Diaphorina citri psyllid: psy11155


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-
MPIPQYVTHQMGEKRHNSSHFGAGSIQEHQKVFFDGYNPNIAADISNVFATVALRFGHTLINPILTRLNENYTTIPEVNISWLKWIQPVQMFLSSWVECMS
ccccCEEEEccccccccccccccHHHHHHHccccccccccccccHHHHHHHHHHHHHHHccccHHHHcccccccccccccccHHHccccccccccHHHHcc
MPIPQYVTHQMGEKRHNSSHFGAGSIQEHQKVFFDGYNPNIAADISNVFATVALRFGHTLINPILTRLNENYTTIPEVNISWLKWIQPVQMFLSSWVECM*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPIPQYVTHQMGEKRHNSSHFGAGSIQEHQKVFFDGYNPNIAADISNVFATVALRFGHTLINPILTRLNENYTTIPEVNISWLKWIQPVQMFLSSWVECMS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peroxidasin homolog Displays low peroxidase activity and is likely to participate in H(2)O(2) metabolism and peroxidative reactions in the cardiovascular system (By similarity). Plays a role in extracellular matrix formation.confidentQ3UQ28
Peroxidasin-like protein confidentA1KZ92
Peroxidasin Plays a role in extracellular matrix consolidation, phagocytosis and defense.confidentQ9VZZ4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0055114 [BP]oxidation-reduction processprobableGO:0044710, GO:0008150, GO:0008152
GO:0005201 [MF]extracellular matrix structural constituentprobableGO:0003674, GO:0005198
GO:0030198 [BP]extracellular matrix organizationprobableGO:0009987, GO:0016043, GO:0044763, GO:0044699, GO:0043062, GO:0008150, GO:0071840
GO:0031012 [CC]extracellular matrixprobableGO:0005575
GO:0042744 [BP]hydrogen peroxide catabolic processprobableGO:0000302, GO:0044248, GO:0042743, GO:0070887, GO:0044699, GO:0051716, GO:0070301, GO:0009987, GO:0034614, GO:0072593, GO:0006950, GO:0008150, GO:0008152, GO:0042221, GO:0034599, GO:0010035, GO:0009056, GO:0006979, GO:1901700, GO:1901701, GO:0042542, GO:0050896, GO:0044237, GO:0033554, GO:0044763
GO:0020037 [MF]heme bindingprobableGO:0005488, GO:0097159, GO:0003674, GO:1901363, GO:0046906
GO:0004601 [MF]peroxidase activityprobableGO:0003824, GO:0016209, GO:0016684, GO:0003674, GO:0016491
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1D2V, chain C
Confidence level:very confident
Coverage over the Query: 32-94
View the alignment between query and template
View the model in PyMOL