Diaphorina citri psyllid: psy11162

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-
MIRKIIKELDTKVPNAAIFTVNKEDHTLGNMIRNQLLKDPHVLFAGYKQPHPLEHKFILRIQTTAESTPHDALMNAITDLLAELSLFEERF
ccEEEEEEcccccccEEEEEEEcccccHHHHHHHHHHccccEEEEcEEccccccccEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHcc
**RKIIKELDTKVPNAAIFTVNKEDHTLGNMIRNQLLKDPHVLFAGYKQPHPLEHKFILRIQTTAESTPHDALMNAITDLLAELSLFEERF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIRKIIKELDTKVPNAAIFTVNKEDHTLGNMIRNQLLKDPHVLFAGYKQPHPLEHKFILRIQTTAESTPHDALMNAITDLLAELSLFEERF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DNA-directed RNA polymerase II subunit RPB11-b1 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. RPB11 is part of the core element with the central large cleft.very confidentQ9GZM3
DNA-directed RNA polymerase II subunit RPB11 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. RPB11 is part of the core element with the central large cleft.very confidentQ9VJE4
DNA-directed RNA polymerase II subunit RPB11 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. RPB11 is part of the core element with the central large cleft.very confidentQ7PVQ9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0003677 [MF]DNA bindingconfidentGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0044260 [BP]cellular macromolecule metabolic processconfidentGO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0005665 [CC]DNA-directed RNA polymerase II, core complexconfidentGO:0030880, GO:0000428, GO:0031974, GO:0043229, GO:0016591, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0055029, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0044238 [BP]primary metabolic processconfidentGO:0008150, GO:0008152
GO:0003899 [MF]DNA-directed RNA polymerase activityconfidentGO:0016779, GO:0016772, GO:0034062, GO:0003824, GO:0016740, GO:0003674
GO:0040027 [BP]negative regulation of vulval developmentprobableGO:0051093, GO:0050793, GO:0051241, GO:0040028, GO:0048581, GO:0048580, GO:0050789, GO:0065007, GO:2000026, GO:0008150, GO:0051239, GO:0048519, GO:0061062, GO:0061064
GO:0040035 [BP]hermaphrodite genitalia developmentprobableGO:0032502, GO:0007548, GO:0032501, GO:0048608, GO:0000003, GO:0044707, GO:0022414, GO:0061458, GO:0048856, GO:0044767, GO:0003006, GO:0048513, GO:0048806, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0048477 [BP]oogenesisprobableGO:0044702, GO:0048609, GO:0032504, GO:0019953, GO:0007292, GO:0022414, GO:0032501, GO:0008150, GO:0044699, GO:0007276, GO:0000003
GO:0030275 [MF]LRR domain bindingprobableGO:0003674, GO:0019904, GO:0005515, GO:0005488
GO:0002119 [BP]nematode larval developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0006898 [BP]receptor-mediated endocytosisprobableGO:0006897, GO:0016192, GO:0006810, GO:0008150, GO:0051234, GO:0051179
GO:0040007 [BP]growthprobableGO:0008150
GO:0004672 [MF]protein kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674
GO:0006468 [BP]protein phosphorylationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0040010 [BP]positive regulation of growth rateprobableGO:0045927, GO:0040008, GO:0040009, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0003968 [MF]RNA-directed RNA polymerase activityprobableGO:0016779, GO:0016772, GO:0034062, GO:0003824, GO:0016740, GO:0003674
GO:0006283 [BP]transcription-coupled nucleotide-excision repairprobableGO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:0044699, GO:0006281, GO:0009987, GO:0006725, GO:0006289, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0000398 [BP]mRNA splicing, via spliceosomeprobableGO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0044260, GO:0071704, GO:0010467, GO:0008380, GO:0044238, GO:0009987, GO:0006725, GO:0000375, GO:0000377, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0016071, GO:0044237, GO:0043170, GO:0006396, GO:0006397
GO:0006370 [BP]7-methylguanosine mRNA cappingprobableGO:0036260, GO:0009452, GO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0044260, GO:0071704, GO:0010467, GO:0044238, GO:0009987, GO:0006725, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0016071, GO:0044237, GO:0043170, GO:0006396, GO:0006397
GO:0005666 [CC]DNA-directed RNA polymerase III complexprobableGO:0030880, GO:0000428, GO:0031974, GO:0043229, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0055029, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0006367 [BP]transcription initiation from RNA polymerase II promoterprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0006366, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0006352, GO:0019438
GO:0006369 [BP]termination of RNA polymerase II transcriptionprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0006366, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0006353, GO:0019438
GO:0046983 [MF]protein dimerization activityprobableGO:0003674, GO:0005488, GO:0005515
GO:0050434 [BP]positive regulation of viral transcriptionprobableGO:0009893, GO:0019222, GO:0031328, GO:2000243, GO:0031325, GO:2000241, GO:0031323, GO:0050789, GO:0080090, GO:0010604, GO:0009891, GO:0019219, GO:0065007, GO:0046782, GO:0031326, GO:0048518, GO:0045935, GO:0060255, GO:0050792, GO:0009889, GO:0050794, GO:0043902, GO:0043900, GO:0008150, GO:0051171, GO:2001141, GO:0051173, GO:0051252, GO:0051254, GO:0010557, GO:0010556, GO:0048524, GO:0048522
GO:0005736 [CC]DNA-directed RNA polymerase I complexprobableGO:0030880, GO:0000428, GO:0031974, GO:0043229, GO:0043228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005730, GO:0005634, GO:0044452, GO:0055029, GO:0043234, GO:0032991, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0042797 [BP]tRNA transcription from RNA polymerase III promoterprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0006383, GO:0018130, GO:0006139, GO:0009304, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0019438
GO:0006368 [BP]transcription elongation from RNA polymerase II promoterprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0006366, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006354, GO:0006351, GO:0019438
GO:0016032 [BP]viral reproductionprobableGO:0009987, GO:0044764, GO:0008150, GO:0051704

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.7.-Nucleotidyltransferases.probable
2.7.7.6DNA-directed RNA polymerase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3H0G, chain K
Confidence level:very confident
Coverage over the Query: 3-91
View the alignment between query and template
View the model in PyMOL