Diaphorina citri psyllid: psy11147

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------28

MKPEPPRPPLIRPWVPTRTMEVQRTAGVSTTDLVGRMLSMTSQHNASDVARPYERKARSPYTTCSSQFLLTTEKIRQFSEGRQPKPTDRIVYVDGAYDLFHPGHLDFLEKAKQAGDYLIVGIHPDHVVAWYKGYGYPIMNLHERVLSVLACKYVDEVVIGAPYTITADMLSQLRVDIVCRGLAAVLPDETGRDPYSEAKKLGKFKLIDSGNTTTTEKIVDRIVFHRLEFERRNFEKENKEMKLIELIESSKTGATGMVGATTYATRHTLKATNCNVRPS

cccccccccccccccccccEEEEcccccHHHHHHHccccccccccccccccHHHHHcccccccccccccccHHHHHHHHcccccccccEEEEEccccccccHHHHHHHHHHHHcccEEEEEEcccHHHHHHcccccccccHHHHHHHHHccccccEEECcccccccHHHHHHccccEEEEccccccccccccccHHHHHHccCEEEEcccccccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHccccccccccc

*****PR***IRPWVPTRTMEVQRTAGVSTTDLVGRMLSMTS*********************CSSQFLLTTEKIRQF****QPKPTDRIVYVDGAYDLFHPGHLDFLEKAKQAGDYLIVGIHPDHVVAWYKGYGYPIMNLHERVLSVLACKYVDEVVIGAPYTITADMLSQLRVDIVCRGLAAVLPDETGRDPYSEAKKLGKFKLIDSGNTTTTEKIVDRIVFHRLEFERRNFE*****MKLIELIE****GATGMVGATTYATRHTL**********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Ethanolamine-phosphate cytidylyltransferase	Plays an important role in the biosynthesis of the phospholipid phosphatidylethanolamine. Catalyzes the formation of CDP-ethanolamine.	confident	Q55BZ4
Ethanolamine-phosphate cytidylyltransferase	Plays an important role in the biosynthesis of the phospholipid phosphatidylethanolamine. Catalyzes the formation of CDP-ethanolamine.	confident	Q5EA75
Ethanolamine-phosphate cytidylyltransferase	Plays an important role in the biosynthesis of the phospholipid phosphatidylethanolamine. Catalyzes the formation of CDP-ethanolamine.	confident	Q99447

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0045335 [CC]	phagocytic vesicle	probable	GO:0005737, GO:0005575, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0030139, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0004306 [MF]	ethanolamine-phosphate cytidylyltransferase activity	probable	GO:0016779, GO:0003824, GO:0016772, GO:0070567, GO:0016740, GO:0003674
GO:0044425 [CC]	membrane part	probable	GO:0005575, GO:0016020
GO:0012505 [CC]	endomembrane system	probable	GO:0005575, GO:0044464, GO:0005623
GO:0031090 [CC]	organelle membrane	probable	GO:0005575, GO:0016020, GO:0043227, GO:0043226, GO:0044422
GO:0044446 [CC]	intracellular organelle part	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0006657 [BP]	CDP-choline pathway	probable	GO:0006656, GO:0006650, GO:0044249, GO:0034641, GO:0006807, GO:0044281, GO:0044283, GO:0044255, GO:1901576, GO:0044710, GO:0044711, GO:0008150, GO:0071704, GO:0006644, GO:0006629, GO:0009308, GO:0045017, GO:0046165, GO:0009987, GO:0044106, GO:0009058, GO:0042439, GO:0008152, GO:0046486, GO:0090407, GO:0008610, GO:0044238, GO:1901564, GO:0006576, GO:1901566, GO:0008654, GO:0044237, GO:0046470, GO:0006066, GO:0006796, GO:0006793, GO:0019637, GO:0046474, GO:1901617, GO:1901615

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
2.-.-.-	Transferases.	probable
2.7.-.-	Transferring phosphorous-containing groups.	probable
2.7.7.-	Nucleotidyltransferases.	probable
2.7.7.14	Ethanolamine-phosphate cytidylyltransferase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3ELB, chain A
Confidence level:very confident
Coverage over the Query: 5-38,61-224
View the alignment between query and template
View the model in PyMOL

Template: 3ELB, chain A
Confidence level:very confident
Coverage over the Query: 87-223,263-275
View the alignment between query and template
View the model in PyMOL