Query         psy11155
Match_columns 101
No_of_seqs    102 out of 594
Neff          5.4 
Searched_HMMs 46136
Date          Fri Aug 16 19:23:29 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy11155.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/11155hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2408|consensus               99.5 1.2E-14 2.7E-19  125.1   3.1   64   31-94    447-511 (719)
  2 PF03098 An_peroxidase:  Animal  99.4 5.8E-14 1.3E-18  116.4   4.0   66   28-94    284-350 (530)
  3 PLN02283 alpha-dioxygenase      98.0 8.6E-06 1.9E-10   70.1   4.4   38   34-73    361-398 (633)
  4 PF15502 MPLKIP:  M-phase-speci  78.1    0.92   2E-05   32.6   0.7   17   84-100   117-133 (151)
  5 COG2978 AbgT Putative p-aminob  20.3      57  0.0012   28.2   1.3   18   45-62    432-449 (516)
  6 COG1036 Archaeal flavoproteins  16.8      77  0.0017   23.9   1.2   28   40-67     93-120 (187)
  7 PF02044 Bombesin:  Bombesin-li  16.3      51  0.0011   14.9   0.1    8    7-14      6-13  (14)
  8 PF08998 Epsilon_antitox:  Bact  15.6 1.1E+02  0.0023   20.6   1.5   29   42-70      9-38  (89)
  9 PF14698 ASL_C2:  Argininosucci  15.5      45 0.00098   20.7  -0.3   23   52-74     16-38  (70)
 10 PF02772 S-AdoMet_synt_M:  S-ad  12.4      95  0.0021   21.7   0.6   19    1-19     23-41  (120)

No 1  
>KOG2408|consensus
Probab=99.49  E-value=1.2e-14  Score=125.13  Aligned_cols=64  Identities=42%  Similarity=0.673  Sum_probs=57.8

Q ss_pred             cCCCCCCCCCCCCchhHHHHHHHHHHHhhhhcccccccCCCCCcccCC-ccchhhcccChhhhhh
Q psy11155         31 KVFFDGYNPNIAADISNVFATVALRFGHTLINPILTRLNENYTTIPEV-NISWLKWIQPVQMFLS   94 (101)
Q Consensus        31 ~g~~~gYd~~vdPsIsneFatAAfRfgHSlI~~~i~~~~~~~~~~~~~-~i~L~d~ff~P~~l~~   94 (101)
                      .|+|.|||++|||+|+||||+||||||||||++.+.++++++++.... .+.+.+.||+|..+..
T Consensus       447 ~g~~~gY~~~~dp~IsneFataAfRfgHsli~~~~~~l~~~~~~~~~~~~l~~~~~~~~~~~i~~  511 (719)
T KOG2408|consen  447 LGGYRGYDPNVDPTISNEFATAAFRFGHSLIPPFFQRLDENFQPIGEVVNLPLHDAFFNPWLILN  511 (719)
T ss_pred             CccccCcCCCCChhhhhhhhHHHHhhhcccCchhhhhhcccCcccccccCchhhhhhcchhhhhh
Confidence            589999999999999999999999999999999999999999986432 7889999998887765


No 2  
>PF03098 An_peroxidase:  Animal haem peroxidase;  InterPro: IPR002007 Peroxidases are haem-containing enzymes that use hydrogen peroxide as the electron acceptor to catalyse a number of oxidative reactions. Peroxidases are found in bacteria, fungi, plants and animals. On the basis of sequence similarity, a number of animal haem peroxidases can be categorised as members of a superfamily: myeloperoxidase (MPO); eosinophil peroxidase (EPO); lactoperoxidase (LPO); thyroid peroxidase (TPO); prostaglandin H synthase (PGHS); and peroxidasin [, , ].  MPO plays a major role in the oxygen-dependent microbicidal system of neutrophils. EPO from eosinophilic granulocytes participates in immunological reactions, and potentiates tumor necrosis factor (TNF) production and hydrogen peroxide release by human monocyte-derived macrophages [, ]. In the main, MPO (and possibly EPO) utilises Cl-ions and H2O2 to form hypochlorous acid (HOCl), which can effectively kill bacteria or parasites. In secreted fluids, LPO catalyses the oxidation of thiocyanate ions (SCN-) by H2O2, producing the weak oxidising agent hypothiocyanite (OSCN-), which has bacteriostatic activity []. TPO uses I- ions and H2O2 to generate iodine, and plays a central role in the biosynthesis of thyroid hormones T(3) and T(4).  To date, the 3D structures of MPO and PGHS have been reported. MPO is a homodimer: each monomer consists of a light (A or B) and a heavy (C or D) chain resulting from post-translational excision of 6 residues from the common precursor. Monomers are linked by a single inter-chain disulphide. Each monomer includes a bound calcium ion []. PGHS exists as a symmetric dimer, each monomer of which consists of 3 domains: an N-terminal epidermal growth factor (EGF) like module; a membrane-binding domain; and a large C-terminal catalytic domain containing the cyclooxygenase and the peroxidase active sites. The catalytic domain shows striking structural similarity to MPO. The cyclooxygenase active site, which catalyses the formation of prostaglandin G2 (PGG2) from arachidonic acid, resides at the apex of a long hydrophobic channel, extending from the membrane-binding domain to the centre of the molecule. The peroxidase active site, which catalyses the reduction of PGG2 to PGH2, is located on the other side of the molecule, at the haem binding site []. Both MPO and the catalytic domain of PGHS are mainly alpha-helical, 19 helices being identified as topologically and spatially equivalent; PGHS contains 5 additional N-terminal helices that have no equivalent in MPO. In both proteins, three Asn residues in each monomer are glycosylated.; GO: 0004601 peroxidase activity, 0020037 heme binding, 0006979 response to oxidative stress, 0055114 oxidation-reduction process; PDB: 1FE2_A 1PGG_B 1PGF_A 3N8W_B 1IGZ_A 3KK6_B 3N8Z_A 1Q4G_A 1PTH_A 1EQH_A ....
Probab=99.44  E-value=5.8e-14  Score=116.42  Aligned_cols=66  Identities=30%  Similarity=0.567  Sum_probs=47.7

Q ss_pred             ccccCCCCCCCCCCCCchhHHHHHHHHHHHhhhhcccccccCCCCCcccCCccchhhcccChh-hhhh
Q psy11155         28 EHQKVFFDGYNPNIAADISNVFATVALRFGHTLINPILTRLNENYTTIPEVNISWLKWIQPVQ-MFLS   94 (101)
Q Consensus        28 ~~~~g~~~gYd~~vdPsIsneFatAAfRfgHSlI~~~i~~~~~~~~~~~~~~i~L~d~ff~P~-~l~~   94 (101)
                      ....+++.+|+++++|+|+||||+||||||||||++.+.+.++++.. ..+.++|.|.|++|. .+..
T Consensus       284 ~~~~g~~~~y~~~~~~~i~~EFa~aA~RfgHs~i~~~~~~~~~~~~~-~~~~~~L~d~f~~~~~~~~~  350 (530)
T PF03098_consen  284 PLNNGYYKGYDPSVDPSISNEFAAAAYRFGHSMIPDTYDRWDENFEI-PEPSLPLSDAFFNPSNRLLE  350 (530)
T ss_dssp             ----GCGTTS-TTS--S-BTTH-HHHGGGGGGGS-SEEEEBTTTSBE-TTSEEEGGGGBT-HH-HHHT
T ss_pred             ccccccccCCCCCCCCchhHHHHHHHHHhhheeehhhhhhccccCCc-ccccccccccccCcchhhhh
Confidence            44556899999999999999999999999999999999999988832 236899999999999 4443


No 3  
>PLN02283 alpha-dioxygenase
Probab=97.96  E-value=8.6e-06  Score=70.08  Aligned_cols=38  Identities=18%  Similarity=0.222  Sum_probs=30.4

Q ss_pred             CCCCCCCCCCchhHHHHHHHHHHHhhhhcccccccCCCCC
Q psy11155         34 FDGYNPNIAADISNVFATVALRFGHTLINPILTRLNENYT   73 (101)
Q Consensus        34 ~~gYd~~vdPsIsneFatAAfRfgHSlI~~~i~~~~~~~~   73 (101)
                      ...+++.|+++|+||| +||||| ||+|++.+.+.+...+
T Consensus       361 ~~~~~~~v~~~is~EF-~aaYR~-Hslip~~~~~~~~~~~  398 (633)
T PLN02283        361 KKPNNHGVPYSLTEEF-TSVYRM-HSLLPDHLILRDITAA  398 (633)
T ss_pred             CccccCCCCcchhHHH-HHHHhh-hhcCCCceeccccccc
Confidence            3345567889999999 579998 9999999888776543


No 4  
>PF15502 MPLKIP:  M-phase-specific PLK1-interacting protein
Probab=78.14  E-value=0.92  Score=32.62  Aligned_cols=17  Identities=12%  Similarity=0.178  Sum_probs=15.1

Q ss_pred             hcccChhhhhhhhhhhc
Q psy11155         84 KWIQPVQMFLSSWVECM  100 (101)
Q Consensus        84 d~ff~P~~l~~~w~~~~  100 (101)
                      +.|++|..|++||+.|+
T Consensus       117 e~Yy~pSMLEDPW~~L~  133 (151)
T PF15502_consen  117 EQYYHPSMLEDPWAHLE  133 (151)
T ss_pred             HHhcCHHhhhChHHHhh
Confidence            56899999999999876


No 5  
>COG2978 AbgT Putative p-aminobenzoyl-glutamate transporter [Coenzyme metabolism]
Probab=20.27  E-value=57  Score=28.20  Aligned_cols=18  Identities=33%  Similarity=0.519  Sum_probs=14.9

Q ss_pred             hhHHHHHHHHHHHhhhhc
Q psy11155         45 ISNVFATVALRFGHTLIN   62 (101)
Q Consensus        45 IsneFatAAfRfgHSlI~   62 (101)
                      .+.||+.||||.|.|...
T Consensus       432 ysPe~tQaayRigDS~tn  449 (516)
T COG2978         432 YSPEFTQAAYRIGDSVTN  449 (516)
T ss_pred             CCHHHHHHHHHhcccccc
Confidence            456999999999998653


No 6  
>COG1036 Archaeal flavoproteins [Energy production and conversion]
Probab=16.81  E-value=77  Score=23.89  Aligned_cols=28  Identities=25%  Similarity=0.349  Sum_probs=24.3

Q ss_pred             CCCCchhHHHHHHHHHHHhhhhcccccc
Q psy11155         40 NIAADISNVFATVALRFGHTLINPILTR   67 (101)
Q Consensus        40 ~vdPsIsneFatAAfRfgHSlI~~~i~~   67 (101)
                      -|.|+++|..|-.|++++.|++...+-.
T Consensus        93 lvaPaTsNTvAKIa~GIADtLVTNAVaq  120 (187)
T COG1036          93 LVAPATSNTVAKIAYGIADTLVTNAVAQ  120 (187)
T ss_pred             EEcccccchHHHHHhhhHHHHHHHHHHH
Confidence            3899999999999999999999865544


No 7  
>PF02044 Bombesin:  Bombesin-like peptide;  InterPro: IPR000874 Bombesin-like peptides comprise a large family of peptides which were initially isolated from amphibian skin, where they stimulate smooth muscle contraction. They were later found to be widely distributed in mammalian neural and endocrine cells. The amphibian peptides which belong to this family are currently classified into three subfamilies [, ]; the Bombesin group, which includes bombesin and alytesin; the Ranatensin group, which includes ranatensins, litorin, and Rohdei litorin; and the Phyllolitorin group, which includes Leu(8)- and Phe(8)-phyllolitorins. In mammals and birds two categories of bombesin-like peptides are known [, ], gastrin-releasing peptide (GRP), which stimulates the release of gastrin as well as other gastrointestinal hormones, and neuromedin B (NMB), a neuropeptide whose function is not yet clear. Bombesin-like peptides, like many other active peptides, are synthesized as larger protein precursors that are enzymatically converted to their mature forms. The final peptides are eight to fourteen residues long.; GO: 0007218 neuropeptide signaling pathway; PDB: 1C9A_A 1C98_A.
Probab=16.29  E-value=51  Score=14.95  Aligned_cols=8  Identities=63%  Similarity=0.875  Sum_probs=3.0

Q ss_pred             HHhhhhhh
Q psy11155          7 VTHQMGEK   14 (101)
Q Consensus         7 ~~~~~~~~   14 (101)
                      ++|-||.|
T Consensus         6 vGh~Mgkk   13 (14)
T PF02044_consen    6 VGHFMGKK   13 (14)
T ss_dssp             HHCT----
T ss_pred             eeeeeccC
Confidence            67888865


No 8  
>PF08998 Epsilon_antitox:  Bacterial epsilon antitoxin;  InterPro: IPR015090 The epsilon antitoxin, produced by various prokaryotes, forms part of a post-segregational killing system, which is involved in the initiation of programmed cell death of plasmid-free cells. The protein is folded into a three-helix bundle that directly interacts with the zeta toxin, inactivating it []. ; GO: 0015643 toxin binding, 0009636 response to toxin, 0031342 negative regulation of cell killing; PDB: 1GVN_C 3Q8X_C.
Probab=15.56  E-value=1.1e+02  Score=20.58  Aligned_cols=29  Identities=21%  Similarity=0.282  Sum_probs=16.7

Q ss_pred             CCchhHHHHHHHH-HHHhhhhcccccccCC
Q psy11155         42 AADISNVFATVAL-RFGHTLINPILTRLNE   70 (101)
Q Consensus        42 dPsIsneFatAAf-RfgHSlI~~~i~~~~~   70 (101)
                      .-.|.|||+++.| |...-.+...+..-|+
T Consensus         9 kiEilnEfs~~vy~rvlnyVlnheldk~ds   38 (89)
T PF08998_consen    9 KIEILNEFSSSVYNRVLNYVLNHELDKNDS   38 (89)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHTT--TT-T
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhhhcccccc
Confidence            3458999998887 5544455555554443


No 9  
>PF14698 ASL_C2:  Argininosuccinate lyase C-terminal; PDB: 1XWO_A 2E9F_A 1TJW_C 1TJU_A 1DCN_B 1K7W_B 1HY1_C 1TJV_B 1AUW_A 1U15_B ....
Probab=15.50  E-value=45  Score=20.72  Aligned_cols=23  Identities=13%  Similarity=0.297  Sum_probs=15.6

Q ss_pred             HHHHHHhhhhcccccccCCCCCc
Q psy11155         52 VALRFGHTLINPILTRLNENYTT   74 (101)
Q Consensus        52 AAfRfgHSlI~~~i~~~~~~~~~   74 (101)
                      .-||=.|-.+...+....+.+..
T Consensus        16 ipFR~AH~iVg~~V~~a~~~~~~   38 (70)
T PF14698_consen   16 IPFREAHHIVGRLVRLAEEEGKP   38 (70)
T ss_dssp             S-HHHHHHHHHHHHHHHHHTTS-
T ss_pred             CCHHHHHHHHHHHHHHHHHcCCC
Confidence            35899999998888765555444


No 10 
>PF02772 S-AdoMet_synt_M:  S-adenosylmethionine synthetase, central domain;  InterPro: IPR022629  The three domains of S-adenosylmethionine synthetase have the same alpha+beta fold. This entry represents the central domain and is found in association with PF00438 from PFAM and PF02773 from PFAM. S-adenosylmethionine synthetase (MAT, 2.5.1.6 from EC) is the enzyme that catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP []. AdoMet is an important methyl donor for transmethylation and is also the propylamino donor in polyamine biosynthesis. In bacteria there is a single isoform of AdoMet synthetase (gene metK), there are two in budding yeast (genes SAM1 and SAM2) and in mammals while in plants there is generally a multigene family. The sequence of AdoMet synthetase is highly conserved throughout isozymes and species. The active sites of both the Escherichia coli and rat liver MAT reside between two subunits, with contributions from side chains of residues from both subunits, resulting in a dimer as the minimal catalytic entity. The side chains that contribute to the ligand binding sites are conserved between the two proteins. In the structures of complexes with the E. coli enzyme, the phosphate groups have the same positions in the (PPi plus Pi) complex and the (ADP plus Pi) complex, and are located at the bottom of a deep cavity with the adenosyl group nearer the entrance []; GO: 0004478 methionine adenosyltransferase activity; PDB: 3S82_B 2OBV_A 3RV2_A 1FUG_A 1RG9_D 1XRA_A 1P7L_C 1XRB_A 1MXA_A 1MXB_A ....
Probab=12.43  E-value=95  Score=21.67  Aligned_cols=19  Identities=21%  Similarity=0.567  Sum_probs=14.9

Q ss_pred             CCcchhHHhhhhhhhccCC
Q psy11155          1 MPIPQYVTHQMGEKRHNSS   19 (101)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~   19 (101)
                      ||+|-+|.|.+..++...+
T Consensus        23 MPl~i~lAh~L~~~l~~~R   41 (120)
T PF02772_consen   23 MPLPIVLAHRLARRLAEVR   41 (120)
T ss_dssp             S-HHHHHHHHHHHHHHHHH
T ss_pred             CChHHHHHHHHHHHHHHHH
Confidence            8999999999999884333


Done!