0005261 "cation channel activity" evidence=IEA]
            [GO:0002133 "polycystin complex" evidence=IEA] [GO:0001892
            "embryonic placenta development" evidence=IEA] [GO:0001822 "kidney
            development" evidence=IEA] [GO:0001502 "cartilage condensation"
            evidence=IEA] [GO:0016021 "integral to membrane" evidence=IEA]
            [GO:0030246 "carbohydrate binding" evidence=IEA] [GO:0007218
            "neuropeptide signaling pathway" evidence=IEA] InterPro:IPR001611
            InterPro:IPR000203 InterPro:IPR000434 InterPro:IPR001024
            InterPro:IPR001304 Pfam:PF00059 Pfam:PF01477 Pfam:PF01825
            PRINTS:PR00500 PROSITE:PS50041 PROSITE:PS50095 PROSITE:PS50221
            PROSITE:PS51450 SMART:SM00034 SMART:SM00303 SMART:SM00308
            InterPro:IPR002889 GO:GO:0016021 GO:GO:0005886 GO:GO:0005634
            GO:GO:0005737 GO:GO:0007507 GO:GO:0032092 GO:GO:0030246
            GO:GO:0007218 Gene3D:3.10.100.10 InterPro:IPR016186
            InterPro:IPR016187 SUPFAM:SSF56436 InterPro:IPR000483
            InterPro:IPR003591 SMART:SM00369 SMART:SM00082 GO:GO:0007050
            GO:GO:0018105 GO:GO:0005261 GO:GO:0001822 GO:GO:0006816
            InterPro:IPR000372 SMART:SM00013 GO:GO:0001502 GO:GO:0006611
            GO:GO:0001892 GO:GO:0042994 GO:GO:0007259 GO:GO:0060674
            GO:GO:0031512 Gene3D:2.60.60.20 InterPro:IPR008976 SUPFAM:SSF49723
            Gene3D:2.60.40.670 InterPro:IPR022409 InterPro:IPR000601
            Pfam:PF00801 SMART:SM00089 SUPFAM:SSF49299 PROSITE:PS50093
            InterPro:IPR002859 Pfam:PF02010 Pfam:PF01822 PROSITE:PS51212
            InterPro:IPR013122 Pfam:PF08016 GO:GO:0050982 InterPro:IPR014010
            PROSITE:PS51111 GeneTree:ENSGT00700000104402 OMA:GQCNTDL
            GO:GO:0002133 InterPro:IPR006228 TIGRFAMs:TIGR00864
            EMBL:DAAA02057309 EMBL:DAAA02057310 IPI:IPI00688388
            Ensembl:ENSBTAT00000027480 Uniprot:E1BC86
        Length = 4301

 Score = 125 (49.1 bits), Expect = 5.2e-06, P = 5.2e-06
 Identities = 24/61 (39%), Positives = 40/61 (65%)

Query:     9 IYNGGGYVKDLGSS-ESNMAQGLSQMIIHKWLDERTRVILIECSLYNPNINAIIAVSLMI 67
             +Y+ GGYV++LG S E + AQ L  + +H W+D R+R + +E + Y+P +    AV+L +
Sbjct:  3812 VYDSGGYVQELGPSLEESRAQ-LGFLQLHNWIDNRSRAVFVELTRYSPAVGLHAAVTLRL 3870

Query:    68 E 68
             E
Sbjct:  3871 E 3871


>UNIPROTKB|F1RFB1 [details] [associations]
            symbol:PKD1 "Uncharacterized protein" species:9823 "Sus
            scrofa" [GO:0060674 "placenta blood vessel development"
            evidence=IEA] [GO:0050982 "detection of mechanical stimulus"
            evidence=IEA] [GO:0042994 "cytoplasmic sequestering of
            transcription factor" evidence=IEA] [GO:0032092 "positive
            regulation of protein binding" evidence=IEA] [GO:0031512 "motile
            primary cilium" evidence=IEA] [GO:0018105 "peptidyl-serine
            phosphorylation" evidence=IEA] [GO:0007507 "heart development"
            evidence=IEA] [GO:0007259 "JAK-STAT cascade" evidence=IEA]
            [GO:0007050 "cell cycle arrest" evidence=IEA] [GO:0006816 "calcium
            ion transport" evidence=IEA] [GO:0006611 "protein export from
            nucleus" evidence=IEA] [GO:0005886 "plasma membrane" evidence=IEA]
            [GO:0005737 "cytoplasm" evidence=IEA] [GO:0005634 "nucleus"
            evidence=IEA] [GO:0005261 "cation channel activity" evidence=IEA]
            [GO:0002133 "polycystin complex" evidence=IEA] [GO:0001892
            "embryonic placenta development" evidence=IEA] [GO:0001822 "kidney
            development" evidence=IEA] [GO:0001502 "cartilage condensation"
            evidence=IEA] [GO:0016021 "integral to membrane" evidence=IEA]
            [GO:0030246 "carbohydrate binding" evidence=IEA] [GO:0007218
            "neuropeptide signaling pathway" evidence=IEA] InterPro:IPR001611
            InterPro:IPR000203 InterPro:IPR000434 InterPro:IPR001024
            InterPro:IPR001304 Pfam:PF00059 Pfam:PF01477 Pfam:PF01825
            PRINTS:PR00500 PROSITE:PS50041 PROSITE:PS50095 PROSITE:PS50221
            PROSITE:PS51450 SMART:SM00034 SMART:SM00303 SMART:SM00308
            InterPro:IPR002889 GO:GO:0016021 GO:GO:0005886 GO:GO:0005634
            GO:GO:0005737 GO:GO:0007507 GO:GO:0032092 GO:GO:0030246
            GO:GO:0007218 Gene3D:3.10.100.10 InterPro:IPR016186
            InterPro:IPR016187 SUPFAM:SSF56436 InterPro:IPR000483
            InterPro:IPR003591 SMART:SM00369 SMART:SM00082 GO:GO:0007050
            GO:GO:0018105 GO:GO:0005261 GO:GO:0001822 GO:GO:0006816
            InterPro:IPR000372 SMART:SM00013 GO:GO:0001502 GO:GO:0006611
            GO:GO:0001892 GO:GO:0042994 GO:GO:0007259 GO:GO:0060674
            GO:GO:0031512 Gene3D:2.60.60.20 InterPro:IPR008976 SUPFAM:SSF49723
            Gene3D:2.60.40.670 InterPro:IPR022409 InterPro:IPR000601
            Pfam:PF00801 SMART:SM00089 SUPFAM:SSF49299 PROSITE:PS50093
            InterPro:IPR002859 Pfam:PF02010 Pfam:PF01822 PROSITE:PS51212
            InterPro:IPR013122 Pfam:PF08016 GO:GO:0050982 InterPro:IPR014010
            PROSITE:PS51111 GeneTree:ENSGT00700000104402 OMA:GQCNTDL
            GO:GO:0002133 InterPro:IPR006228 TIGRFAMs:TIGR00864 EMBL:FP102350
            Ensembl:ENSSSCT00000008812 Uniprot:F1RFB1
        Length = 4316

 Score = 125 (49.1 bits), Expect = 5.2e-06, P = 5.2e-06
 Identities = 24/61 (39%), Positives = 40/61 (65%)

Query:     9 IYNGGGYVKDLGSS-ESNMAQGLSQMIIHKWLDERTRVILIECSLYNPNINAIIAVSLMI 67
             +Y+ GGYV++LG S E + AQ L  + +H W+D R+R + +E + Y+P +    AV+L +
Sbjct:  3822 VYDSGGYVQELGPSLEESRAQ-LGFLQLHNWIDNRSRAVFVELTRYSPAVGLHAAVTLRL 3880

Query:    68 E 68
             E
Sbjct:  3881 E 3881


>WB|WBGene00004035 [details] [associations]
            symbol:pkd-2 species:6239 "Caenorhabditis elegans"
            [GO:0005509 "calcium ion binding" evidence=IEA] [GO:0016020
            "membrane" evidence=IEA] [GO:0005216 "ion channel activity"
            evidence=IEA] [GO:0006811 "ion transport" evidence=IEA] [GO:0055085
            "transmembrane transport" evidence=IEA] [GO:0016021 "integral to
            membrane" evidence=IEA] [GO:0007617 "mating behavior"
            evidence=IGI;IMP] [GO:0031513 "nonmotile primary cilium"
            evidence=IDA] [GO:0043025 "neuronal cell body" evidence=IDA]
            [GO:0005886 "plasma membrane" evidence=IDA] [GO:0031090 "organelle
            membrane" evidence=IDA] [GO:0030425 "dendrite" evidence=IDA]
            [GO:0030424 "axon" evidence=IDA] InterPro:IPR003915 PRINTS:PR01433
            GO:GO:0005783 GO:GO:0016021 GO:GO:0005789 GO:GO:0005262
            GO:GO:0030424 GO:GO:0043025 GO:GO:0030425 GO:GO:0043204
            GO:GO:0005509 GO:GO:0060170 GO:GO:0034606 GO:GO:0031513
            GO:GO:0031090 GO:GO:0034608 InterPro:IPR013122 Pfam:PF08016
            EMBL:AL132862 eggNOG:NOG325704 HOGENOM:HOG000230858 KO:K04990
            GeneTree:ENSGT00700000104221 RefSeq:NP_502838.3
            ProteinModelPortal:Q9U1S7 SMR:Q9U1S7 IntAct:Q9U1S7
            MINT:MINT-3385171 STRING:Q9U1S7 EnsemblMetazoa:Y73F8A.1
            GeneID:178424 KEGG:cel:CELE_Y73F8A.1 UCSC:Y73F8A.1 CTD:178424
            WormBase:Y73F8A.1 InParanoid:Q9U1S7 OMA:TRQTEDT NextBio:901088
            Uniprot:Q9U1S7
        Length = 716

 Score = 116 (45.9 bits), Expect = 6.3e-06, P = 6.3e-06
 Identities = 24/69 (34%), Positives = 40/69 (57%)

Query:    10 YNGGGYVKDLGSSESNMAQG-LSQMIIHKWLDERTRVILIECSLYNPNINAIIAVSLMIE 68
             Y GGG+V+ L  + S  AQ  ++ +  ++W+D  +R I+++ +LYN NIN    V L+ E
Sbjct:   235 YGGGGFVQRLPVAGSTEAQSAIATLKANRWIDRGSRAIIVDFALYNANINLFCVVKLLFE 294

Query:    69 RLGSHNYLT 77
                S   +T
Sbjct:   295 LPASGGVIT 303


>UNIPROTKB|Q9U1S7 [details] [associations]
            symbol:pkd-2 "Polycystin-2" species:6239 "Caenorhabditis
            elegans" [GO:0070588 "calcium ion transmembrane transport"
            evidence=IDA] [GO:0034606 "response to hermaphrodite contact"
            evidence=IMP] [GO:0060170 "cilium membrane" evidence=IDA]
            [GO:0043025 "neuronal cell body" evidence=IDA] [GO:0005929 "cilium"
            evidence=IDA] [GO:0005783 "endoplasmic reticulum" evidence=IDA]
            [GO:0034608 "vulval location" evidence=IMP] [GO:0006816 "calcium
            ion transport" evidence=IDA] [GO:0005262 "calcium channel activity"
            evidence=IDA] [GO:0060179 "male mating behavior" evidence=IDA]
            [GO:0016020 "membrane" evidence=IDA] [GO:0005886 "plasma membrane"
            evidence=IDA] InterPro:IPR003915 PRINTS:PR01433 GO:GO:0005783
            GO:GO:0016021 GO:GO:0005789 GO:GO:0005262 GO:GO:0030424
            GO:GO:0043025 GO:GO:0030425 GO:GO:0043204 GO:GO:0005509
            GO:GO:0060170 GO:GO:0034606 GO:GO:0031513 GO:GO:0031090
            GO:GO:0034608 InterPro:IPR013122 Pfam:PF08016 EMBL:AL132862
            eggNOG:NOG325704 HOGENOM:HOG000230858 KO:K04990
            GeneTree:ENSGT00700000104221 RefSeq:NP_502838.3
            ProteinModelPortal:Q9U1S7 SMR:Q9U1S7 IntAct:Q9U1S7
            MINT:MINT-3385171 STRING:Q9U1S7 EnsemblMetazoa:Y73F8A.1
            GeneID:178424 KEGG:cel:CELE_Y73F8A.1 UCSC:Y73F8A.1 CTD:178424
            WormBase:Y73F8A.1 InParanoid:Q9U1S7 OMA:TRQTEDT NextBio:901088
            Uniprot:Q9U1S7
        Length = 716

 Score = 116 (45.9 bits), Expect = 6.3e-06, P = 6.3e-06
 Identities = 24/69 (34%), Positives = 40/69 (57%)

Query:    10 YNGGGYVKDLGSSESNMAQG-LSQMIIHKWLDERTRVILIECSLYNPNINAIIAVSLMIE 68
             Y GGG+V+ L  + S  AQ  ++ +  ++W+D  +R I+++ +LYN NIN    V L+ E
Sbjct:   235 YGGGGFVQRLPVAGSTEAQSAIATLKANRWIDRGSRAIIVDFALYNANINLFCVVKLLFE 294

Query:    69 RLGSHNYLT 77
                S   +T
Sbjct:   295 LPASGGVIT 303


>UNIPROTKB|F1Q0G0 [details] [associations]
            symbol:PKD1 "Uncharacterized protein" species:9615 "Canis
            lupus familiaris" [GO:0016021 "integral to membrane" evidence=IEA]
            [GO:0030246 "carbohydrate binding" evidence=IEA] [GO:0007218
            "neuropeptide signaling pathway" evidence=IEA] InterPro:IPR001611
            InterPro:IPR000203 InterPro:IPR000434 InterPro:IPR001024
            InterPro:IPR001304 Pfam:PF00059 Pfam:PF01477 Pfam:PF01825
            PRINTS:PR00500 PROSITE:PS50041 PROSITE:PS50095 PROSITE:PS50221
            PROSITE:PS51450 SMART:SM00034 SMART:SM00303 SMART:SM00308
            InterPro:IPR002889 GO:GO:0016021 GO:GO:0030246 GO:GO:0007218
            Gene3D:3.10.100.10 InterPro:IPR016186 InterPro:IPR016187
            SUPFAM:SSF56436 InterPro:IPR000483 InterPro:IPR003591 SMART:SM00369
            SMART:SM00082 Gene3D:2.60.60.20 InterPro:IPR008976 SUPFAM:SSF49723
            Gene3D:2.60.40.670 InterPro:IPR022409 InterPro:IPR000601
            Pfam:PF00801 SMART:SM00089 SUPFAM:SSF49299 PROSITE:PS50093
            InterPro:IPR002859 Pfam:PF02010 Pfam:PF01822 PROSITE:PS51212
            InterPro:IPR013122 Pfam:PF08016 InterPro:IPR014010 PROSITE:PS51111
            GeneTree:ENSGT00700000104402 OMA:GQCNTDL InterPro:IPR006228
            TIGRFAMs:TIGR00864 EMBL:AAEX03004628 EMBL:AAEX03004626
            EMBL:AAEX03004627 Ensembl:ENSCAFT00000030883 Uniprot:F1Q0G0
        Length = 4240

 Score = 124 (48.7 bits), Expect = 6.5e-06, P = 6.5e-06
 Identities = 24/61 (39%), Positives = 40/61 (65%)

Query:     9 IYNGGGYVKDLGSS-ESNMAQGLSQMIIHKWLDERTRVILIECSLYNPNINAIIAVSLMI 67
             +Y+ GGYV++LG S E + AQ L  + +H W+D R+R + +E + Y+P +    AV+L +
Sbjct:  3750 VYDSGGYVQELGLSLEESRAQ-LGFLQLHNWIDNRSRAVFVELTRYSPAVGLHAAVTLRL 3808

Query:    68 E 68
             E
Sbjct:  3809 E 3809


>WB|WBGene00003058 [details] [associations]
            symbol:lov-1 species:6239 "Caenorhabditis elegans"
            [GO:0007218 "neuropeptide signaling pathway" evidence=IEA]
            [GO:0016020 "membrane" evidence=IEA] [GO:0016021 "integral to
            membrane" evidence=IEA] [GO:0040010 "positive regulation of growth
            rate" evidence=IMP] [GO:0007617 "mating behavior" evidence=IGI;IMP]
            [GO:0031513 "nonmotile primary cilium" evidence=IDA] [GO:0043025
            "neuronal cell body" evidence=IDA] [GO:0019904 "protein domain
            specific binding" evidence=IPI] InterPro:IPR000203
            InterPro:IPR001024 Pfam:PF01477 PROSITE:PS50095 PROSITE:PS50221
            SMART:SM00303 SMART:SM00308 GO:GO:0016021 GO:GO:0040010
            GO:GO:0043025 GO:GO:0007218 eggNOG:NOG12793 GO:GO:0034606
            GO:GO:0031513 GO:GO:0034608 Gene3D:2.60.60.20 InterPro:IPR008976
            SUPFAM:SSF49723 EMBL:Z48582 EMBL:Z48544 InterPro:IPR013122
            Pfam:PF08016 GeneTree:ENSGT00700000104174 PIR:T28125
            RefSeq:NP_496184.3 IntAct:Q09624 STRING:Q09624
            EnsemblMetazoa:ZK945.9 GeneID:174576 KEGG:cel:CELE_ZK945.9
            CTD:174576 WormBase:ZK945.9 InParanoid:Q09624 OMA:WDWARES
            NextBio:884626 Uniprot:Q09624
        Length = 3284

 Score = 121 (47.7 bits), Expect = 1.0e-05, P = 1.0e-05
 Identities = 24/72 (33%), Positives = 41/72 (56%)

Query:    10 YNGGGYVKDLGSSESNMAQGLSQMIIHKWLDERTRVILIECSLYNPNINAIIAVSLMIER 69
             Y+GGGY   +  +++ +    +++   +W+D+ TR ++IE S YN  IN    V L++E 
Sbjct:  2853 YSGGGYTISMSGTQAEIITLFNKLDSERWIDDHTRAVIIEFSAYNAQINYFSVVQLLVEI 2912

Query:    70 LGSHNYLTDSEV 81
               S  YL +S V
Sbjct:  2913 PKSGIYLPNSWV 2924


>UNIPROTKB|Q09624 [details] [associations]
            symbol:lov-1 "Location of vulva defective 1" species:6239
            "Caenorhabditis elegans" [GO:0005515 "protein binding"
            evidence=IPI] [GO:0034606 "response to hermaphrodite contact"
            evidence=IMP] [GO:0060179 "male mating behavior" evidence=IMP]
            [GO:0005929 "cilium" evidence=IDA] [GO:0034608 "vulval location"
            evidence=IMP] InterPro:IPR000203 InterPro:IPR001024 Pfam:PF01477
            PROSITE:PS50095 PROSITE:PS50221 SMART:SM00303 SMART:SM00308
            GO:GO:0016021 GO:GO:0040010 GO:GO:0043025 GO:GO:0007218
            eggNOG:NOG12793 GO:GO:0034606 GO:GO:0031513 GO:GO:0034608
            Gene3D:2.60.60.20 InterPro:IPR008976 SUPFAM:SSF49723 EMBL:Z48582
            EMBL:Z48544 InterPro:IPR013122 Pfam:PF08016
            GeneTree:ENSGT00700000104174 PIR:T28125 RefSeq:NP_496184.3
            IntAct:Q09624 STRING:Q09624 EnsemblMetazoa:ZK945.9 GeneID:174576
            KEGG:cel:CELE_ZK945.9 CTD:174576 WormBase:ZK945.9 InParanoid:Q09624
            OMA:WDWARES NextBio:884626 Uniprot:Q09624
        Length = 3284

 Score = 121 (47.7 bits), Expect = 1.0e-05, P = 1.0e-05
 Identities = 24/72 (33%), Positives = 41/72 (56%)

Query:    10 YNGGGYVKDLGSSESNMAQGLSQMIIHKWLDERTRVILIECSLYNPNINAIIAVSLMIER 69
             Y+GGGY   +  +++ +    +++   +W+D+ TR ++IE S YN  IN    V L++E 
Sbjct:  2853 YSGGGYTISMSGTQAEIITLFNKLDSERWIDDHTRAVIIEFSAYNAQINYFSVVQLLVEI 2912

Query:    70 LGSHNYLTDSEV 81
               S  YL +S V
Sbjct:  2913 PKSGIYLPNSWV 2924


>UNIPROTKB|Q9NZM6 [details] [associations]
            symbol:PKD2L2 "Polycystic kidney disease 2-like 2 protein"
            species:9606 "Homo sapiens" [GO:0005509 "calcium ion binding"
            evidence=IEA] [GO:0006811 "ion transport" evidence=IEA] [GO:0016021
            "integral to membrane" evidence=TAS] [GO:0008150
            "biological_process" evidence=ND] InterPro:IPR003915 PRINTS:PR01433
            GO:GO:0016021 EMBL:CH471062 GO:GO:0005509 GO:GO:0005216
            EMBL:AC106753 InterPro:IPR013122 Pfam:PF08016 EMBL:AC106791
            eggNOG:NOG325704 HOGENOM:HOG000230858 HOVERGEN:HBG014945
            EMBL:AF118125 EMBL:AF182034 EMBL:AK301924 EMBL:BC044581
            IPI:IPI00021443 IPI:IPI00070729 IPI:IPI00216678 IPI:IPI00216679
            IPI:IPI00216680 IPI:IPI00384675 IPI:IPI00910627 RefSeq:NP_055201.2
            UniGene:Hs.716884 ProteinModelPortal:Q9NZM6 PhosphoSite:Q9NZM6
            DMDM:23821937 PaxDb:Q9NZM6 PRIDE:Q9NZM6 Ensembl:ENST00000290431
            Ensembl:ENST00000350250 Ensembl:ENST00000414094
            Ensembl:ENST00000502810 Ensembl:ENST00000508638
            Ensembl:ENST00000508883 GeneID:27039 KEGG:hsa:27039 UCSC:uc003lbw.1
            UCSC:uc003lby.3 CTD:27039 GeneCards:GC05P137225 H-InvDB:HIX0024797
            HGNC:HGNC:9012 MIM:604669 neXtProt:NX_Q9NZM6 PharmGKB:PA33345
            InParanoid:Q9NZM6 KO:K04991 OMA:KFMEGPL PhylomeDB:Q9NZM6
            GenomeRNAi:27039 NextBio:49604 ArrayExpress:Q9NZM6 Bgee:Q9NZM6
            CleanEx:HS_PKD2L2 Genevestigator:Q9NZM6 GermOnline:ENSG00000078795
            Uniprot:Q9NZM6
        Length = 624

 Score = 113 (44.8 bits), Expect = 1.1e-05, P = 1.1e-05
 Identities = 23/69 (33%), Positives = 35/69 (50%)

Query:     9 IYNGGGYVKDLGSSESNMAQGLSQMIIHKWLDERTRVILIECSLYNPNINAIIAVSLMIE 68
             +Y  GGY+  L  S+S        + ++ W+   TRVI I+ SLYN N+N    + L+ E
Sbjct:   194 VYRNGGYIFTLSKSKSETKNKFIDLRLNSWITRGTRVIFIDFSLYNANVNLFCIIRLVAE 253

Query:    69 RLGSHNYLT 77
                +   LT
Sbjct:   254 FPATGGILT 262


>RGD|3333 [details] [associations]
            symbol:Pkd1 "polycystic kidney disease 1 homolog (human)"
          species:10116 "Rattus norvegicus" [GO:0001502 "cartilage
          condensation" evidence=ISO] [GO:0001568 "blood vessel development"
          evidence=ISO] [GO:0001701 "in utero embryonic development"
          evidence=ISO] [GO:0001822 "kidney development" evidence=ISO]
          [GO:0001889 "liver development" evidence=ISO] [GO:0001892 "embryonic
          placenta development" evidence=ISO] [GO:0002133 "polycystin complex"
          evidence=ISO] [GO:0005261 "cation channel activity" evidence=ISO]
          [GO:0005634 "nucleus" evidence=ISO] [GO:0005737 "cytoplasm"
          evidence=ISO] [GO:0005794 "Golgi apparatus" evidence=IDA] [GO:0005886
          "plasma membrane" evidence=ISO] [GO:0005929 "cilium" evidence=ISO]
          [GO:0006611 "protein export from nucleus" evidence=ISO] [GO:0006807
          "nitrogen compound metabolic process" evidence=ISO] [GO:0006812
          "cation transport" evidence=ISO] [GO:0006816 "calcium ion transport"
          evidence=ISO] [GO:0007050 "cell cycle arrest" evidence=ISO]
          [GO:0007204 "elevation of cytosolic calcium ion concentration"
          evidence=IMP] [GO:0007259 "JAK-STAT cascade" evidence=ISO]
          [GO:0007507 "heart development" evidence=ISO] [GO:0016020 "membrane"
          evidence=IDA] [GO:0016323 "basolateral plasma membrane" evidence=ISO]
          [GO:0016328 "lateral plasma membrane" evidence=IDA] [GO:0016337
          "cell-cell adhesion" evidence=ISO] [GO:0018105 "peptidyl-serine
          phosphorylation" evidence=ISO] [GO:0019901 "protein kinase binding"
          evidence=ISO] [GO:0019904 "protein domain specific binding"
          evidence=ISO] [GO:0021510 "spinal cord development" evidence=ISO]
          [GO:0021915 "neural tube development" evidence=ISO] [GO:0031512
          "motile primary cilium" evidence=ISO] [GO:0031659 "positive
          regulation of cyclin-dependent protein serine/threonine kinase
          activity involved in G1/S" evidence=ISO] [GO:0032092 "positive
          regulation of protein binding" evidence=ISO] [GO:0034220 "ion
          transmembrane transport" evidence=ISO] [GO:0042994 "cytoplasmic
          sequestering of transcription factor" evidence=ISO] [GO:0043588 "skin
          development" evidence=ISO] [GO:0044325 "ion channel binding"
          evidence=ISO] [GO:0045944 "positive regulation of transcription from
          RNA polymerase II promoter" evidence=ISO] [GO:0048565 "digestive
          tract development" evidence=ISO] [GO:0048754 "branching morphogenesis
          of an epithelial tube" evidence=ISO] [GO:0048806 "genitalia
          development" evidence=ISO] [GO:0050982 "detection of mechanical
          stimulus" evidence=ISO] [GO:0051216 "cartilage development"
          evidence=ISO] [GO:0060236 "regulation of mitotic spindle
          organization" evidence=ISO] [GO:0060428 "lung epithelium development"
          evidence=ISO] [GO:0060674 "placenta blood vessel development"
          evidence=ISO] [GO:0072001 "renal system development" evidence=ISO]
          [GO:0072164 "mesonephric tubule development" evidence=ISO]
          [GO:0072177 "mesonephric duct development" evidence=ISO] [GO:0072205
          "metanephric collecting duct development" evidence=ISO] [GO:0072218
          "metanephric ascending thin limb development" evidence=ISO]
          [GO:0072237 "metanephric proximal tubule development" evidence=ISO]
          [GO:0072287 "metanephric distal tubule morphogenesis" evidence=ISO]
          InterPro:IPR001611 InterPro:IPR000203 InterPro:IPR000434
          InterPro:IPR001024 InterPro:IPR001304 Pfam:PF00059 Pfam:PF01477
          Pfam:PF01825 PRINTS:PR00500 PROSITE:PS50041 PROSITE:PS50095
          PROSITE:PS50221 PROSITE:PS51450 SMART:SM00034 SMART:SM00303
          SMART:SM00308 InterPro:IPR002889 RGD:3333 GO:GO:0016021 GO:GO:0005794
          GO:GO:0030246 GO:GO:0007218 Gene3D:3.10.100.10 InterPro:IPR016186
          InterPro:IPR016187 SUPFAM:SSF56436 InterPro:IPR000483
          InterPro:IPR003591 SMART:SM00369 SMART:SM00082 GO:GO:0007204
          GO:GO:0016328 InterPro:IPR000372 SMART:SM00013 Gene3D:2.60.60.20
          InterPro:IPR008976 SUPFAM:SSF49723 Gene3D:2.60.40.670
          InterPro:IPR022409 InterPro:IPR000601 Pfam:PF00801 SMART:SM00089
          SUPFAM:SSF49299 PROSITE:PS50093 InterPro:IPR002859 Pfam:PF02010
          eggNOG:COG3291 Pfam:PF01822 PROSITE:PS51212 InterPro:IPR013122
          Pfam:PF08016 InterPro:IPR014010 PROSITE:PS51111 MEROPS:T06.001
          HOGENOM:HOG000168445 HOVERGEN:HBG049412 OrthoDB:EOG4Z8XVH
          InterPro:IPR006228 InterPro:IPR013994 SMART:SM00321
          TIGRFAMs:TIGR00864 HSSP:P98161 IPI:IPI00191485 EMBL:AF277452
          UniGene:Rn.127770 ProteinModelPortal:Q9ERV0 IntAct:Q9ERV0
          STRING:Q9ERV0 PhosphoSite:Q9ERV0 UCSC:RGD:3333 InParanoid:Q9ERV0
          ChEMBL:CHEMBL1687686 Genevestigator:Q9ERV0 Uniprot:Q9ERV0
        Length = 4283

 Score = 121 (47.7 bits), Expect = 1.4e-05, P = 1.4e-05
 Identities = 21/60 (35%), Positives = 36/60 (60%)

Query:     9 IYNGGGYVKDLGSSESNMAQGLSQMIIHKWLDERTRVILIECSLYNPNINAIIAVSLMIE 68
             +Y+ GGY+++LG S       L  + +H WLD R+R + +E + Y+P +    AV+L +E
Sbjct:  3793 VYDSGGYIQELGLSLEESRARLGFLQLHNWLDSRSRAVFVELTRYSPAVGLHAAVTLRLE 3852


>MGI|MGI:97603 [details] [associations]
            symbol:Pkd1 "polycystic kidney disease 1 homolog"
            species:10090 "Mus musculus" [GO:0001502 "cartilage condensation"
            evidence=IMP] [GO:0001568 "blood vessel development" evidence=IMP]
            [GO:0001701 "in utero embryonic development" evidence=IGI;IMP]
            [GO:0001822 "kidney development" evidence=IGI;IMP] [GO:0001889
            "liver development" evidence=IGI] [GO:0001892 "embryonic placenta
            development" evidence=IMP] [GO:0002133 "polycystin complex"
            evidence=IDA] [GO:0005261 "cation channel activity" evidence=IPI]
            [GO:0005262 "calcium channel activity" evidence=TAS] [GO:0005515
            "protein binding" evidence=IPI] [GO:0005634 "nucleus" evidence=IDA]
            [GO:0005737 "cytoplasm" evidence=IMP] [GO:0005794 "Golgi apparatus"
            evidence=ISO] [GO:0005886 "plasma membrane" evidence=IPI]
            [GO:0005929 "cilium" evidence=IDA] [GO:0006611 "protein export from
            nucleus" evidence=IMP] [GO:0006807 "nitrogen compound metabolic
            process" evidence=IGI] [GO:0006812 "cation transport" evidence=IPI]
            [GO:0006816 "calcium ion transport" evidence=IMP] [GO:0007050 "cell
            cycle arrest" evidence=IDA] [GO:0007204 "elevation of cytosolic
            calcium ion concentration" evidence=ISO] [GO:0007218 "neuropeptide
            signaling pathway" evidence=IEA] [GO:0007259 "JAK-STAT cascade"
            evidence=IDA] [GO:0007507 "heart development" evidence=IMP]
            [GO:0016020 "membrane" evidence=ISO] [GO:0016021 "integral to
            membrane" evidence=IEA] [GO:0016323 "basolateral plasma membrane"
            evidence=ISO] [GO:0016328 "lateral plasma membrane" evidence=ISO]
            [GO:0016337 "cell-cell adhesion" evidence=IMP] [GO:0018105
            "peptidyl-serine phosphorylation" evidence=IMP] [GO:0019901
            "protein kinase binding" evidence=ISO] [GO:0019904 "protein domain
            specific binding" evidence=ISO] [GO:0030246 "carbohydrate binding"
            evidence=IEA] [GO:0031512 "motile primary cilium" evidence=IDA]
            [GO:0031659 "positive regulation of cyclin-dependent protein
            serine/threonine kinase activity involved in G1/S" evidence=ISO]
            [GO:0032092 "positive regulation of protein binding" evidence=IMP]
            [GO:0034220 "ion transmembrane transport" evidence=IPI] [GO:0042994
            "cytoplasmic sequestering of transcription factor" evidence=IMP]
            [GO:0042995 "cell projection" evidence=IEA] [GO:0044325 "ion
            channel binding" evidence=ISO] [GO:0045944 "positive regulation of
            transcription from RNA polymerase II promoter" evidence=ISO]
            [GO:0048754 "branching morphogenesis of an epithelial tube"
            evidence=ISO] [GO:0050982 "detection of mechanical stimulus"
            evidence=IDA;IMP] [GO:0060236 "regulation of mitotic spindle
            organization" evidence=IMP] [GO:0060674 "placenta blood vessel
            development" evidence=IMP] [GO:0070588 "calcium ion transmembrane
            transport" evidence=TAS] [GO:0072001 "renal system development"
            evidence=IGI] InterPro:IPR001611 InterPro:IPR000203
            InterPro:IPR000434 InterPro:IPR001024 InterPro:IPR001304
            Pfam:PF00059 Pfam:PF01477 Pfam:PF01825 PRINTS:PR00500
            PROSITE:PS50041 PROSITE:PS50068 PROSITE:PS50095 PROSITE:PS50221
            PROSITE:PS51450 SMART:SM00034 SMART:SM00303 SMART:SM00308
            MGI:MGI:97603 InterPro:IPR002889 GO:GO:0016021 GO:GO:0005886
            GO:GO:0005634 GO:GO:0005737 GO:GO:0043588 GO:GO:0007507
            GO:GO:0032092 GO:GO:0005262 GO:GO:0030246 GO:GO:0007218
            Gene3D:3.10.100.10 InterPro:IPR016186 InterPro:IPR016187
            SUPFAM:SSF56436 GO:GO:0045944 InterPro:IPR000483 InterPro:IPR003591
            SMART:SM00369 SMART:SM00082 GO:GO:0016323 GO:GO:0007050
            GO:GO:0018105 GO:GO:0048806 GO:GO:0001822 GO:GO:0031659
            PROSITE:PS01209 GO:GO:0021510 GO:GO:0021915 InterPro:IPR000372
            SMART:SM00013 GO:GO:0001502 GO:GO:0048565 GO:GO:0006807
            GO:GO:0006611 GO:GO:0072205 GO:GO:0001892 GO:GO:0048754
            GO:GO:0060236 GO:GO:0042994 GO:GO:0007259 GO:GO:0060674
            GO:GO:0031512 Gene3D:2.60.60.20 InterPro:IPR008976 SUPFAM:SSF49723
            GO:GO:0060428 Gene3D:2.60.40.670 InterPro:IPR022409
            InterPro:IPR000601 Pfam:PF00801 SMART:SM00089 SUPFAM:SSF49299
            PROSITE:PS50093 InterPro:IPR002859 Pfam:PF02010 eggNOG:COG3291
            Pfam:PF01822 PROSITE:PS51212 GO:GO:0072177 InterPro:IPR013122
            Pfam:PF08016 GO:GO:0050982 InterPro:IPR014010 PROSITE:PS51111
            GeneTree:ENSGT00700000104402 MEROPS:T06.001 CTD:5310
            HOGENOM:HOG000168445 HOVERGEN:HBG049412 KO:K04985 OMA:GQCNTDL
            OrthoDB:EOG4Z8XVH GO:GO:0002133 GO:GO:0072218 GO:GO:0072287
            GO:GO:0072237 InterPro:IPR006228 InterPro:IPR013994 SMART:SM00321
            TIGRFAMs:TIGR00864 EMBL:U70209 EMBL:AC132367 IPI:IPI00116377
            RefSeq:NP_038658.2 UniGene:Mm.290442 UniGene:Mm.30435 HSSP:P98161
            ProteinModelPortal:O08852 SMR:O08852 MINT:MINT-5163387
            STRING:O08852 PhosphoSite:O08852 PRIDE:O08852
            Ensembl:ENSMUST00000035565 GeneID:18763 KEGG:mmu:18763
            UCSC:uc008awv.1 InParanoid:O08852 ChiTaRS:Pkd1 NextBio:294959
            Bgee:O08852 Genevestigator:O08852 Uniprot:O08852
        Length = 4293

 Score = 121 (47.7 bits), Expect = 1.4e-05, P = 1.4e-05
 Identities = 21/60 (35%), Positives = 36/60 (60%)

Query:     9 IYNGGGYVKDLGSSESNMAQGLSQMIIHKWLDERTRVILIECSLYNPNINAIIAVSLMIE 68
             +Y+ GGY+++LG S       L  + +H WLD R+R + +E + Y+P +    AV+L +E
Sbjct:  3803 VYDSGGYIQELGLSLEESRARLGFLQLHNWLDSRSRAVFVELTRYSPAVGLHAAVTLRLE 3862


>UNIPROTKB|P98161 [details] [associations]
            symbol:PKD1 "Polycystin-1" species:9606 "Homo sapiens"
            [GO:0007218 "neuropeptide signaling pathway" evidence=IEA]
            [GO:0030246 "carbohydrate binding" evidence=IEA] [GO:0072164
            "mesonephric tubule development" evidence=IEP] [GO:0072237
            "metanephric proximal tubule development" evidence=IEP] [GO:0072177
            "mesonephric duct development" evidence=IEP] [GO:0072218
            "metanephric ascending thin limb development" evidence=IEP]
            [GO:0072287 "metanephric distal tubule morphogenesis" evidence=IEP]
            [GO:0072205 "metanephric collecting duct development" evidence=IEP]
            [GO:0021915 "neural tube development" evidence=IEP] [GO:0043588
            "skin development" evidence=IEP] [GO:0060428 "lung epithelium
            development" evidence=IEP] [GO:0007507 "heart development"
            evidence=IEP] [GO:0048565 "digestive tract development"
            evidence=IEP] [GO:0048806 "genitalia development" evidence=IEP]
            [GO:0051216 "cartilage development" evidence=IEP] [GO:0021510
            "spinal cord development" evidence=IEP] [GO:0048754 "branching
            morphogenesis of an epithelial tube" evidence=IDA] [GO:0005515
            "protein binding" evidence=IPI] [GO:0019901 "protein kinase
            binding" evidence=IPI] [GO:0005887 "integral to plasma membrane"
            evidence=TAS] [GO:0007156 "homophilic cell adhesion" evidence=TAS]
            [GO:0007160 "cell-matrix adhesion" evidence=TAS] [GO:0007161
            "calcium-independent cell-matrix adhesion" evidence=TAS]
            [GO:0009653 "anatomical structure morphogenesis" evidence=TAS]
            [GO:0002133 "polycystin complex" evidence=ISS] [GO:0001701 "in
            utero embryonic development" evidence=ISS] [GO:0006611 "protein
            export from nucleus" evidence=ISS] [GO:0007050 "cell cycle arrest"
            evidence=ISS] [GO:0007259 "JAK-STAT cascade" evidence=ISS]
            [GO:0018105 "peptidyl-serine phosphorylation" evidence=ISS]
            [GO:0050982 "detection of mechanical stimulus" evidence=ISS]
            [GO:0005634 "nucleus" evidence=ISS] [GO:0005929 "cilium"
            evidence=ISS] [GO:0031512 "motile primary cilium" evidence=ISS]
            [GO:0001822 "kidney development" evidence=ISS] [GO:0001892
            "embryonic placenta development" evidence=ISS] [GO:0032092
            "positive regulation of protein binding" evidence=ISS] [GO:0042994
            "cytoplasmic sequestering of transcription factor" evidence=ISS]
            [GO:0060674 "placenta blood vessel development" evidence=ISS]
            [GO:0005261 "cation channel activity" evidence=ISS] [GO:0005737
            "cytoplasm" evidence=ISS] [GO:0044325 "ion channel binding"
            evidence=IPI] [GO:0016021 "integral to membrane" evidence=NAS]
            [GO:0016323 "basolateral plasma membrane" evidence=IDA] [GO:0045944
            "positive regulation of transcription from RNA polymerase II
            promoter" evidence=IDA] [GO:0031659 "positive regulation of
            cyclin-dependent protein serine/threonine kinase activity involved
            in G1/S" evidence=IDA] [GO:0019904 "protein domain specific
            binding" evidence=IPI] InterPro:IPR001611 InterPro:IPR000203
            InterPro:IPR000434 InterPro:IPR001024 InterPro:IPR001304
            Pfam:PF00059 Pfam:PF01477 Pfam:PF01825 PRINTS:PR00500
            PROSITE:PS50041 PROSITE:PS50068 PROSITE:PS50095 PROSITE:PS50221
            PROSITE:PS51450 SMART:SM00034 SMART:SM00303 SMART:SM00308
            InterPro:IPR002889 UniProt:P98161 GO:GO:0005634 GO:GO:0005737
            GO:GO:0043588 GO:GO:0007507 GO:GO:0005887 GO:GO:0032092
            GO:GO:0030246 GO:GO:0007218 Gene3D:3.10.100.10 InterPro:IPR016186
            InterPro:IPR016187 SUPFAM:SSF56436 PROSITE:PS00615 GO:GO:0045944
            InterPro:IPR000483 InterPro:IPR003591 SMART:SM00369 SMART:SM00082
            GO:GO:0016323 GO:GO:0007050 GO:GO:0018105 GO:GO:0048806
            GO:GO:0005261 GO:GO:0006816 GO:GO:0051216 GO:GO:0031659
            PROSITE:PS01209 GO:GO:0021510 GO:GO:0021915 InterPro:IPR000372
            Pfam:PF01462 SMART:SM00013 GO:GO:0001502 GO:GO:0048565
            GO:GO:0007156 GO:GO:0006611 GO:GO:0072205 GO:GO:0001892
            GO:GO:0048754 EMBL:AC009065 GO:GO:0042994 GO:GO:0007259
            GO:GO:0060674 GO:GO:0031512 Gene3D:2.60.60.20 InterPro:IPR008976
            SUPFAM:SSF49723 GO:GO:0060428 GO:GO:0007161 Gene3D:2.60.40.670
            InterPro:IPR022409 InterPro:IPR000601 Pfam:PF00801 SMART:SM00089
            SUPFAM:SSF49299 PROSITE:PS50093 InterPro:IPR002859 Pfam:PF02010
            eggNOG:COG3291 CleanEx:HS_PKD1 Pfam:PF01822 PROSITE:PS51212
            GO:GO:0072177 InterPro:IPR013122 Pfam:PF08016 GO:GO:0050982
            InterPro:IPR014010 PROSITE:PS51111 EMBL:U24497 EMBL:L33243
            EMBL:L43619 EMBL:L43601 EMBL:L43602 EMBL:L43604 EMBL:L43605
            EMBL:L43610 EMBL:L43617 EMBL:L43618 EMBL:AC093513 IPI:IPI00028786
            IPI:IPI00409566 IPI:IPI00409567 PIR:A38971 RefSeq:NP_000287.3
            RefSeq:NP_001009944.2 UniGene:Hs.75813 PDB:1B4R PDBsum:1B4R
            ProteinModelPortal:P98161 IntAct:P98161 MINT:MINT-1199187
            STRING:P98161 MEROPS:T06.001 TCDB:1.A.5.1.1 PhosphoSite:P98161
            DMDM:292495072 PaxDb:P98161 PRIDE:P98161 Ensembl:ENST00000262304
            Ensembl:ENST00000423118 GeneID:5310 KEGG:hsa:5310 UCSC:uc002cos.1
            UCSC:uc002cot.1 CTD:5310 GeneCards:GC16M002138 H-InvDB:HIX0173395
            H-InvDB:HIX0202314 HGNC:HGNC:9008 HPA:CAB046448 MIM:173900
            MIM:601313 neXtProt:NX_P98161 Orphanet:730 Orphanet:88924
            PharmGKB:PA35521 HOGENOM:HOG000168445 HOVERGEN:HBG049412
            InParanoid:P98161 KO:K04985 OMA:GQCNTDL OrthoDB:EOG4Z8XVH
            PhylomeDB:P98161 BindingDB:P98161 ChEMBL:CHEMBL5772
            EvolutionaryTrace:P98161 GenomeRNAi:5310 NextBio:20530
            ArrayExpress:P98161 Bgee:P98161 Genevestigator:P98161
            GermOnline:ENSG00000008710 GO:GO:0002133 GO:GO:0072218
            GO:GO:0072287 GO:GO:0072237 InterPro:IPR006228 InterPro:IPR013994
            SMART:SM00321 TIGRFAMs:TIGR00864
        Length = 4303

 Score = 121 (47.7 bits), Expect = 1.4e-05, P = 1.4e-05
 Identities = 22/60 (36%), Positives = 36/60 (60%)

Query:     9 IYNGGGYVKDLGSSESNMAQGLSQMIIHKWLDERTRVILIECSLYNPNINAIIAVSLMIE 68
             +Y+ GGYV++LG S       L  + +H WLD R+R + +E + Y+P +    AV+L +E
Sbjct:  3813 VYDSGGYVQELGLSLEESRDRLRFLQLHNWLDNRSRAVFLELTRYSPAVGLHAAVTLRLE 3872


>UNIPROTKB|Q4GZT3 [details] [associations]
            symbol:PKD2 "Polycystin-2" species:9913 "Bos taurus"
            [GO:2000134 "negative regulation of G1/S transition of mitotic cell
            cycle" evidence=IEA] [GO:0090279 "regulation of calcium ion import"
            evidence=IEA] [GO:0072686 "mitotic spindle" evidence=IEA]
            [GO:0072284 "metanephric S-shaped body morphogenesis" evidence=IEA]
            [GO:0072235 "metanephric distal tubule development" evidence=IEA]
            [GO:0072219 "metanephric cortical collecting duct development"
            evidence=IEA] [GO:0072218 "metanephric ascending thin limb
            development" evidence=IEA] [GO:0072214 "metanephric cortex
            development" evidence=IEA] [GO:0072208 "metanephric smooth muscle
            tissue development" evidence=IEA] [GO:0072177 "mesonephric duct
            development" evidence=IEA] [GO:0072075 "metanephric mesenchyme
            development" evidence=IEA] [GO:0071556 "integral to lumenal side of
            endoplasmic reticulum membrane" evidence=IEA] [GO:0071498 "cellular
            response to fluid shear stress" evidence=IEA] [GO:0071470 "cellular
            response to osmotic stress" evidence=IEA] [GO:0071464 "cellular
            response to hydrostatic pressure" evidence=IEA] [GO:0071458
            "integral to cytosolic side of endoplasmic reticulum membrane"
            evidence=IEA] [GO:0071158 "positive regulation of cell cycle
            arrest" evidence=IEA] [GO:0061441 "renal artery morphogenesis"
            evidence=IEA] [GO:0061371 "determination of heart left/right
            asymmetry" evidence=IEA] [GO:0061333 "renal tubule morphogenesis"
            evidence=IEA] [GO:0060674 "placenta blood vessel development"
            evidence=IEA] [GO:0060315 "negative regulation of
            ryanodine-sensitive calcium-release channel activity" evidence=IEA]
            [GO:0051209 "release of sequestered calcium ion into cytosol"
            evidence=IEA] [GO:0051117 "ATPase binding" evidence=IEA]
            [GO:0050982 "detection of mechanical stimulus" evidence=IEA]
            [GO:0048763 "calcium-induced calcium release activity"
            evidence=IEA] [GO:0045944 "positive regulation of transcription
            from RNA polymerase II promoter" evidence=IEA] [GO:0045429
            "positive regulation of nitric oxide biosynthetic process"
            evidence=IEA] [GO:0045180 "basal cortex" evidence=IEA] [GO:0044441
            "cilium part" evidence=IEA] [GO:0044325 "ion channel binding"
            evidence=IEA] [GO:0043398 "HLH domain binding" evidence=IEA]
            [GO:0042994 "cytoplasmic sequestering of transcription factor"
            evidence=IEA] [GO:0042805 "actinin binding" evidence=IEA]
            [GO:0042803 "protein homodimerization activity" evidence=IEA]
            [GO:0042127 "regulation of cell proliferation" evidence=IEA]
            [GO:0035904 "aorta development" evidence=IEA] [GO:0035502
            "metanephric part of ureteric bud development" evidence=IEA]
            [GO:0031941 "filamentous actin" evidence=IEA] [GO:0031659 "positive
            regulation of cyclin-dependent protein serine/threonine kinase
            activity involved in G1/S" evidence=IEA] [GO:0031587 "positive
            regulation of inositol 1,4,5-trisphosphate-sensitive
            calcium-release channel activity" evidence=IEA] [GO:0031513
            "nonmotile primary cilium" evidence=IEA] [GO:0031512 "motile
            primary cilium" evidence=IEA] [GO:0030814 "regulation of cAMP
            metabolic process" evidence=IEA] [GO:0030027 "lamellipodium"
            evidence=IEA] [GO:0021915 "neural tube development" evidence=IEA]
            [GO:0021510 "spinal cord development" evidence=IEA] [GO:0009925
            "basal plasma membrane" evidence=IEA] [GO:0007507 "heart
            development" evidence=IEA] [GO:0007259 "JAK-STAT cascade"
            evidence=IEA] [GO:0007050 "cell cycle arrest" evidence=IEA]
            [GO:0005932 "microtubule basal body" evidence=IEA] [GO:0005911
            "cell-cell junction" evidence=IEA] [GO:0005887 "integral to plasma
            membrane" evidence=IEA] [GO:0005509 "calcium ion binding"
            evidence=IEA] [GO:0005267 "potassium channel activity"
            evidence=IEA] [GO:0005248 "voltage-gated sodium channel activity"
            evidence=IEA] [GO:0005245 "voltage-gated calcium channel activity"
            evidence=IEA] [GO:0005102 "receptor binding" evidence=IEA]
            [GO:0003127 "detection of nodal flow" evidence=IEA] [GO:0002133
            "polycystin complex" evidence=IEA] [GO:0001892 "embryonic placenta
            development" evidence=IEA] [GO:0001889 "liver development"
            evidence=IEA] [GO:0001658 "branching involved in ureteric bud
            morphogenesis" evidence=IEA] InterPro:IPR002048 InterPro:IPR003915
            InterPro:IPR011992 PRINTS:PR01433 PROSITE:PS50222 Prosite:PS00018
            GO:GO:0007507 GO:GO:0071556 GO:GO:0005887 GO:GO:0071158
            GO:GO:0051209 GO:GO:0045944 GO:GO:0005509 Gene3D:1.10.238.10
            GO:GO:0001889 GO:GO:0007050 GO:GO:0045180 GO:GO:0005911
            GO:GO:0030027 GO:GO:0005267 EMBL:AJ871176 GO:GO:0042127
            GO:GO:0031941 GO:GO:0031659 GO:GO:0071470 GO:GO:0045429
            GO:GO:0005932 GO:GO:0021510 GO:GO:0021915 GO:GO:0001658
            GO:GO:0009925 GO:GO:2000134 GO:GO:0001892 GO:GO:0005248
            GO:GO:0072686 GO:GO:0060315 GO:GO:0072075 GO:GO:0031513
            GO:GO:0061371 GO:GO:0005245 GO:GO:0042994 GO:GO:0035502
            GO:GO:0090279 GO:GO:0007259 GO:GO:0060674 GO:GO:0071464
            GO:GO:0003127 GO:GO:0031512 GO:GO:0030814 GO:GO:0071498
            GO:GO:0061333 GO:GO:0071458 GO:GO:0072177 GO:GO:0072284
            InterPro:IPR013122 Pfam:PF08016 GO:GO:0050982 GO:GO:0072208
            GO:GO:0044441 eggNOG:NOG325704 HOGENOM:HOG000230858
            HOVERGEN:HBG014945 GeneTree:ENSGT00700000104221 GO:GO:0002133
            GO:GO:0072218 IPI:IPI00701864 RefSeq:NP_001039777.1
            UniGene:Bt.59637 STRING:Q4GZT3 PRIDE:Q4GZT3
            Ensembl:ENSBTAT00000026682 GeneID:530393 KEGG:bta:530393 CTD:5311
            InParanoid:Q4GZT3 KO:K04986 OMA:AWSRDNP OrthoDB:EOG473PQQ
            NextBio:20875247 GO:GO:0048763 GO:GO:0035904 GO:GO:0072214
            GO:GO:0072219 GO:GO:0072235 GO:GO:0031587 GO:GO:0061441
            Uniprot:Q4GZT3
        Length = 970

 Score = 113 (44.8 bits), Expect = 1.9e-05, P = 1.9e-05
 Identities = 22/59 (37%), Positives = 33/59 (55%)

Query:    10 YNGGGYVKDLGSSESNMAQGLSQMIIHKWLDERTRVILIECSLYNPNINAIIAVSLMIE 68
             Y+G GY  DL  +    A  ++ +  + WLD  TR I I+ ++YN NIN    + L+IE
Sbjct:   388 YSGAGYYLDLSRTREETAAQVANLKKNVWLDRGTRAIFIDFTVYNANINLFCVIRLLIE 446


>UNIPROTKB|F1NT86 [details] [associations]
            symbol:PKD2 "Uncharacterized protein" species:9031 "Gallus
            gallus" [GO:0001658 "branching involved in ureteric bud
            morphogenesis" evidence=IEA] [GO:0001889 "liver development"
            evidence=IEA] [GO:0001892 "embryonic placenta development"
            evidence=IEA] [GO:0002133 "polycystin complex" evidence=IEA]
            [GO:0003127 "detection of nodal flow" evidence=IEA] [GO:0005102
            "receptor binding" evidence=IEA] [GO:0005245 "voltage-gated calcium
            channel activity" evidence=IEA] [GO:0005248 "voltage-gated sodium
            channel activity" evidence=IEA] [GO:0005267 "potassium channel
            activity" evidence=IEA] [GO:0005509 "calcium ion binding"
            evidence=IEA] [GO:0005887 "integral to plasma membrane"
            evidence=IEA] [GO:0005911 "cell-cell junction" evidence=IEA]
            [GO:0005932 "microtubule basal body" evidence=IEA] [GO:0007050
            "cell cycle arrest" evidence=IEA] [GO:0007259 "JAK-STAT cascade"
            evidence=IEA] [GO:0009925 "basal plasma membrane" evidence=IEA]
            [GO:0021510 "spinal cord development" evidence=IEA] [GO:0021915
            "neural tube development" evidence=IEA] [GO:0030027 "lamellipodium"
            evidence=IEA] [GO:0030814 "regulation of cAMP metabolic process"
            evidence=IEA] [GO:0031512 "motile primary cilium" evidence=IEA]
            [GO:0031513 "nonmotile primary cilium" evidence=IEA] [GO:0031587
            "positive regulation of inositol 1,4,5-trisphosphate-sensitive
            calcium-release channel activity" evidence=IEA] [GO:0031659
            "positive regulation of cyclin-dependent protein serine/threonine
            kinase activity involved in G1/S" evidence=IEA] [GO:0031941
            "filamentous actin" evidence=IEA] [GO:0035502 "metanephric part of
            ureteric bud development" evidence=IEA] [GO:0035904 "aorta
            development" evidence=IEA] [GO:0042127 "regulation of cell
            proliferation" evidence=IEA] [GO:0042803 "protein homodimerization
            activity" evidence=IEA] [GO:0042805 "actinin binding" evidence=IEA]
            [GO:0042994 "cytoplasmic sequestering of transcription factor"
            evidence=IEA] [GO:0043398 "HLH domain binding" evidence=IEA]
            [GO:0044325 "ion channel binding" evidence=IEA] [GO:0044441 "cilium
            part" evidence=IEA] [GO:0045180 "basal cortex" evidence=IEA]
            [GO:0045429 "positive regulation of nitric oxide biosynthetic
            process" evidence=IEA] [GO:0045944 "positive regulation of
            transcription from RNA polymerase II promoter" evidence=IEA]
            [GO:0048763 "calcium-induced calcium release activity"
            evidence=IEA] [GO:0050982 "detection of mechanical stimulus"
            evidence=IEA] [GO:0051117 "ATPase binding" evidence=IEA]
            [GO:0051209 "release of sequestered calcium ion into cytosol"
            evidence=IEA] [GO:0060315 "negative regulation of
            ryanodine-sensitive calcium-release channel activity" evidence=IEA]
            [GO:0060674 "placenta blood vessel development" evidence=IEA]
            [GO:0061333 "renal tubule morphogenesis" evidence=IEA] [GO:0061371
            "determination of heart left/right asymmetry" evidence=IEA]
            [GO:0061441 "renal artery morphogenesis" evidence=IEA] [GO:0071158
            "positive regulation of cell cycle arrest" evidence=IEA]
            [GO:0071458 "integral to cytosolic side of endoplasmic reticulum
            membrane" evidence=IEA] [GO:0071464 "cellular response to
            hydrostatic pressure" evidence=IEA] [GO:0071470 "cellular response
            to osmotic stress" evidence=IEA] [GO:0071498 "cellular response to
            fluid shear stress" evidence=IEA] [GO:0071556 "integral to lumenal
            side of endoplasmic reticulum membrane" evidence=IEA] [GO:0072075
            "metanephric mesenchyme development" evidence=IEA] [GO:0072177
            "mesonephric duct development" evidence=IEA] [GO:0072208
            "metanephric smooth muscle tissue development" evidence=IEA]
            [GO:0072214 "metanephric cortex development" evidence=IEA]
            [GO:0072218 "metanephric ascending thin limb development"
            evidence=IEA] [GO:0072219 "metanephric cortical collecting duct
            development" evidence=IEA] [GO:0072235 "metanephric distal tubule
            development" evidence=IEA] [GO:0072284 "metanephric S-shaped body
            morphogenesis" evidence=IEA] [GO:0072686 "mitotic spindle"
            evidence=IEA] [GO:0090279 "regulation of calcium ion import"
            evidence=IEA] [GO:2000134 "negative regulation of G1/S transition
            of mitotic cell cycle" evidence=IEA] InterPro:IPR002048
            InterPro:IPR003915 InterPro:IPR011992 PRINTS:PR01433
            PROSITE:PS50222 GO:GO:0071556 GO:GO:0005887 GO:GO:0071158
            GO:GO:0051209 GO:GO:0045944 GO:GO:0005509 Gene3D:1.10.238.10
            GO:GO:0007050 GO:GO:0045180 GO:GO:0005911 GO:GO:0030027
            GO:GO:0005267 GO:GO:0042127 GO:GO:0031941 GO:GO:0031659
            GO:GO:0071470 GO:GO:0045429 GO:GO:0005932 GO:GO:0009925
            GO:GO:2000134 GO:GO:0005248 GO:GO:0072686 GO:GO:0060315
            GO:GO:0031513 GO:GO:0005245 GO:GO:0042994 GO:GO:0090279
            GO:GO:0007259 GO:GO:0071464 GO:GO:0031512 GO:GO:0030814
            GO:GO:0071498 GO:GO:0071458 InterPro:IPR013122 Pfam:PF08016
            GO:GO:0050982 EMBL:AADN02009016 GO:GO:0044441
            GeneTree:ENSGT00700000104221 GO:GO:0002133 GO:GO:0048763
            GO:GO:0031587 IPI:IPI00596324 Ensembl:ENSGALT00000017765
            ArrayExpress:F1NT86 Uniprot:F1NT86
        Length = 881

 Score = 112 (44.5 bits), Expect = 2.2e-05, P = 2.2e-05
 Identities = 24/68 (35%), Positives = 36/68 (52%)

Query:    10 YNGGGYVKDLGSSESNMAQGLSQMIIHKWLDERTRVILIECSLYNPNINAIIAVSLMIER 69
             Y+G GY +DL  +    A  ++ +  + WLD  TR   I+ S+YN NIN    V L++E 
Sbjct:   299 YSGAGYYQDLSRTREVTAVQIASLKENLWLDRGTRAAFIDFSVYNANINLFCVVRLLVEF 358

Query:    70 LGSHNYLT 77
               +   LT
Sbjct:   359 PATGGLLT 366


>UNIPROTKB|F1NDJ6 [details] [associations]
            symbol:PKD2 "Uncharacterized protein" species:9031 "Gallus
            gallus" [GO:0001658 "branching involved in ureteric bud
            morphogenesis" evidence=IEA] [GO:0001889 "liver development"
            evidence=IEA] [GO:0001892 "embryonic placenta development"
            evidence=IEA] [GO:0002133 "polycystin complex" evidence=IEA]
            [GO:0003127 "detection of nodal flow" evidence=IEA] [GO:0005102
            "receptor binding" evidence=IEA] [GO:0005245 "voltage-gated calcium
            channel activity" evidence=IEA] [GO:0005248 "voltage-gated sodium
            channel activity" evidence=IEA] [GO:0005267 "potassium channel
            activity" evidence=IEA] [GO:0005509 "calcium ion binding"
            evidence=IEA] [GO:0005887 "integral to plasma membrane"
            evidence=IEA] [GO:0005911 "cell-cell junction" evidence=IEA]
            [GO:0005932 "microtubule basal body" evidence=IEA] [GO:0007050
            "cell cycle arrest" evidence=IEA] [GO:0007259 "JAK-STAT cascade"
            evidence=IEA] [GO:0009925 "basal plasma membrane" evidence=IEA]
            [GO:0021510 "spinal cord development" evidence=IEA] [GO:0021915
            "neural tube development" evidence=IEA] [GO:0030027 "lamellipodium"
            evidence=IEA] [GO:0030814 "regulation of cAMP metabolic process"
            evidence=IEA] [GO:0031512 "motile primary cilium" evidence=IEA]
            [GO:0031513 "nonmotile primary cilium" evidence=IEA] [GO:0031587
            "positive regulation of inositol 1,4,5-trisphosphate-sensitive
            calcium-release channel activity" evidence=IEA] [GO:0031659
            "positive regulation of cyclin-dependent protein serine/threonine
            kinase activity involved in G1/S" evidence=IEA] [GO:0031941
            "filamentous actin" evidence=IEA] [GO:0035502 "metanephric part of
            ureteric bud development" evidence=IEA] [GO:0035904 "aorta
            development" evidence=IEA] [GO:0042127 "regulation of cell
            proliferation" evidence=IEA] [GO:0042803 "protein homodimerization
            activity" evidence=IEA] [GO:0042805 "actinin binding" evidence=IEA]
            [GO:0042994 "cytoplasmic sequestering of transcription factor"
            evidence=IEA] [GO:0043398 "HLH domain binding" evidence=IEA]
            [GO:0044325 "ion channel binding" evidence=IEA] [GO:0044441 "cilium
            part" evidence=IEA] [GO:0045180 "basal cortex" evidence=IEA]
            [GO:0045429 "positive regulation of nitric oxide biosynthetic
            process" evidence=IEA] [GO:0045944 "positive regulation of
            transcription from RNA polymerase II promoter" evidence=IEA]
            [GO:0048763 "calcium-induced calcium release activity"
            evidence=IEA] [GO:0050982 "detection of mechanical stimulus"
            evidence=IEA] [GO:0051117 "ATPase binding" evidence=IEA]
            [GO:0051209 "release of sequestered calcium ion into cytosol"
            evidence=IEA] [GO:0060315 "negative regulation of
            ryanodine-sensitive calcium-release channel activity" evidence=IEA]
            [GO:0060674 "placenta blood vessel development" evidence=IEA]
            [GO:0061333 "renal tubule morphogenesis" evidence=IEA] [GO:0061371
            "determination of heart left/right asymmetry" evidence=IEA]
            [GO:0061441 "renal artery morphogenesis" evidence=IEA] [GO:0071158
            "positive regulation of cell cycle arrest" evidence=IEA]
            [GO:0071458 "integral to cytosolic side of endoplasmic reticulum
            membrane" evidence=IEA] [GO:0071464 "cellular response to
            hydrostatic pressure" evidence=IEA] [GO:0071470 "cellular response
            to osmotic stress" evidence=IEA] [GO:0071498 "cellular response to
            fluid shear stress" evidence=IEA] [GO:0071556 "integral to lumenal
            side of endoplasmic reticulum membrane" evidence=IEA] [GO:0072075
            "metanephric mesenchyme development" evidence=IEA] [GO:0072177
            "mesonephric duct development" evidence=IEA] [GO:0072208
            "metanephric smooth muscle tissue development" evidence=IEA]
            [GO:0072214 "metanephric cortex development" evidence=IEA]
            [GO:0072218 "metanephric ascending thin limb development"
            evidence=IEA] [GO:0072219 "metanephric cortical collecting duct
            development" evidence=IEA] [GO:0072235 "metanephric distal tubule
            development" evidence=IEA] [GO:0072284 "metanephric S-shaped body
            morphogenesis" evidence=IEA] [GO:0072686 "mitotic spindle"
            evidence=IEA] [GO:0090279 "regulation of calcium ion import"
            evidence=IEA] [GO:2000134 "negative regulation of G1/S transition
            of mitotic cell cycle" evidence=IEA] InterPro:IPR002048
            InterPro:IPR003915 InterPro:IPR011992 PRINTS:PR01433
            PROSITE:PS50222 GO:GO:0071556 GO:GO:0005887 GO:GO:0071158
            GO:GO:0051209 GO:GO:0045944 GO:GO:0005509 Gene3D:1.10.238.10
            GO:GO:0007050 GO:GO:0045180 GO:GO:0005911 GO:GO:0030027
            GO:GO:0005267 GO:GO:0042127 GO:GO:0031941 GO:GO:0031659
            GO:GO:0071470 GO:GO:0045429 GO:GO:0005932 GO:GO:0009925
            GO:GO:2000134 GO:GO:0005248 GO:GO:0072686 GO:GO:0060315
            GO:GO:0031513 GO:GO:0005245 GO:GO:0042994 GO:GO:0090279
            GO:GO:0007259 GO:GO:0071464 GO:GO:0031512 GO:GO:0030814
            GO:GO:0071498 GO:GO:0071458 InterPro:IPR013122 Pfam:PF08016
            GO:GO:0050982 EMBL:AADN02009016 GO:GO:0044441
            GeneTree:ENSGT00700000104221 GO:GO:0002133 OMA:AWSRDNP
            GO:GO:0048763 GO:GO:0031587 IPI:IPI00821494
            Ensembl:ENSGALT00000038132 ArrayExpress:F1NDJ6 Uniprot:F1NDJ6
        Length = 926

 Score = 112 (44.5 bits), Expect = 2.3e-05, P = 2.3e-05
 Identities = 24/68 (35%), Positives = 36/68 (52%)

Query:    10 YNGGGYVKDLGSSESNMAQGLSQMIIHKWLDERTRVILIECSLYNPNINAIIAVSLMIER 69
             Y+G GY +DL  +    A  ++ +  + WLD  TR   I+ S+YN NIN    V L++E 
Sbjct:   344 YSGAGYYQDLSRTREVTAVQIASLKENLWLDRGTRAAFIDFSVYNANINLFCVVRLLVEF 403

Query:    70 LGSHNYLT 77
               +   LT
Sbjct:   404 PATGGLLT 411


>UNIPROTKB|Q2TBW4 [details] [associations]
            symbol:PKD2L2 "Uncharacterized protein" species:9913 "Bos
            taurus" [GO:0016020 "membrane" evidence=IEA] [GO:0005509 "calcium
            ion binding" evidence=IEA] InterPro:IPR003915 PRINTS:PR01433
            GO:GO:0016020 GO:GO:0005509 InterPro:IPR013122 Pfam:PF08016
            eggNOG:NOG325704 HOGENOM:HOG000230858 HOVERGEN:HBG014945 CTD:27039
            KO:K04991 OMA:KFMEGPL GeneTree:ENSGT00700000104221
            OrthoDB:EOG4C5CJ2 EMBL:DAAA02020389 EMBL:DAAA02020388 EMBL:BC109572
            IPI:IPI00722247 RefSeq:NP_001033641.1 UniGene:Bt.87606
            Ensembl:ENSBTAT00000010236 GeneID:521683 KEGG:bta:521683
            InParanoid:Q2TBW4 NextBio:20873346 Uniprot:Q2TBW4
        Length = 600

 Score = 109 (43.4 bits), Expect = 2.8e-05, P = 2.8e-05
 Identities = 22/69 (31%), Positives = 35/69 (50%)

Query:     9 IYNGGGYVKDLGSSESNMAQGLSQMIIHKWLDERTRVILIECSLYNPNINAIIAVSLMIE 68
             +Y  GGY+  L  S+S        + ++ W+   TRVI I+ S+YN N+N    + L+ E
Sbjct:   168 VYQNGGYIFTLSKSKSETLNKFINLRMNSWITRGTRVIFIDFSVYNANVNLFCIIRLVAE 227

Query:    69 RLGSHNYLT 77
                +   LT
Sbjct:   228 FPATGGILT 236


>MGI|MGI:1858231 [details] [associations]
            symbol:Pkd2l2 "polycystic kidney disease 2-like 2"
            species:10090 "Mus musculus" [GO:0005216 "ion channel activity"
            evidence=IEA] [GO:0005509 "calcium ion binding" evidence=IEA]
            [GO:0006810 "transport" evidence=IEA] [GO:0006811 "ion transport"
            evidence=IEA] [GO:0016020 "membrane" evidence=IEA] [GO:0016021
            "integral to membrane" evidence=IEA] [GO:0034220 "ion transmembrane
            transport" evidence=IEA] InterPro:IPR003915 PRINTS:PR01433
            MGI:MGI:1858231 GO:GO:0016021 GO:GO:0005509 GO:GO:0005216
            InterPro:IPR013122 Pfam:PF08016 eggNOG:NOG325704
            HOGENOM:HOG000230858 HOVERGEN:HBG014945 CTD:27039 KO:K04991
            OMA:KFMEGPL EMBL:AF182033 EMBL:BC138717 IPI:IPI00124289
            RefSeq:NP_001156476.1 RefSeq:NP_058623.2 UniGene:Mm.445792
            ProteinModelPortal:Q9JLG4 PhosphoSite:Q9JLG4 PRIDE:Q9JLG4
            Ensembl:ENSMUST00000014647 Ensembl:ENSMUST00000166156 GeneID:53871
            KEGG:mmu:53871 GeneTree:ENSGT00700000104221 InParanoid:B2RS50
            OrthoDB:EOG4C5CJ2 NextBio:310725 Bgee:Q9JLG4 CleanEx:MM_PKD2L2
            Genevestigator:Q9JLG4 GermOnline:ENSMUSG00000014503 Uniprot:Q9JLG4
        Length = 621

 Score = 109 (43.4 bits), Expect = 2.9e-05, P = 2.9e-05
 Identities = 21/69 (30%), Positives = 34/69 (49%)

Query:     9 IYNGGGYVKDLGSSESNMAQGLSQMIIHKWLDERTRVILIECSLYNPNINAIIAVSLMIE 68
             +Y  GGY+  L  S+S        + ++ W+   TR + I+ SLYN N+N    + L+ E
Sbjct:   194 VYRDGGYIVTLSKSKSETKAKFVDLRLNNWISRGTRAVFIDFSLYNANVNLFCIIRLLAE 253

Query:    69 RLGSHNYLT 77
                +   LT
Sbjct:   254 FPATGGLLT 262


>RGD|1559992 [details] [associations]
            symbol:Pkd2 "polycystic kidney disease 2 (autosomal dominant)"
            species:10116 "Rattus norvegicus" [GO:0001658 "branching involved
            in ureteric bud morphogenesis" evidence=IEA;ISO] [GO:0001822
            "kidney development" evidence=ISO] [GO:0001889 "liver development"
            evidence=IEA;ISO] [GO:0001892 "embryonic placenta development"
            evidence=IEA;ISO] [GO:0001947 "heart looping" evidence=ISO]
            [GO:0002133 "polycystin complex" evidence=IEA;ISO] [GO:0003127
            "detection of nodal flow" evidence=IEA;ISO] [GO:0005102 "receptor
            binding" evidence=IEA;ISO] [GO:0005244 "voltage-gated ion channel
            activity" evidence=ISO] [GO:0005245 "voltage-gated calcium channel
            activity" evidence=IEA;ISO] [GO:0005248 "voltage-gated sodium
            channel activity" evidence=IEA;ISO] [GO:0005262 "calcium channel
            activity" evidence=ISO] [GO:0005267 "potassium channel activity"
            evidence=IEA;ISO] [GO:0005509 "calcium ion binding"
            evidence=IEA;ISO] [GO:0005737 "cytoplasm" evidence=ISO] [GO:0005783
            "endoplasmic reticulum" evidence=ISO;IDA] [GO:0005789 "endoplasmic
            reticulum membrane" evidence=ISO] [GO:0005886 "plasma membrane"
            evidence=ISO] [GO:0005887 "integral to plasma membrane"
            evidence=IEA;ISO] [GO:0005911 "cell-cell junction"
            evidence=IEA;ISO] [GO:0005929 "cilium" evidence=ISO] [GO:0005932
            "microtubule basal body" evidence=IEA;ISO] [GO:0006816 "calcium ion
            transport" evidence=ISO] [GO:0006874 "cellular calcium ion
            homeostasis" evidence=ISO] [GO:0007050 "cell cycle arrest"
            evidence=IEA;ISO] [GO:0007204 "elevation of cytosolic calcium ion
            concentration" evidence=IMP] [GO:0007259 "JAK-STAT cascade"
            evidence=IEA;ISO] [GO:0007368 "determination of left/right
            symmetry" evidence=ISO] [GO:0007507 "heart development"
            evidence=IEA;ISO] [GO:0008092 "cytoskeletal protein binding"
            evidence=ISO] [GO:0009925 "basal plasma membrane" evidence=IEA;ISO]
            [GO:0010628 "positive regulation of gene expression" evidence=ISO]
            [GO:0015267 "channel activity" evidence=ISO] [GO:0016020 "membrane"
            evidence=IDA] [GO:0021510 "spinal cord development"
            evidence=IEA;ISO] [GO:0021915 "neural tube development"
            evidence=IEA;ISO] [GO:0022843 "voltage-gated cation channel
            activity" evidence=ISO] [GO:0030027 "lamellipodium"
            evidence=IEA;ISO] [GO:0030814 "regulation of cAMP metabolic
            process" evidence=IEA;ISO] [GO:0031512 "motile primary cilium"
            evidence=IEA;ISO] [GO:0031513 "nonmotile primary cilium"
            evidence=IEA;ISO] [GO:0031587 "positive regulation of inositol
            1,4,5-trisphosphate-sensitive calcium-release channel activity"
            evidence=IEA;ISO] [GO:0031659 "positive regulation of
            cyclin-dependent protein serine/threonine kinase activity involved
            in G1/S" evidence=IEA;ISO] [GO:0031941 "filamentous actin"
            evidence=IEA;ISO] [GO:0035502 "metanephric part of ureteric bud
            development" evidence=IEA;ISO] [GO:0035725 "sodium ion
            transmembrane transport" evidence=ISO] [GO:0035904 "aorta
            development" evidence=IEA;ISO] [GO:0042127 "regulation of cell
            proliferation" evidence=IEA;ISO] [GO:0042802 "identical protein
            binding" evidence=ISO] [GO:0042803 "protein homodimerization
            activity" evidence=IEA;ISO] [GO:0042805 "actinin binding"
            evidence=ISO] [GO:0042994 "cytoplasmic sequestering of
            transcription factor" evidence=IEA;ISO] [GO:0043398 "HLH domain
            binding" evidence=IEA;ISO] [GO:0044325 "ion channel binding"
            evidence=IEA;ISO] [GO:0044441 "cilium part" evidence=IEA;ISO]
            [GO:0045180 "basal cortex" evidence=IEA;ISO] [GO:0045429 "positive
            regulation of nitric oxide biosynthetic process" evidence=IEA;ISO]
            [GO:0045944 "positive regulation of transcription from RNA
            polymerase II promoter" evidence=IEA;ISO] [GO:0048763
            "calcium-induced calcium release activity" evidence=IEA;ISO]
            [GO:0050982 "detection of mechanical stimulus" evidence=IEA;ISO]
            [GO:0051117 "ATPase binding" evidence=IEA;ISO] [GO:0051209 "release
            of sequestered calcium ion into cytosol" evidence=IEA;ISO]
            [GO:0051371 "muscle alpha-actinin binding" evidence=IPI]
            [GO:0051393 "alpha-actinin binding" evidence=IPI] [GO:0055085
            "transmembrane transport" evidence=ISO] [GO:0060315 "negative
            regulation of ryanodine-sensitive calcium-release channel activity"
            evidence=IEA;ISO] [GO:0060674 "placenta blood vessel development"
            evidence=IEA;ISO] [GO:0061333 "renal tubule morphogenesis"
            evidence=IEA;ISO] [GO:0061371 "determination of heart left/right
            asymmetry" evidence=IEA] [GO:0061441 "renal artery morphogenesis"
            evidence=IEA;ISO] [GO:0070588 "calcium ion transmembrane transport"
            evidence=ISO] [GO:0071158 "positive regulation of cell cycle
            arrest" evidence=IEA;ISO] [GO:0071458 "integral to cytosolic side
            of endoplasmic reticulum membrane" evidence=IEA;ISO] [GO:0071464
            "cellular response to hydrostatic pressure" evidence=IEA;ISO]
            [GO:0071470 "cellular response to osmotic stress" evidence=IEA;ISO]
            [GO:0071498 "cellular response to fluid shear stress"
            evidence=IEA;ISO] [GO:0071556 "integral to lumenal side of
            endoplasmic reticulum membrane" evidence=IEA;ISO] [GO:0071910
            "determination of liver left/right asymmetry" evidence=ISO]
            [GO:0072001 "renal system development" evidence=ISO] [GO:0072075
            "metanephric mesenchyme development" evidence=IEA;ISO] [GO:0072164
            "mesonephric tubule development" evidence=ISO] [GO:0072177
            "mesonephric duct development" evidence=IEA;ISO] [GO:0072208
            "metanephric smooth muscle tissue development" evidence=IEA;ISO]
            [GO:0072214 "metanephric cortex development" evidence=IEA;ISO]
            [GO:0072218 "metanephric ascending thin limb development"
            evidence=IEA;ISO] [GO:0072219 "metanephric cortical collecting duct
            development" evidence=IEA;ISO] [GO:0072235 "metanephric distal
            tubule development" evidence=IEA;ISO] [GO:0072284 "metanephric
            S-shaped body morphogenesis" evidence=IEA;ISO] [GO:0072686 "mitotic
            spindle" evidence=IEA;ISO] [GO:0090279 "regulation of calcium ion
            import" evidence=IEA;ISO] [GO:2000134 "negative regulation of G1/S
            transition of mitotic cell cycle" evidence=IEA;ISO]
            InterPro:IPR002048 InterPro:IPR003915 InterPro:IPR011992
            PRINTS:PR01433 PROSITE:PS50222 RGD:1559992 GO:GO:0005783
            GO:GO:0007507 GO:GO:0071556 GO:GO:0005887 GO:GO:0071158
            GO:GO:0016020 GO:GO:0051209 GO:GO:0045944 GO:GO:0005509
            Gene3D:1.10.238.10 GO:GO:0001889 GO:GO:0007050 GO:GO:0045180
            GO:GO:0005911 GO:GO:0030027 GO:GO:0005267 GO:GO:0042127
            GO:GO:0007204 GO:GO:0031941 GO:GO:0031659 GO:GO:0071470
            GO:GO:0045429 GO:GO:0005932 GO:GO:0021510 GO:GO:0021915
            GO:GO:0001658 GO:GO:0009925 GO:GO:2000134 GO:GO:0001892
            GO:GO:0005248 GO:GO:0072686 GO:GO:0060315 GO:GO:0072075
            GO:GO:0031513 GO:GO:0061371 GO:GO:0005245 GO:GO:0042994
            GO:GO:0035502 GO:GO:0090279 GO:GO:0007259 GO:GO:0060674
            GO:GO:0071464 GO:GO:0003127 GO:GO:0031512 GO:GO:0030814
            GO:GO:0071498 GO:GO:0061333 GO:GO:0071458 GO:GO:0072177
            GO:GO:0072284 InterPro:IPR013122 Pfam:PF08016 GO:GO:0050982
            GO:GO:0072208 GO:GO:0044441 GeneTree:ENSGT00700000104221
            GO:GO:0002133 GO:GO:0072218 CTD:5311 KO:K04986 OMA:AWSRDNP
            OrthoDB:EOG473PQQ GO:GO:0048763 GO:GO:0035904 GO:GO:0072214
            GO:GO:0072219 GO:GO:0072235 GO:GO:0031587 GO:GO:0061441
            EMBL:CH474022 IPI:IPI00198146 RefSeq:NP_001178863.1
            UniGene:Rn.198353 Ensembl:ENSRNOT00000002916 GeneID:498328
            KEGG:rno:498328 NextBio:699432 Uniprot:D4A5F1
        Length = 966

 Score = 111 (44.1 bits), Expect = 3.1e-05, P = 3.1e-05
 Identities = 23/59 (38%), Positives = 32/59 (54%)

Query:    10 YNGGGYVKDLGSSESNMAQGLSQMIIHKWLDERTRVILIECSLYNPNINAIIAVSLMIE 68
             Y+G GY  DL  +    A  L+ +  + WLD  TR   I+ S+YN NIN    V L++E
Sbjct:   384 YSGAGYYLDLSRTREETAAQLAGLRRNFWLDRGTRAAFIDFSVYNANINLFCVVRLLVE 442


>UNIPROTKB|Q13563 [details] [associations]
            symbol:PKD2 "Polycystin-2" species:9606 "Homo sapiens"
            [GO:0044441 "cilium part" evidence=IEA] [GO:0005515 "protein
            binding" evidence=IPI] [GO:0072075 "metanephric mesenchyme
            development" evidence=IEP] [GO:0072284 "metanephric S-shaped body
            morphogenesis" evidence=IEP] [GO:0001658 "branching involved in
            ureteric bud morphogenesis" evidence=IEP] [GO:0072235 "metanephric
            distal tubule development" evidence=IEP] [GO:0072218 "metanephric
            ascending thin limb development" evidence=IEP] [GO:0072208
            "metanephric smooth muscle tissue development" evidence=IEP]
            [GO:0072214 "metanephric cortex development" evidence=IEP]
            [GO:0072219 "metanephric cortical collecting duct development"
            evidence=IEP] [GO:0072177 "mesonephric duct development"
            evidence=IEP] [GO:0072164 "mesonephric tubule development"
            evidence=IEP] [GO:0035502 "metanephric part of ureteric bud
            development" evidence=IEP] [GO:0021915 "neural tube development"
            evidence=IEP] [GO:0007507 "heart development" evidence=IEP]
            [GO:0001889 "liver development" evidence=IEP] [GO:0021510 "spinal
            cord development" evidence=IEP] [GO:0035904 "aorta development"
            evidence=IEP] [GO:0061441 "renal artery morphogenesis"
            evidence=IEP] [GO:0005932 "microtubule basal body" evidence=IDA]
            [GO:0005248 "voltage-gated sodium channel activity" evidence=IDA]
            [GO:0035725 "sodium ion transmembrane transport" evidence=IDA]
            [GO:0005245 "voltage-gated calcium channel activity" evidence=IDA]
            [GO:0006816 "calcium ion transport" evidence=ISS;IDA] [GO:0022843
            "voltage-gated cation channel activity" evidence=IDA] [GO:0007050
            "cell cycle arrest" evidence=ISS] [GO:0007259 "JAK-STAT cascade"
            evidence=ISS] [GO:0050982 "detection of mechanical stimulus"
            evidence=ISS] [GO:0060315 "negative regulation of
            ryanodine-sensitive calcium-release channel activity" evidence=ISS]
            [GO:0061333 "renal tubule morphogenesis" evidence=ISS] [GO:0002133
            "polycystin complex" evidence=ISS] [GO:0005789 "endoplasmic
            reticulum membrane" evidence=IDA] [GO:0042127 "regulation of cell
            proliferation" evidence=IMP] [GO:0071556 "integral to lumenal side
            of endoplasmic reticulum membrane" evidence=IDA] [GO:0001947 "heart
            looping" evidence=IMP] [GO:0001892 "embryonic placenta development"
            evidence=ISS] [GO:0007368 "determination of left/right symmetry"
            evidence=ISS] [GO:0030814 "regulation of cAMP metabolic process"
            evidence=ISS] [GO:0060674 "placenta blood vessel development"
            evidence=ISS] [GO:0005267 "potassium channel activity"
            evidence=ISS] [GO:0051117 "ATPase binding" evidence=ISS]
            [GO:0005911 "cell-cell junction" evidence=ISS] [GO:0005929 "cilium"
            evidence=ISS] [GO:0031512 "motile primary cilium" evidence=ISS]
            [GO:0031513 "nonmotile primary cilium" evidence=ISS] [GO:0005509
            "calcium ion binding" evidence=ISS] [GO:0042802 "identical protein
            binding" evidence=ISS] [GO:0071910 "determination of liver
            left/right asymmetry" evidence=IMP] [GO:0045944 "positive
            regulation of transcription from RNA polymerase II promoter"
            evidence=IDA;IMP] [GO:0042803 "protein homodimerization activity"
            evidence=IDA] [GO:0044325 "ion channel binding" evidence=IPI]
            [GO:0070588 "calcium ion transmembrane transport" evidence=IDA]
            [GO:0005244 "voltage-gated ion channel activity" evidence=IDA]
            [GO:0090279 "regulation of calcium ion import" evidence=IDA]
            [GO:0051209 "release of sequestered calcium ion into cytosol"
            evidence=IMP;IDA] [GO:0048763 "calcium-induced calcium release
            activity" evidence=IDA] [GO:0005783 "endoplasmic reticulum"
            evidence=IMP;IDA] [GO:0030027 "lamellipodium" evidence=IDA]
            [GO:0008092 "cytoskeletal protein binding" evidence=IDA]
            [GO:0009925 "basal plasma membrane" evidence=IDA] [GO:0005737
            "cytoplasm" evidence=IMP;IDA] [GO:0045180 "basal cortex"
            evidence=IDA] [GO:0072686 "mitotic spindle" evidence=IDA]
            [GO:0005886 "plasma membrane" evidence=IDA] [GO:0042805 "actinin
            binding" evidence=IDA] [GO:0031941 "filamentous actin"
            evidence=IDA] [GO:0071464 "cellular response to hydrostatic
            pressure" evidence=IDA] [GO:0071470 "cellular response to osmotic
            stress" evidence=IDA] [GO:0031587 "positive regulation of inositol
            1,4,5-trisphosphate-sensitive calcium-release channel activity"
            evidence=IMP] [GO:0005102 "receptor binding" evidence=IPI]
            [GO:0071158 "positive regulation of cell cycle arrest"
            evidence=IMP] [GO:2000134 "negative regulation of G1/S transition
            of mitotic cell cycle" evidence=IMP] [GO:0043398 "HLH domain
            binding" evidence=IPI] [GO:0042994 "cytoplasmic sequestering of
            transcription factor" evidence=IMP] [GO:0031659 "positive
            regulation of cyclin-dependent protein serine/threonine kinase
            activity involved in G1/S" evidence=IDA] [GO:0034614 "cellular
            response to reactive oxygen species" evidence=NAS] [GO:0008285
            "negative regulation of cell proliferation" evidence=NAS]
            [GO:0051298 "centrosome duplication" evidence=NAS] [GO:0071498
            "cellular response to fluid shear stress" evidence=IMP] [GO:0045429
            "positive regulation of nitric oxide biosynthetic process"
            evidence=IMP] [GO:0005887 "integral to plasma membrane"
            evidence=IDA] [GO:0071458 "integral to cytosolic side of
            endoplasmic reticulum membrane" evidence=IDA] [GO:0003127
            "detection of nodal flow" evidence=ISS] InterPro:IPR002048
            InterPro:IPR003915 InterPro:IPR011992 PRINTS:PR01433
            PROSITE:PS50222 Prosite:PS00018 GO:GO:0008285 GO:GO:0042803
            GO:GO:0007507 GO:GO:0071556 GO:GO:0005887 GO:GO:0071158
            GO:GO:0051298 GO:GO:0051209 GO:GO:0045944 GO:GO:0005509
            Gene3D:1.10.238.10 GO:GO:0001889 GO:GO:0007050 GO:GO:0045180
            GO:GO:0005911 GO:GO:0030027 GO:GO:0005267 GO:GO:0031659
            GO:GO:0071470 GO:GO:0034614 GO:GO:0045429 GO:GO:0005932
            GO:GO:0021510 GO:GO:0021915 GO:GO:0051117 GO:GO:0001658
            GO:GO:0009925 GO:GO:2000134 GO:GO:0001892 GO:GO:0005248
            GO:GO:0072686 GO:GO:0060315 GO:GO:0072075 GO:GO:0031513
            GO:GO:0061371 GO:GO:0005245 GO:GO:0042994 GO:GO:0035502
            GO:GO:0090279 GO:GO:0007259 GO:GO:0060674 GO:GO:0071464
            GO:GO:0042805 GO:GO:0003127 GO:GO:0031512 GO:GO:0030814
            GO:GO:0071498 GO:GO:0061333 GO:GO:0071458 CleanEx:HS_PKD2
            GO:GO:0072177 GO:GO:0072284 InterPro:IPR013122 Pfam:PF08016
            GO:GO:0050982 GO:GO:0072208 GO:GO:0044441 eggNOG:NOG325704
            HOGENOM:HOG000230858 HOVERGEN:HBG014945 Orphanet:730 GO:GO:0002133
            GO:GO:0072218 CTD:5311 KO:K04986 OMA:AWSRDNP OrthoDB:EOG473PQQ
            GO:GO:0048763 GO:GO:0035904 GO:GO:0072214 GO:GO:0072219
            GO:GO:0072235 GO:GO:0031587 GO:GO:0061441 EMBL:U50928 EMBL:AF004873
            EMBL:AF004859 EMBL:AF004860 EMBL:AF004861 EMBL:AF004862
            EMBL:AF004863 EMBL:AF004864 EMBL:AF004865 EMBL:AF004866
            EMBL:AF004867 EMBL:AF004868 EMBL:AF004869 EMBL:AF004870
            EMBL:AF004871 EMBL:AF004872 EMBL:BC112261 EMBL:BC112263 EMBL:U56813
            IPI:IPI00299040 PIR:G02640 RefSeq:NP_000288.1 UniGene:Hs.181272
            PDB:2KLD PDB:2KLE PDB:2KQ6 PDB:2Y4Q PDB:3HRN PDB:3HRO PDBsum:2KLD
            PDBsum:2KLE PDBsum:2KQ6 PDBsum:2Y4Q PDBsum:3HRN PDBsum:3HRO
            ProteinModelPortal:Q13563 SMR:Q13563 DIP:DIP-47455N
            MINT:MINT-6618167 STRING:Q13563 TCDB:1.A.5.2.1 PhosphoSite:Q13563
            DMDM:116242717 PaxDb:Q13563 PeptideAtlas:Q13563 PRIDE:Q13563
            DNASU:5311 Ensembl:ENST00000237596 GeneID:5311 KEGG:hsa:5311
            UCSC:uc003hre.3 GeneCards:GC04P088929 HGNC:HGNC:9009 HPA:CAB004544
            HPA:HPA015794 MIM:173910 MIM:613095 neXtProt:NX_Q13563
            PharmGKB:PA33343 InParanoid:Q13563 PhylomeDB:Q13563
            BindingDB:Q13563 ChEMBL:CHEMBL5465 ChiTaRS:PKD2
            EvolutionaryTrace:Q13563 GenomeRNAi:5311 NextBio:20536
            ArrayExpress:Q13563 Bgee:Q13563 Genevestigator:Q13563
            GermOnline:ENSG00000118762 Uniprot:Q13563
        Length = 968

 Score = 111 (44.1 bits), Expect = 3.1e-05, P = 3.1e-05
 Identities = 22/59 (37%), Positives = 32/59 (54%)

Query:    10 YNGGGYVKDLGSSESNMAQGLSQMIIHKWLDERTRVILIECSLYNPNINAIIAVSLMIE 68
             Y+G GY  DL  +    A  ++ +  + WLD  TR   I+ S+YN NIN    V L++E
Sbjct:   386 YSGAGYYLDLSRTREETAAQVASLKKNVWLDRGTRATFIDFSVYNANINLFCVVRLLVE 444


>ZFIN|ZDB-GENE-030616-558 [details] [associations]
            symbol:pkd2l1 "polycystic kidney disease 2-like 1"
            species:7955 "Danio rerio" [GO:0005509 "calcium ion binding"
            evidence=IEA] [GO:0016020 "membrane" evidence=IEA]
            InterPro:IPR002048 InterPro:IPR003915 InterPro:IPR011992
            PRINTS:PR01433 PROSITE:PS50222 ZFIN:ZDB-GENE-030616-558
            GO:GO:0016020 GO:GO:0005509 Gene3D:1.10.238.10 InterPro:IPR013122
            Pfam:PF08016 GeneTree:ENSGT00700000104221 EMBL:BX530079
            IPI:IPI00919687 Ensembl:ENSDART00000002415 Uniprot:F1QAN9
        Length = 805

 Score = 110 (43.8 bits), Expect = 3.2e-05, P = 3.2e-05
 Identities = 21/59 (35%), Positives = 34/59 (57%)

Query:    10 YNGGGYVKDLGSSESNMAQGLSQMIIHKWLDERTRVILIECSLYNPNINAIIAVSLMIE 68
             Y+G G+ +DL ++    A  L  +  + WLD  TRV+ I+ + YN NIN    + L++E
Sbjct:   272 YSGAGFYQDLTTTRDESAALLEDLRENLWLDRGTRVLFIDFTAYNANINLFCVIRLVVE 330


>UNIPROTKB|F1PHV2 [details] [associations]
            symbol:PKD1L3 "Uncharacterized protein" species:9615 "Canis
            lupus familiaris" [GO:0016021 "integral to membrane" evidence=IEA]
            [GO:0007218 "neuropeptide signaling pathway" evidence=IEA]
            [GO:0005509 "calcium ion binding" evidence=IEA] InterPro:IPR000203
            InterPro:IPR001024 InterPro:IPR003915 Pfam:PF01477 Pfam:PF01825
            PRINTS:PR01433 PROSITE:PS50095 PROSITE:PS50221 SMART:SM00303
            SMART:SM00308 GO:GO:0016021 GO:GO:0007218 GO:GO:0005509
            Gene3D:2.60.60.20 InterPro:IPR008976 SUPFAM:SSF49723
            InterPro:IPR013122 Pfam:PF08016 GeneTree:ENSGT00700000104402
            EMBL:AAEX03004090 OMA:CQVGPQS Ensembl:ENSCAFT00000032201
            Uniprot:F1PHV2
        Length = 1555

 Score = 113 (44.8 bits), Expect = 3.3e-05, P = 3.3e-05
 Identities = 23/68 (33%), Positives = 35/68 (51%)

Query:    10 YNGGGYVKDLGSSESNMAQGLSQMIIHKWLDERTRVILIECSLYNPNINAIIAVSLMIER 69
             Y+GGGYV  LG S S     L  +    WLD  T+ + +E  ++N N+N    V+L++E 
Sbjct:  1212 YSGGGYVVKLGRSSSTAISVLQHLEQSHWLDHCTKSLFVEFVVFNANVNLFCVVTLILES 1271

Query:    70 LGSHNYLT 77
                  + T
Sbjct:  1272 NNMGTFFT 1279


>UNIPROTKB|F1PGE3 [details] [associations]
            symbol:PKD2 "Uncharacterized protein" species:9615 "Canis
            lupus familiaris" [GO:0016020 "membrane" evidence=IEA] [GO:0005509
            "calcium ion binding" evidence=IEA] InterPro:IPR002048
            InterPro:IPR003915 InterPro:IPR011992 PRINTS:PR01433
            PROSITE:PS50222 GO:GO:0016020 GO:GO:0005509 Gene3D:1.10.238.10
            InterPro:IPR013122 Pfam:PF08016 GeneTree:ENSGT00700000104221
            OMA:AWSRDNP EMBL:AAEX03016749 Ensembl:ENSCAFT00000015243
            Uniprot:F1PGE3
        Length = 861

 Score = 110 (43.8 bits), Expect = 3.5e-05, P = 3.5e-05
 Identities = 21/59 (35%), Positives = 32/59 (54%)

Query:    10 YNGGGYVKDLGSSESNMAQGLSQMIIHKWLDERTRVILIECSLYNPNINAIIAVSLMIE 68
             Y+G GY  DL  +    A  ++ +  + WLD  TR   I+ S+YN NIN    + L++E
Sbjct:   279 YSGAGYYLDLSRTREETAAQVASLKKNVWLDRGTRATFIDFSVYNANINLFCVIRLLVE 337


>UNIPROTKB|D4A828 [details] [associations]
            symbol:Pkd2l2 "Protein Pkd2l2" species:10116 "Rattus
            norvegicus" [GO:0005509 "calcium ion binding" evidence=IEA]
            [GO:0016020 "membrane" evidence=IEA] InterPro:IPR003915
            PRINTS:PR01433 RGD:1310272 GO:GO:0016020 GO:GO:0005509
            EMBL:CH473974 InterPro:IPR013122 Pfam:PF08016 CTD:27039 KO:K04991
            OMA:KFMEGPL GeneTree:ENSGT00700000104221 OrthoDB:EOG4C5CJ2
            IPI:IPI00869785 RefSeq:NP_001099626.1 UniGene:Rn.207191
            Ensembl:ENSRNOT00000037690 GeneID:291683 KEGG:rno:291683
            NextBio:633013 Uniprot:D4A828
        Length = 621

 Score = 108 (43.1 bits), Expect = 3.8e-05, P = 3.8e-05
 Identities = 22/69 (31%), Positives = 35/69 (50%)

Query:     9 IYNGGGYVKDLGSSESNMAQGLSQMIIHKWLDERTRVILIECSLYNPNINAIIAVSLMIE 68
             +Y  GGY+  L  S+S     L+ +  + W+   TR + I+ SLYN N+N    + L+ E
Sbjct:   194 VYRDGGYMVTLSKSKSETKAKLADLRQNNWIGRGTRAVFIDFSLYNANVNLFCIIRLLAE 253

Query:    69 RLGSHNYLT 77
                +   LT
Sbjct:   254 FPATGGILT 262


>UNIPROTKB|E2RMB4 [details] [associations]
            symbol:PKD2L2 "Uncharacterized protein" species:9615 "Canis
            lupus familiaris" [GO:0016020 "membrane" evidence=IEA] [GO:0005509
            "calcium ion binding" evidence=IEA] InterPro:IPR003915
            PRINTS:PR01433 GO:GO:0016020 GO:GO:0005509 InterPro:IPR013122
            Pfam:PF08016 OMA:KFMEGPL GeneTree:ENSGT00700000104221
            EMBL:AAEX03007811 Ensembl:ENSCAFT00000001760 Uniprot:E2RMB4
        Length = 620

 Score = 106 (42.4 bits), Expect = 6.2e-05, P = 6.2e-05
 Identities = 20/60 (33%), Positives = 31/60 (51%)

Query:     9 IYNGGGYVKDLGSSESNMAQGLSQMIIHKWLDERTRVILIECSLYNPNINAIIAVSLMIE 68
             +Y  GG++  L  S+S        + ++ W+   TRVI I+ SLYN N+N    + L  E
Sbjct:   194 VYQNGGFIFTLSKSKSETKNKFVDLKLNSWITRGTRVIFIDFSLYNANVNLFCIIRLAAE 253


>MGI|MGI:1099818 [details] [associations]
            symbol:Pkd2 "polycystic kidney disease 2" species:10090 "Mus
            musculus" [GO:0001822 "kidney development" evidence=IGI;IMP]
            [GO:0001889 "liver development" evidence=IGI] [GO:0001892
            "embryonic placenta development" evidence=IMP] [GO:0001947 "heart
            looping" evidence=ISO] [GO:0002133 "polycystin complex"
            evidence=IDA] [GO:0003127 "detection of nodal flow" evidence=IMP]
            [GO:0005102 "receptor binding" evidence=ISO;IPI] [GO:0005216 "ion
            channel activity" evidence=IEA] [GO:0005244 "voltage-gated ion
            channel activity" evidence=ISO] [GO:0005245 "voltage-gated calcium
            channel activity" evidence=ISO] [GO:0005248 "voltage-gated sodium
            channel activity" evidence=ISO] [GO:0005262 "calcium channel
            activity" evidence=IDA;TAS] [GO:0005267 "potassium channel
            activity" evidence=IDA] [GO:0005509 "calcium ion binding"
            evidence=IDA] [GO:0005515 "protein binding" evidence=IPI]
            [GO:0005737 "cytoplasm" evidence=ISO;IDA] [GO:0005783 "endoplasmic
            reticulum" evidence=ISO;IDA;IMP;TAS] [GO:0005789 "endoplasmic
            reticulum membrane" evidence=ISO] [GO:0005886 "plasma membrane"
            evidence=ISO;IDA] [GO:0005887 "integral to plasma membrane"
            evidence=ISO] [GO:0005911 "cell-cell junction" evidence=IDA]
            [GO:0005929 "cilium" evidence=IDA] [GO:0005932 "microtubule basal
            body" evidence=ISO] [GO:0006810 "transport" evidence=IEA]
            [GO:0006811 "ion transport" evidence=IEA] [GO:0006816 "calcium ion
            transport" evidence=ISO;IMP] [GO:0006874 "cellular calcium ion
            homeostasis" evidence=IMP] [GO:0007050 "cell cycle arrest"
            evidence=IDA] [GO:0007259 "JAK-STAT cascade" evidence=IDA]
            [GO:0007368 "determination of left/right symmetry" evidence=IMP]
            [GO:0007507 "heart development" evidence=IMP] [GO:0008092
            "cytoskeletal protein binding" evidence=ISO] [GO:0009925 "basal
            plasma membrane" evidence=ISO] [GO:0010628 "positive regulation of
            gene expression" evidence=IMP] [GO:0015267 "channel activity"
            evidence=IMP] [GO:0016020 "membrane" evidence=IEA] [GO:0016021
            "integral to membrane" evidence=IEA] [GO:0022843 "voltage-gated
            cation channel activity" evidence=ISO] [GO:0030027 "lamellipodium"
            evidence=ISO] [GO:0030814 "regulation of cAMP metabolic process"
            evidence=IMP] [GO:0031512 "motile primary cilium" evidence=IDA]
            [GO:0031513 "nonmotile primary cilium" evidence=IDA] [GO:0031587
            "positive regulation of inositol 1,4,5-trisphosphate-sensitive
            calcium-release channel activity" evidence=ISO] [GO:0031659
            "positive regulation of cyclin-dependent protein serine/threonine
            kinase activity involved in G1/S" evidence=ISO] [GO:0035725 "sodium
            ion transmembrane transport" evidence=ISO] [GO:0042127 "regulation
            of cell proliferation" evidence=ISO] [GO:0042802 "identical protein
            binding" evidence=IPI] [GO:0042803 "protein homodimerization
            activity" evidence=ISO] [GO:0042805 "actinin binding" evidence=ISO]
            [GO:0042994 "cytoplasmic sequestering of transcription factor"
            evidence=ISO] [GO:0042995 "cell projection" evidence=IEA]
            [GO:0043398 "HLH domain binding" evidence=ISO] [GO:0044325 "ion
            channel binding" evidence=ISO] [GO:0044441 "cilium part"
            evidence=IMP] [GO:0045180 "basal cortex" evidence=ISO;IDA]
            [GO:0045429 "positive regulation of nitric oxide biosynthetic
            process" evidence=ISO;IMP] [GO:0045944 "positive regulation of
            transcription from RNA polymerase II promoter" evidence=ISO]
            [GO:0046872 "metal ion binding" evidence=IEA] [GO:0048763
            "calcium-induced calcium release activity" evidence=ISO]
            [GO:0050982 "detection of mechanical stimulus" evidence=IMP]
            [GO:0051117 "ATPase binding" evidence=IPI] [GO:0051209 "release of
            sequestered calcium ion into cytosol" evidence=ISO;IMP] [GO:0055085
            "transmembrane transport" evidence=IMP] [GO:0060315 "negative
            regulation of ryanodine-sensitive calcium-release channel activity"
            evidence=IDA] [GO:0060674 "placenta blood vessel development"
            evidence=IMP] [GO:0061333 "renal tubule morphogenesis"
            evidence=IMP] [GO:0070588 "calcium ion transmembrane transport"
            evidence=ISO;TAS] [GO:0071158 "positive regulation of cell cycle
            arrest" evidence=ISO] [GO:0071458 "integral to cytosolic side of
            endoplasmic reticulum membrane" evidence=ISO] [GO:0071464 "cellular
            response to hydrostatic pressure" evidence=ISO] [GO:0071470
            "cellular response to osmotic stress" evidence=ISO] [GO:0071498
            "cellular response to fluid shear stress" evidence=ISO;IMP]
            [GO:0071556 "integral to lumenal side of endoplasmic reticulum
            membrane" evidence=ISO] [GO:0071910 "determination of liver
            left/right asymmetry" evidence=ISO] [GO:0072001 "renal system
            development" evidence=IGI] [GO:0072686 "mitotic spindle"
            evidence=ISO;IDA] [GO:0090279 "regulation of calcium ion import"
            evidence=ISO] [GO:2000134 "negative regulation of G1/S transition
            of mitotic cell cycle" evidence=ISO] InterPro:IPR002048
            InterPro:IPR003915 InterPro:IPR011992 PRINTS:PR01433
            PROSITE:PS50222 Prosite:PS00018 MGI:MGI:1099818 GO:GO:0005783
            GO:GO:0005886 GO:GO:0007507 GO:GO:0071556 GO:GO:0005887
            GO:GO:0071158 GO:GO:0051209 GO:GO:0005262 GO:GO:0045944
            GO:GO:0005509 Gene3D:1.10.238.10 GO:GO:0001889 GO:GO:0007050
            GO:GO:0045180 GO:GO:0030027 GO:GO:0005267 GO:GO:0042127
            GO:GO:0001822 GO:GO:0031941 GO:GO:0031659 GO:GO:0071470
            GO:GO:0010628 GO:GO:0045429 GO:GO:0005932 GO:GO:0021510
            GO:GO:0021915 GO:GO:0001658 GO:GO:0009925 GO:GO:2000134
            GO:GO:0001892 GO:GO:0005248 GO:GO:0072686 GO:GO:0060315
            GO:GO:0072075 GO:GO:0031513 GO:GO:0061371 GO:GO:0005245
            GO:GO:0042994 GO:GO:0035502 GO:GO:0090279 GO:GO:0007259
            GO:GO:0060674 GO:GO:0071464 GO:GO:0003127 GO:GO:0031512
            GO:GO:0030814 GO:GO:0071498 GO:GO:0061333 GO:GO:0071458
            GO:GO:0072177 GO:GO:0072284 InterPro:IPR013122 Pfam:PF08016
            GO:GO:0050982 GO:GO:0072208 GO:GO:0044441 eggNOG:NOG325704
            HOGENOM:HOG000230858 HOVERGEN:HBG014945
            GeneTree:ENSGT00700000104221 GO:GO:0002133 GO:GO:0072218 CTD:5311
            KO:K04986 OMA:AWSRDNP OrthoDB:EOG473PQQ GO:GO:0048763 GO:GO:0035904
            GO:GO:0072214 GO:GO:0072219 GO:GO:0072235 GO:GO:0031587
            GO:GO:0061441 ChiTaRS:PKD2 EMBL:AF014010 EMBL:Y13278 EMBL:Y14105
            EMBL:Y14106 EMBL:Y14107 EMBL:Y14108 EMBL:Y14109 EMBL:Y14110
            EMBL:Y14111 EMBL:Y14112 EMBL:Y14113 EMBL:Y14114 EMBL:Y14115
            EMBL:Y14116 EMBL:Y14117 EMBL:Y14118 EMBL:Y14119 EMBL:Y14120
            EMBL:FJ609779 EMBL:AK053502 EMBL:AC123687 EMBL:AC124106
            EMBL:AF242389 IPI:IPI00314352 IPI:IPI00986374 RefSeq:NP_032887.3
            UniGene:Mm.483692 UniGene:Mm.6442 ProteinModelPortal:O35245
            SMR:O35245 STRING:O35245 PhosphoSite:O35245 PaxDb:O35245
            PRIDE:O35245 Ensembl:ENSMUST00000086831 GeneID:18764 KEGG:mmu:18764
            InParanoid:O35245 NextBio:294963 Bgee:O35245 CleanEx:MM_PKD2
            Genevestigator:O35245 GermOnline:ENSMUSG00000034462 Uniprot:O35245
        Length = 966

 Score = 107 (42.7 bits), Expect = 8.3e-05, P = 8.3e-05
 Identities = 23/59 (38%), Positives = 31/59 (52%)

Query:    10 YNGGGYVKDLGSSESNMAQGLSQMIIHKWLDERTRVILIECSLYNPNINAIIAVSLMIE 68
             Y+G GY  DL  +    A  L+ +  + WLD  TR   I+ S+YN NIN    V L+ E
Sbjct:   384 YSGAGYYLDLSRTREETAAQLAGLRRNFWLDRGTRAAFIDFSVYNANINLFCVVRLLAE 442


>RGD|1310272 [details] [associations]
            symbol:Pkd2l2 "polycystic kidney disease 2-like 2" species:10116
            "Rattus norvegicus" [GO:0005509 "calcium ion binding" evidence=IEA]
            [GO:0016020 "membrane" evidence=IEA] InterPro:IPR003915
            PRINTS:PR01433 RGD:1310272 GO:GO:0016020 GO:GO:0005509
            InterPro:IPR013122 Pfam:PF08016 IPI:IPI00776797
            Ensembl:ENSRNOT00000060864 UCSC:RGD:1310272 ArrayExpress:D4AC57
            Uniprot:D4AC57
        Length = 265

 Score = 98 (39.6 bits), Expect = 0.00012, P = 0.00012
 Identities = 18/50 (36%), Positives = 28/50 (56%)

Query:     9 IYNGGGYVKDLGSSESNMAQGLSQMIIHKWLDERTRVILIECSLYNPNIN 58
             +Y  GGY+  L  S+S     L+ +  + W+   TR + I+ SLYN N+N
Sbjct:   194 VYRDGGYMVTLSKSKSETKAKLADLRQNNWIGRGTRAVFIDFSLYNANVN 243


>UNIPROTKB|F1MAD3 [details] [associations]
            symbol:Pkd1 "Protein Pkd1" species:10116 "Rattus
            norvegicus" [GO:0007218 "neuropeptide signaling pathway"
            evidence=IEA] [GO:0016021 "integral to membrane" evidence=IEA]
            [GO:0030246 "carbohydrate binding" evidence=IEA] InterPro:IPR001611
            InterPro:IPR000203 InterPro:IPR000434 InterPro:IPR001024
            InterPro:IPR001304 Pfam:PF00059 Pfam:PF01477 Pfam:PF01825
            PRINTS:PR00500 PROSITE:PS50041 PROSITE:PS50095 PROSITE:PS50221
            PROSITE:PS51450 SMART:SM00034 SMART:SM00303 SMART:SM00308
            InterPro:IPR002889 GO:GO:0016021 GO:GO:0005634 GO:GO:0005737
            GO:GO:0043588 GO:GO:0007507 GO:GO:0032092 GO:GO:0030246
            GO:GO:0007218 Gene3D:3.10.100.10 InterPro:IPR016186
            InterPro:IPR016187 SUPFAM:SSF56436 GO:GO:0045944 InterPro:IPR000483
            InterPro:IPR003591 SMART:SM00369 SMART:SM00082 GO:GO:0016323
            GO:GO:0007050 GO:GO:0018105 GO:GO:0048806 GO:GO:0005261
            GO:GO:0006816 GO:GO:0031659 GO:GO:0021510 GO:GO:0021915
            InterPro:IPR000372 SMART:SM00013 GO:GO:0001502 GO:GO:0048565
            GO:GO:0006611 GO:GO:0072205 GO:GO:0001892 GO:GO:0048754
            GO:GO:0042994 GO:GO:0007259 GO:GO:0060674 GO:GO:0031512
            Gene3D:2.60.60.20 InterPro:IPR008976 SUPFAM:SSF49723 GO:GO:0060428
            Gene3D:2.60.40.670 InterPro:IPR022409 InterPro:IPR000601
            Pfam:PF00801 SMART:SM00089 SUPFAM:SSF49299 PROSITE:PS50093
            InterPro:IPR002859 Pfam:PF02010 Pfam:PF01822 PROSITE:PS51212
            GO:GO:0072177 InterPro:IPR013122 Pfam:PF08016 GO:GO:0050982
            InterPro:IPR014010 PROSITE:PS51111 GeneTree:ENSGT00700000104402
            GO:GO:0002133 GO:GO:0072218 GO:GO:0072287 GO:GO:0072237
            InterPro:IPR006228 InterPro:IPR013994 SMART:SM00321
            TIGRFAMs:TIGR00864 IPI:IPI00191485 Ensembl:ENSRNOT00000015092
            Uniprot:F1MAD3
        Length = 4292

 Score = 112 (44.5 bits), Expect = 0.00012, P = 0.00012
 Identities = 20/60 (33%), Positives = 34/60 (56%)

Query:     9 IYNGGGYVKDLGSSESNMAQGLSQMIIHKWLDERTRVILIECSLYNPNINAIIAVSLMIE 68
             +Y+ GGY+++LG S       L  + +H WLD R   + +E + Y+P +    AV+L +E
Sbjct:  3802 VYDSGGYIQELGLSLEESRARLGFLQLHNWLDSRWXAVFVELTRYSPAVGLHAAVTLRLE 3861


>UNIPROTKB|F1NE51 [details] [associations]
            symbol:PKD2L2 "Uncharacterized protein" species:9031
            "Gallus gallus" [GO:0005509 "calcium ion binding" evidence=IEA]
            [GO:0016020 "membrane" evidence=IEA] InterPro:IPR003915
            PRINTS:PR01433 GO:GO:0016020 GO:GO:0005509 InterPro:IPR013122
            Pfam:PF08016 GeneTree:ENSGT00700000104221 OMA:WLDMLLI
            EMBL:AADN02028480 IPI:IPI00598816 Ensembl:ENSGALT00000009875
            Uniprot:F1NE51
        Length = 603

 Score = 96 (38.9 bits), Expect = 0.00070, P = 0.00070
 Identities = 20/72 (27%), Positives = 36/72 (50%)

Query:    10 YNGGGYVKDLGSSESNMAQGLSQMIIHKWLDERTRVILIECSLYNPNINAIIAVSLMIER 69
             Y  GG++  L  S+    + L+ +  + W+   TR + I+ S +N NIN    V L++E 
Sbjct:   177 YRSGGFIVTLPRSKQESMEKLASLRKNGWITHGTRAVFIDFSTFNANINLFCIVRLVVEF 236

Query:    70 LGSHNYLTDSEV 81
               +   LT  ++
Sbjct:   237 PATGGALTSFQI 248


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.316   0.135   0.385    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0       89        89   0.00091  102 3  11 22  0.36    30
                                                     29  0.50    30


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  44
  No. of states in DFA:  534 (57 KB)
  Total size of DFA:  103 KB (2071 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  8.62u 0.15s 8.77t   Elapsed:  00:00:00
  Total cpu time:  8.62u 0.15s 8.77t   Elapsed:  00:00:00
  Start:  Thu Aug 15 17:21:10 2013   End:  Thu Aug 15 17:21:10 2013
the Gene Ontology

BLAST Results

Query Summary

Query Sequence

High Scoring Gene Products

Raw Blast Data


Symbol, full name	Information	P value
BLAST match view associations BLAST with E1C6F6 E1C6F6 E1C6F6 Uncharacterized protein	protein from Gallus gallus	7.3e-08
BLAST match view associations BLAST with Pkd1l3 Pkd1l3 Pkd1l3 polycystic kidney disease 1 like 3	protein from Mus musculus	2.2e-07
BLAST match view associations BLAST with Gga.19764 Gga.19764 Gga.19764 Uncharacterized protein	protein from Gallus gallus	5.7e-07
BLAST match view associations BLAST with PKD2L1 PKD2L1 PKD2L1 Polycystic kidney disease 2-like 1 protein	protein from Homo sapiens	8.0e-07
BLAST match view associations BLAST with PKD2L1 PKD2L1 PKD2L1 Uncharacterized protein	protein from Canis lupus familiaris	8.0e-07
BLAST match view associations BLAST with F1MLH0 F1MLH0 F1MLH0 Uncharacterized protein	protein from Bos taurus	8.5e-07
BLAST match view associations BLAST with Pkd1l2 Pkd1l2 Pkd1l2 polycystic kidney disease 1 like 2	protein from Mus musculus	8.5e-07
BLAST match view associations BLAST with pkd2 pkd2 pkd2 polycystic kidney disease 2	gene_product from Danio rerio	1.2e-06
BLAST match view associations BLAST with Pkd2l1 Pkd2l1 Pkd2l1 polycystic kidney disease 2-like 1	gene from Rattus norvegicus	1.6e-06
BLAST match view associations BLAST with PKD2 PKD2 PKD2 Uncharacterized protein	protein from Sus scrofa	1.6e-06
BLAST match view associations BLAST with PKD2L1 PKD2L1 PKD2L1 Uncharacterized protein	protein from Gallus gallus	1.8e-06
BLAST match view associations BLAST with PKD1L2 PKD1L2 PKD1L2 Uncharacterized protein	protein from Canis lupus familiaris	2.2e-06
BLAST match view associations BLAST with PKD2L1 PKD2L1 PKD2L1 Uncharacterized protein	protein from Bos taurus	3.3e-06
BLAST match view associations BLAST with PKD2L1 PKD2L1 PKD2L1 Uncharacterized protein	protein from Sus scrofa	3.5e-06
BLAST match view associations BLAST with PKD1L2 PKD1L2 PKD1L2 Polycystic kidney disease protein 1-like 2	protein from Homo sapiens	3.7e-06
BLAST match view associations BLAST with Pkd1l3 Pkd1l3 Pkd1l3 polycystic kidney disease 1-like 3	gene from Rattus norvegicus	4.0e-06
BLAST match view associations BLAST with LOC504986 LOC504986 LOC504986 Uncharacterized protein	protein from Bos taurus	5.2e-06
BLAST match view associations BLAST with PKD1 PKD1 PKD1 Uncharacterized protein	protein from Sus scrofa	5.2e-06
BLAST match view associations BLAST with pkd-2 pkd-2 pkd-2	gene from Caenorhabditis elegans	6.3e-06
BLAST match view associations BLAST with pkd-2 pkd-2 pkd-2 Polycystin-2	protein from Caenorhabditis elegans	6.3e-06
BLAST match view associations BLAST with PKD1 PKD1 PKD1 Uncharacterized protein	protein from Canis lupus familiaris	6.5e-06
BLAST match view associations BLAST with lov-1 lov-1 lov-1	gene from Caenorhabditis elegans	1.0e-05
BLAST match view associations BLAST with lov-1 lov-1 lov-1 Location of vulva defective 1	protein from Caenorhabditis elegans	1.0e-05
BLAST match view associations BLAST with PKD2L2 PKD2L2 PKD2L2 Polycystic kidney disease 2-like 2 protein	protein from Homo sapiens	1.1e-05
BLAST match view associations BLAST with Pkd1 Pkd1 Pkd1 polycystic kidney disease 1 homolog (human)	gene from Rattus norvegicus	1.4e-05
BLAST match view associations BLAST with Pkd1 Pkd1 Pkd1 polycystic kidney disease 1 homolog	protein from Mus musculus	1.4e-05
BLAST match view associations BLAST with PKD1 PKD1 PKD1 Polycystin-1	protein from Homo sapiens	1.4e-05
BLAST match view associations BLAST with PKD2 PKD2 PKD2 Polycystin-2	protein from Bos taurus	1.9e-05
BLAST match view associations BLAST with PKD2 PKD2 PKD2 Uncharacterized protein	protein from Gallus gallus	2.3e-05
BLAST match view associations BLAST with PKD2L2 PKD2L2 PKD2L2 Uncharacterized protein	protein from Bos taurus	2.8e-05
BLAST match view associations BLAST with Pkd2l2 Pkd2l2 Pkd2l2 polycystic kidney disease 2-like 2	protein from Mus musculus	2.9e-05
BLAST match view associations BLAST with Pkd2 Pkd2 Pkd2 polycystic kidney disease 2 (autosomal dominant)	gene from Rattus norvegicus	3.1e-05
BLAST match view associations BLAST with PKD2 PKD2 PKD2 Polycystin-2	protein from Homo sapiens	3.1e-05
BLAST match view associations BLAST with pkd2l1 pkd2l1 pkd2l1 polycystic kidney disease 2-like 1	gene_product from Danio rerio	3.2e-05
BLAST match view associations BLAST with PKD1L3 PKD1L3 PKD1L3 Uncharacterized protein	protein from Canis lupus familiaris	3.3e-05
BLAST match view associations BLAST with PKD2 PKD2 PKD2 Uncharacterized protein	protein from Canis lupus familiaris	3.5e-05
BLAST match view associations BLAST with PKD2L2 PKD2L2 PKD2L2 Uncharacterized protein	protein from Canis lupus familiaris	6.2e-05
BLAST match view associations BLAST with Pkd2 Pkd2 Pkd2 polycystic kidney disease 2	protein from Mus musculus	8.3e-05
BLAST match view associations BLAST with Pkd2l2 Pkd2l2 Pkd2l2 polycystic kidney disease 2-like 2	gene from Rattus norvegicus	0.00012
BLAST match view associations BLAST with PKD2L2 PKD2L2 PKD2L2 Uncharacterized protein	protein from Gallus gallus	0.00070