Query         psy11169
Match_columns 66
No_of_seqs    104 out of 480
Neff          7.1 
Searched_HMMs 46136
Date          Fri Aug 16 19:49:05 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy11169.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/11169hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3913|consensus               99.9 6.4E-26 1.4E-30  156.0   5.2   65    1-65     50-114 (356)
  2 PF00110 wnt:  wnt family;  Int  99.9 6.3E-26 1.4E-30  154.1   1.2   64    2-65      5-69  (310)
  3 smart00097 WNT1 found in Wnt-1  99.9 7.6E-25 1.7E-29  148.7   6.2   64    2-65      2-65  (305)
  4 PLN02277 H(+) -translocating i  84.0     1.3 2.9E-05   34.0   3.2   23   19-41    561-583 (730)
  5 TIGR01104 V_PPase vacuolar-typ  83.6     1.4   3E-05   33.8   3.1   23   19-41    529-551 (697)
  6 PRK00733 hppA membrane-bound p  80.8     2.1 4.6E-05   32.6   3.3   24   19-42    504-527 (666)
  7 PLN02255 H(+) -translocating i  79.1     2.5 5.4E-05   32.8   3.1   23   19-41    592-614 (765)
  8 PF03030 H_PPase:  Inorganic H+  78.0     2.4 5.2E-05   32.4   2.8   24   19-42    529-552 (682)
  9 COG3728 XtmA Phage terminase,   69.3     2.1 4.5E-05   27.7   0.6   27    4-30      2-28  (179)
 10 KOG4114|consensus               63.2      12 0.00026   20.8   2.8   31   10-40     29-61  (73)
 11 PF06345 Drf_DAD:  DRF Autoregu  57.3     9.7 0.00021   14.9   1.3   13   18-30      1-13  (15)
 12 PF14483 Cut8_M:  Cut8 dimerisa  53.1     8.8 0.00019   18.6   1.1   23    3-25      8-35  (38)
 13 PF03592 Terminase_2:  Terminas  50.5     5.3 0.00012   24.0   0.0   15    5-19      1-15  (144)
 14 COG1174 OpuBB ABC-type proline  49.1      27 0.00059   23.3   3.2   30    4-33    128-157 (221)
 15 PF11169 DUF2956:  Protein of u  42.4      61  0.0013   19.2   3.7   27    3-39     18-44  (103)
 16 PF04418 DUF543:  Domain of unk  37.6      18 0.00039   20.2   0.9   16   24-39     60-75  (75)
 17 PRK02289 4-oxalocrotonate taut  34.8      68  0.0015   16.3   3.1   10    2-11      9-18  (60)
 18 PF12830 Nipped-B_C:  Sister ch  29.9   1E+02  0.0022   19.4   3.5   33   10-42     70-103 (187)
 19 PF06514 PsbU:  Photosystem II   28.0      41 0.00088   19.6   1.3   17    2-18     54-70  (93)
 20 PF08444 Gly_acyl_tr_C:  Aralky  26.7      19  0.0004   20.8  -0.3    8   39-46     81-88  (89)
 21 PF07023 DUF1315:  Protein of u  25.8      44 0.00095   19.5   1.2   38    4-41     30-80  (93)
 22 TIGR00133 gatB glutamyl-tRNA(G  23.9      70  0.0015   23.6   2.2   45   12-62     42-93  (478)
 23 PF08748 DUF1789:  Domain of un  23.5 1.4E+02   0.003   18.2   3.1   23   11-33    101-123 (128)
 24 PF08688 ASD1:  Apx/Shroom doma  22.6      44 0.00095   21.7   0.8   21    4-24    129-149 (182)
 25 KOG3838|consensus               22.2      59  0.0013   24.0   1.5   20   24-43    169-188 (497)
 26 PF14445 Prok-RING_2:  Prokaryo  21.4      28  0.0006   18.3  -0.2    8   40-47     28-35  (57)
 27 COG3139 Uncharacterized protei  21.3      60  0.0013   18.7   1.1   12    4-15     32-43  (90)
 28 PF12010 DUF3502:  Domain of un  21.1      93   0.002   18.6   2.1   23   17-39    104-127 (134)
 29 PHA03356 tegument protein UL11  20.7      95  0.0021   17.9   1.9   18   40-57     74-91  (93)
 30 TIGR00165 S18 ribosomal protei  20.6 1.6E+02  0.0034   16.1   2.7    9    3-11     42-50  (70)

No 1  
>KOG3913|consensus
Probab=99.92  E-value=6.4e-26  Score=156.04  Aligned_cols=65  Identities=31%  Similarity=0.518  Sum_probs=62.0

Q ss_pred             CCCCCcHHHHhHhhcccchHHHHHHHHHHHHHHHHHhhCcCCCCCCCCCCCCCcccccccccccC
Q psy11169          1 MEYGFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSLFLTPKLTPDLITEFVDH   65 (66)
Q Consensus         1 ~~~~l~~~Q~~lC~~~~~~~~~v~~G~~~a~~eCq~qF~~~RWNCs~~~~~~~~~~~l~~g~kE~   65 (66)
                      +++||+++|+++|++||++|++|.+|+++||+|||+||+++|||||+.+..+.|+++|+.|+||+
T Consensus        50 ~l~gL~~~Q~~~Cr~~p~~~~sv~~G~~~~i~ECq~QFr~~RWNCs~~~~~~~~g~~l~~g~REs  114 (356)
T KOG3913|consen   50 NLPGLSPRQRRLCRRNPDVMPSVAEGAREGIQECQFQFRFRRWNCSTLDQLPVFGPLLSRGTRET  114 (356)
T ss_pred             hccccCHHHHHHHHhCcchHHHHHHHHHHHHHHHHHHHHhhccCCCCCccccccchhhcccchHH
Confidence            47899999999999999999999999999999999999999999999876779999999999996


No 2  
>PF00110 wnt:  wnt family;  InterPro: IPR005817 Wnt proteins constitute a large family of secreted molecules that are involved in intercellular signalling during development. The name derives from the first 2 members of the family to be discovered: int-1 (mouse) and wingless (Drosophila) []. It is now recognised that Wnt signalling controls many cell fate decisions in a variety of different organisms, including mammals []. Wnt signalling has been implicated in tumourigenesis, early mesodermal patterning of the embryo, morphogenesis of the brain and kidneys, regulation of mammary gland proliferation and Alzheimer's disease [, ]. Wnt-mediated signalling is believed to proceed initially through binding to cell surface receptors of the frizzled family; the signal is subsequently transduced through several cytoplasmic components to B-catenin, which enters the nucleus and activates the transcription of several genes important in development []. Several non-canonical Wnt signalling pathways have also been elucidated that act independently of B-catenin. Canonical and noncanonical Wnt signaling branches are highly interconnected, and cross-regulate each other []. Members of the Wnt gene family are defined by their sequence similarity to mouse Wnt-1 and Wingless in Drosophila. They encode proteins of ~350-400 residues in length, with orthologues identified in several, mostly vertebrate, species. Very little is known about the structure of Wnts as they are notoriously insoluble, but they share the following features characteristics of secretory proteins: a signal peptide, several potential N-glycosylation sites and 22 conserved cysteines [] that are probably involved in disulphide bonds. The Wnt proteins seem to adhere to the plasma membrane of the secreting cells and are therefore likely to signal over only few cell diameters. Fifteen major Wnt gene families have been identified in vertebrates, with multiple subtypes within some classes. In humans, 19 Wnt proteins have been identified that share 27% to 83% amino-acid sequence identity and a conserved pattern of 23 or 24 cysteine residues []. Wnt genes are highly conserved between vertebrate species sharing overall sequence identity and gene structure, and are slightly less conserved between vertebrates and invertebrates.; GO: 0005102 receptor binding, 0007275 multicellular organismal development, 0016055 Wnt receptor signaling pathway, 0005576 extracellular region; PDB: 4F0A_B.
Probab=99.91  E-value=6.3e-26  Score=154.09  Aligned_cols=64  Identities=30%  Similarity=0.625  Sum_probs=37.0

Q ss_pred             CCCCcHHHHhHhhcccchHHHHHHHHHHHHHHHHHhhCcCCCCCCCCCCCCCccc-ccccccccC
Q psy11169          2 EYGFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSLFLTPKLTP-DLITEFVDH   65 (66)
Q Consensus         2 ~~~l~~~Q~~lC~~~~~~~~~v~~G~~~a~~eCq~qF~~~RWNCs~~~~~~~~~~-~l~~g~kE~   65 (66)
                      ++||+++|+++|+++|++|++|++|+++|++|||+||+++|||||.....+.|++ ++.+|+||+
T Consensus         5 ~~gL~~~Q~~~C~~~p~~m~~i~~G~~~ai~ECq~QF~~~RWNCs~~~~~~~f~~~~~~~gtrE~   69 (310)
T PF00110_consen    5 IPGLTKRQRRLCRRNPDLMPSIAEGAKMAIEECQHQFRNRRWNCSTVDNNPVFGPPILKKGTRET   69 (310)
T ss_dssp             --------------HHHHHHHHHHHHHHHHHHHHHHTTTSSS-----T-THHHH-TT--S--HHH
T ss_pred             cccccccccccccCCHHHHHHHHHHHHHHHHHHHHHHhccCCCCCCCcccccccccccccCcccc
Confidence            7899999999999999999999999999999999999999999999876677888 999999996


No 3  
>smart00097 WNT1 found in Wnt-1.
Probab=99.91  E-value=7.6e-25  Score=148.70  Aligned_cols=64  Identities=27%  Similarity=0.447  Sum_probs=60.9

Q ss_pred             CCCCcHHHHhHhhcccchHHHHHHHHHHHHHHHHHhhCcCCCCCCCCCCCCCcccccccccccC
Q psy11169          2 EYGFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSLFLTPKLTPDLITEFVDH   65 (66)
Q Consensus         2 ~~~l~~~Q~~lC~~~~~~~~~v~~G~~~a~~eCq~qF~~~RWNCs~~~~~~~~~~~l~~g~kE~   65 (66)
                      ++||++.|+++|+++|++|++|++|+++|++|||+||+++|||||.....+.|++++.+|+||+
T Consensus         2 ~~~l~~~Q~~~C~~~~~~~~~v~~g~~~ai~ECq~QF~~~rWNCs~~~~~~~~~~~l~~~trEt   65 (305)
T smart00097        2 LPGLSRRQRRLCRANPDVMISVAEGAQEGIEECQHQFRFRRWNCSTLDNASVFGKVLRQGTRET   65 (305)
T ss_pred             CcccCHHHHHHHHhCHHHHHHHHHHHHHHHHHHHHHhCCCCCCCCCCcCCcccccccccccchH
Confidence            6799999999999999999999999999999999999999999998766678999999999996


No 4  
>PLN02277 H(+) -translocating inorganic pyrophosphatase
Probab=84.01  E-value=1.3  Score=34.03  Aligned_cols=23  Identities=22%  Similarity=0.254  Sum_probs=21.1

Q ss_pred             hHHHHHHHHHHHHHHHHHhhCcC
Q psy11169         19 IMPHVTKAAYLAANTCTTLFQDR   41 (66)
Q Consensus        19 ~~~~v~~G~~~a~~eCq~qF~~~   41 (66)
                      .|.+|.+++...++||++|||..
T Consensus       561 ~m~AVg~aA~~mVeEVRRQFrei  583 (730)
T PLN02277        561 ACAAVGRTAQEVVNEVRRQFAER  583 (730)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhcC
Confidence            58899999999999999999875


No 5  
>TIGR01104 V_PPase vacuolar-type H(+)-translocating pyrophosphatase. This model describes proton pyrophosphatases from eukaryotes (predominantly plants), archaea and bacteria. It is an integral membrane protein and is suggested to have about 15 membrane spanning domains. Proton translocating inorganic pyrophosphatase, like H(+)-ATPase, acidifies the vacuoles and is pivotal to the vacuolar secondary active transport systems in plants.
Probab=83.58  E-value=1.4  Score=33.77  Aligned_cols=23  Identities=22%  Similarity=0.206  Sum_probs=21.1

Q ss_pred             hHHHHHHHHHHHHHHHHHhhCcC
Q psy11169         19 IMPHVTKAAYLAANTCTTLFQDR   41 (66)
Q Consensus        19 ~~~~v~~G~~~a~~eCq~qF~~~   41 (66)
                      .|.+|.+++..-++||++|||..
T Consensus       529 ~m~AVg~aA~~mV~EVRRQFrei  551 (697)
T TIGR01104       529 TMKSVGRAALKMVEEVRRQFNTI  551 (697)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhhC
Confidence            58899999999999999999875


No 6  
>PRK00733 hppA membrane-bound proton-translocating pyrophosphatase; Validated
Probab=80.81  E-value=2.1  Score=32.63  Aligned_cols=24  Identities=21%  Similarity=0.189  Sum_probs=21.6

Q ss_pred             hHHHHHHHHHHHHHHHHHhhCcCC
Q psy11169         19 IMPHVTKAAYLAANTCTTLFQDRR   42 (66)
Q Consensus        19 ~~~~v~~G~~~a~~eCq~qF~~~R   42 (66)
                      .|.+|.+++...++|+++|||...
T Consensus       504 ~m~AVg~aA~~mV~EVRrQFre~p  527 (666)
T PRK00733        504 AMTAVGRAAGAMVEEVRRQFREIP  527 (666)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhcCc
Confidence            578999999999999999998763


No 7  
>PLN02255 H(+) -translocating inorganic pyrophosphatase
Probab=79.08  E-value=2.5  Score=32.76  Aligned_cols=23  Identities=22%  Similarity=0.169  Sum_probs=21.1

Q ss_pred             hHHHHHHHHHHHHHHHHHhhCcC
Q psy11169         19 IMPHVTKAAYLAANTCTTLFQDR   41 (66)
Q Consensus        19 ~~~~v~~G~~~a~~eCq~qF~~~   41 (66)
                      .|.+|.+++..-++|+++|||..
T Consensus       592 ~m~AVg~aA~~mV~EVRRQFrei  614 (765)
T PLN02255        592 TMKSVGSAALKMVEEVRRQFNTI  614 (765)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhhC
Confidence            58899999999999999999875


No 8  
>PF03030 H_PPase:  Inorganic H+ pyrophosphatase;  InterPro: IPR004131 Two types of proteins that hydrolyse inorganic pyrophosphate (PPi), very different in both amino acid sequence and structure, have been characterised to date: soluble and membrane-bound proton-pumping pyrophosphatases (sPPases and H(+)-PPases, respectively). sPPases are ubiquitous proteins that hydrolyse PPi to release heat, whereas H+-PPases, so far unidentified in animal and fungal cells, couple the energy of PPi hydrolysis to proton movement across biological membranes [, ]. The latter type is represented by this group of proteins. H+-PPases (3.6.1.1 from EC) are also called vacuolar-type inorganic pyrophosphatases (V-PPase) or pyrophosphate-energised vacuolar membrane proton pumps []. In plants, vacuoles contain two enzymes for acidifying the interior of the vacuole, the V-ATPase and the V-PPase (V is for vacuolar) []. Two distinct biochemical subclasses of H+-PPases have been characterised to date: K+-stimulated and K+-insensitive [, ]. For additional information please see [, ].; GO: 0004427 inorganic diphosphatase activity, 0009678 hydrogen-translocating pyrophosphatase activity, 0015992 proton transport, 0016020 membrane; PDB: 4A01_A.
Probab=78.04  E-value=2.4  Score=32.44  Aligned_cols=24  Identities=21%  Similarity=0.170  Sum_probs=21.6

Q ss_pred             hHHHHHHHHHHHHHHHHHhhCcCC
Q psy11169         19 IMPHVTKAAYLAANTCTTLFQDRR   42 (66)
Q Consensus        19 ~~~~v~~G~~~a~~eCq~qF~~~R   42 (66)
                      .|.+|.+++..-++|+++|||..+
T Consensus       529 ~m~aVg~aA~~mV~EvRrQFre~p  552 (682)
T PF03030_consen  529 TMKAVGRAAGKMVEEVRRQFREIP  552 (682)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHST
T ss_pred             HHHHHHHHHHHHHHHHHHHHhcCC
Confidence            578999999999999999998863


No 9  
>COG3728 XtmA Phage terminase, small subunit [DNA replication, recombination, and repair]
Probab=69.26  E-value=2.1  Score=27.71  Aligned_cols=27  Identities=7%  Similarity=0.145  Sum_probs=17.9

Q ss_pred             CCcHHHHhHhhcccchHHHHHHHHHHH
Q psy11169          4 GFSKGQTKICKGWTEIMPHVTKAAYLA   30 (66)
Q Consensus         4 ~l~~~Q~~lC~~~~~~~~~v~~G~~~a   30 (66)
                      -||.+|++||..|-..-.+-..|++.|
T Consensus         2 ~Lt~kQrrF~~eyi~~~naT~sA~~AG   28 (179)
T COG3728           2 ELTEKQRRFVDEYIKTFNATQSAIKAG   28 (179)
T ss_pred             cccHHHHHHHHHHHHcccHhHHHHHhc
Confidence            389999999988765544444444433


No 10 
>KOG4114|consensus
Probab=63.19  E-value=12  Score=20.82  Aligned_cols=31  Identities=23%  Similarity=0.304  Sum_probs=25.9

Q ss_pred             HhHhhcccch--HHHHHHHHHHHHHHHHHhhCc
Q psy11169         10 TKICKGWTEI--MPHVTKAAYLAANTCTTLFQD   40 (66)
Q Consensus        10 ~~lC~~~~~~--~~~v~~G~~~a~~eCq~qF~~   40 (66)
                      -+-|..+|++  +|..-.+...+..+|+.+.-+
T Consensus        29 ~reCldn~~~~~vPeeC~al~~af~dCKRslvD   61 (73)
T KOG4114|consen   29 PRECLDNPELKDVPEECIALMKAFLDCKRSLVD   61 (73)
T ss_pred             HHHHhcCCccccCcHHHHHHHHHHHHHHHHHHH
Confidence            4569999998  888888999999999988643


No 11 
>PF06345 Drf_DAD:  DRF Autoregulatory Domain;  InterPro: IPR010465 This domain is found in Diaphanous-related formins (Drfs). It binds the N-terminal GTPase-binding domain; this link is broken when GTP-bound Rho binds to the GBD and activates the protein. The addition of diaphanous activating domains (DAD) to mammalian cells induces actin filament formation, stabilises microtubules, and activates serum-response mediated transcription [].; PDB: 3O4X_H 3OBV_E 2BAP_C 2F31_B.
Probab=57.29  E-value=9.7  Score=14.88  Aligned_cols=13  Identities=15%  Similarity=0.158  Sum_probs=8.7

Q ss_pred             chHHHHHHHHHHH
Q psy11169         18 EIMPHVTKAAYLA   30 (66)
Q Consensus        18 ~~~~~v~~G~~~a   30 (66)
                      ++|.++.++.+.+
T Consensus         1 gvmdsllealqtg   13 (15)
T PF06345_consen    1 GVMDSLLEALQTG   13 (15)
T ss_dssp             -HHHHHHHHHHHS
T ss_pred             CcHHHHHHHHHcc
Confidence            4678888877653


No 12 
>PF14483 Cut8_M:  Cut8 dimerisation domain; PDB: 3Q5W_A 3Q5X_A.
Probab=53.12  E-value=8.8  Score=18.64  Aligned_cols=23  Identities=22%  Similarity=0.413  Sum_probs=16.4

Q ss_pred             CCCcHHH-----HhHhhcccchHHHHHH
Q psy11169          3 YGFSKGQ-----TKICKGWTEIMPHVTK   25 (66)
Q Consensus         3 ~~l~~~Q-----~~lC~~~~~~~~~v~~   25 (66)
                      .+|.+.|     .++|.+||++-..|..
T Consensus         8 E~Ld~~qL~~lL~~l~~~HPei~~~i~~   35 (38)
T PF14483_consen    8 ETLDKDQLQSLLQSLCERHPEIQQEIRS   35 (38)
T ss_dssp             TTS-HHHHHHHHHHHHHHSTHHHHHHHT
T ss_pred             HHcCHHHHHHHHHHHHHhChhHHHHHHh
Confidence            4555555     4589999999888764


No 13 
>PF03592 Terminase_2:  Terminase small subunit ;  InterPro: IPR005335 Packaging of double-stranded viral DNA concatemers requires interaction of the prohead with virus DNA. This process is mediated by a phage-encoded DNA recognition and terminase protein. The terminase enzymes described so far, which are hetero-oligomers composed of a small and a large subunit, do not have a significant level of sequence homology. The small terminase subunit is thought to form a nucleoprotein structure that helps to position the terminase large subunit at the packaging initiation site [].; GO: 0006323 DNA packaging; PDB: 3ZQP_B 2CMP_A 3ZQO_C 3ZQN_B 3ZQQ_B 3ZQM_D.
Probab=50.52  E-value=5.3  Score=24.00  Aligned_cols=15  Identities=7%  Similarity=0.184  Sum_probs=11.0

Q ss_pred             CcHHHHhHhhcccch
Q psy11169          5 FSKGQTKICKGWTEI   19 (66)
Q Consensus         5 l~~~Q~~lC~~~~~~   19 (66)
                      ||++|+.||..+..-
T Consensus         1 LT~kQ~~F~~~Yl~~   15 (144)
T PF03592_consen    1 LTPKQKRFVDEYLKD   15 (144)
T ss_dssp             --HHHHHHHHHHHHT
T ss_pred             CCHHHHHHHHHHHhc
Confidence            799999999887664


No 14 
>COG1174 OpuBB ABC-type proline/glycine betaine transport systems, permease component [Amino acid transport and metabolism]
Probab=49.07  E-value=27  Score=23.35  Aligned_cols=30  Identities=13%  Similarity=0.093  Sum_probs=26.9

Q ss_pred             CCcHHHHhHhhcccchHHHHHHHHHHHHHH
Q psy11169          4 GFSKGQTKICKGWTEIMPHVTKAAYLAANT   33 (66)
Q Consensus         4 ~l~~~Q~~lC~~~~~~~~~v~~G~~~a~~e   33 (66)
                      |+|+.|+=+=-+-|-.++.|..|+|.+.-.
T Consensus       128 GMT~~Q~L~~VelPlAlPvIlaGIR~a~V~  157 (221)
T COG1174         128 GMTRWQRLLKVELPLALPVILAGIRTAVVI  157 (221)
T ss_pred             CCCHHHHHHHhhccccHHHHHhhHHHHHHH
Confidence            789999999999999999999999988643


No 15 
>PF11169 DUF2956:  Protein of unknown function (DUF2956);  InterPro: IPR021339  This family of proteins with unknown function appears to be restricted to Gammaproteobacteria. 
Probab=42.42  E-value=61  Score=19.24  Aligned_cols=27  Identities=19%  Similarity=0.097  Sum_probs=21.1

Q ss_pred             CCCcHHHHhHhhcccchHHHHHHHHHHHHHHHHHhhC
Q psy11169          3 YGFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQ   39 (66)
Q Consensus         3 ~~l~~~Q~~lC~~~~~~~~~v~~G~~~a~~eCq~qF~   39 (66)
                      ||-|+.|..          .|+.|+..||.+=.+|-+
T Consensus        18 pGQTKEQTK----------LIAqGIeKGIa~YKKQqK   44 (103)
T PF11169_consen   18 PGQTKEQTK----------LIAQGIEKGIAEYKKQQK   44 (103)
T ss_pred             CCCCHHHHH----------HHHHHHHHHHHHHHHHHH
Confidence            566666655          799999999999887753


No 16 
>PF04418 DUF543:  Domain of unknown function (DUF543);  InterPro: IPR007512 This family of short eukaryotic proteins has no known function. Most of the members of this family are only 80 amino acid residues long. However the Arabidopsis homologue is over 300 residues long. These proteins contain a conserved N-terminal cysteine and a conserved motif GXGXGXG in the carboxy terminal half that may be functionally important.
Probab=37.60  E-value=18  Score=20.16  Aligned_cols=16  Identities=19%  Similarity=0.212  Sum_probs=12.5

Q ss_pred             HHHHHHHHHHHHHhhC
Q psy11169         24 TKAAYLAANTCTTLFQ   39 (66)
Q Consensus        24 ~~G~~~a~~eCq~qF~   39 (66)
                      .-|+=+|..+|++.|+
T Consensus        60 G~G~G~aY~~c~~~f~   75 (75)
T PF04418_consen   60 GFGIGMAYSECQRDFN   75 (75)
T ss_pred             ccccchhHHHHHHhcC
Confidence            4467788999999884


No 17 
>PRK02289 4-oxalocrotonate tautomerase; Provisional
Probab=34.80  E-value=68  Score=16.31  Aligned_cols=10  Identities=30%  Similarity=0.112  Sum_probs=7.6

Q ss_pred             CCCCcHHHHh
Q psy11169          2 EYGFSKGQTK   11 (66)
Q Consensus         2 ~~~l~~~Q~~   11 (66)
                      .+|.+..|++
T Consensus         9 ~~Grs~EqK~   18 (60)
T PRK02289          9 FEGRSQEQKN   18 (60)
T ss_pred             CCCCCHHHHH
Confidence            4678888877


No 18 
>PF12830 Nipped-B_C:  Sister chromatid cohesion C-terminus
Probab=29.91  E-value=1e+02  Score=19.36  Aligned_cols=33  Identities=15%  Similarity=0.188  Sum_probs=27.1

Q ss_pred             HhHhhcccchHH-HHHHHHHHHHHHHHHhhCcCC
Q psy11169         10 TKICKGWTEIMP-HVTKAAYLAANTCTTLFQDRR   42 (66)
Q Consensus        10 ~~lC~~~~~~~~-~v~~G~~~a~~eCq~qF~~~R   42 (66)
                      +.++.+|++++. .+.+|+++|.+-++.-+.+.+
T Consensus        70 ~~l~eK~~s~v~~~~~~gi~~af~~~~~l~~~~~  103 (187)
T PF12830_consen   70 KELHEKHESLVESRYSEGIRLAFDYQRRLSSDSR  103 (187)
T ss_pred             HHHHHHhHHHHHHHHHHHHHHHHHHHHHhcCCcc
Confidence            457889999887 589999999999988776654


No 19 
>PF06514 PsbU:  Photosystem II 12 kDa extrinsic protein (PsbU);  InterPro: IPR010527 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].  In PSII, the oxygen-evolving complex (OEC) is responsible for catalysing the splitting of water to O(2) and 4H+. The OEC is composed of a cluster of manganese, calcium and chloride ions bound to extrinsic proteins. In cyanobacteria there are five extrinsic proteins in OEC (PsbO, PsbP-like, PsbQ-like, PsbU and PsbV), while in plants there are only three (PsbO, PsbP and PsbQ), PsbU and PsbV having been lost during the evolution of green plants []. This family represents the PSII extrinsic protein PsbU, which forms part of the OEC in cyanobacteria and red algae. PsbU acts to stabilise the oxygen-evolving machinery of PSII against heat-induced inactivation, which is crucial for cellular thermo-tolerance [].; GO: 0015979 photosynthesis, 0042549 photosystem II stabilization, 0009523 photosystem II, 0009654 oxygen evolving complex, 0019898 extrinsic to membrane; PDB: 3BZ1_U 3KZI_U 3PRQ_U 2AXT_u 3BZ2_U 4FBY_U 3PRR_U 1S5L_U 3A0H_U 3ARC_U ....
Probab=27.97  E-value=41  Score=19.63  Aligned_cols=17  Identities=24%  Similarity=0.348  Sum_probs=12.1

Q ss_pred             CCCCcHHHHhHhhcccc
Q psy11169          2 EYGFSKGQTKICKGWTE   18 (66)
Q Consensus         2 ~~~l~~~Q~~lC~~~~~   18 (66)
                      |+|||.+|+.+-.++-+
T Consensus        54 ipgLse~qK~~lk~~~~   70 (93)
T PF06514_consen   54 IPGLSERQKALLKKYED   70 (93)
T ss_dssp             STT--HHHHHHHHHHGG
T ss_pred             ccCCCHHHHHHHHHHhc
Confidence            68999999998877655


No 20 
>PF08444 Gly_acyl_tr_C:  Aralkyl acyl-CoA:amino acid N-acyltransferase, C-terminal region;  InterPro: IPR013652 This entry represents mammalian-specific glycine N-acyltransferase (also called aralkyl acyl-CoA:amino acid N-acyltransferase; 2.3.1.13 from EC). Mitochondrial acyltransferases catalyse the transfer of an acyl group from acyl-CoA to the N terminus of glycine to produce N-acylglycine. These enzymes can conjugate a multitude of substrates to form a variety of N-acylglycines. The CoA derivatives of a number of aliphatic and aromatic acids, but not phenylacetyl-CoA or (indol-3-yl)acetyl-CoA, can act as donor [, ].
Probab=26.72  E-value=19  Score=20.77  Aligned_cols=8  Identities=38%  Similarity=1.016  Sum_probs=5.6

Q ss_pred             CcCCCCCC
Q psy11169         39 QDRRWNCS   46 (66)
Q Consensus        39 ~~~RWNCs   46 (66)
                      .+++|||.
T Consensus        81 ~w~qW~c~   88 (89)
T PF08444_consen   81 GWHQWNCV   88 (89)
T ss_pred             cchhceee
Confidence            36778884


No 21 
>PF07023 DUF1315:  Protein of unknown function (DUF1315);  InterPro: IPR009749 This family consists of several bacterial proteins of around 90 residues in length. The function of this family is unknown.
Probab=25.79  E-value=44  Score=19.47  Aligned_cols=38  Identities=11%  Similarity=0.060  Sum_probs=21.9

Q ss_pred             CCcHHHHhHhhc-----------ccchHHHHHHH--HHHHHHHHHHhhCcC
Q psy11169          4 GFSKGQTKICKG-----------WTEIMPHVTKA--AYLAANTCTTLFQDR   41 (66)
Q Consensus         4 ~l~~~Q~~lC~~-----------~~~~~~~v~~G--~~~a~~eCq~qF~~~   41 (66)
                      -||+.|+..|.+           .++.+..-.+|  ......+++.+|...
T Consensus        30 ~LT~eQre~~mQaVm~yq~~~n~~~e~~ti~~~G~I~~ksK~~lk~~f~~~   80 (93)
T PF07023_consen   30 ALTPEQRESCMQAVMLYQARHNLPEEHRTIGADGYIDMKSKAELKKQFSSD   80 (93)
T ss_pred             CCCHHHHHHHHHHHHHHHHHcCCCHHHcccCCCCEEccccHHHHHHhcccc
Confidence            499999999965           11111111112  234556778888766


No 22 
>TIGR00133 gatB glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B subunit. The heterotrimer GatABC is responsible for transferring the NH2 group that converts Glu to Gln, or Asp to Asn after the Glu or Asp has been ligated to the tRNA for Gln or Asn, respectively. In Lactobacillus, GatABC is responsible only for tRNA(Gln). In the Archaea, GatABC is responsible only for tRNA(Asn), while GatDE is responsible for tRNA(Gln). In lineages that include Thermus, Chlamydia, or Acidithiobacillus, the GatABC complex catalyzes both.
Probab=23.86  E-value=70  Score=23.62  Aligned_cols=45  Identities=20%  Similarity=0.271  Sum_probs=29.5

Q ss_pred             HhhcccchHHHH-HHHHHHHHHHHHHhhCcCCCCCCCCC------CCCCccccccccc
Q psy11169         12 ICKGWTEIMPHV-TKAAYLAANTCTTLFQDRRWNCSSLF------LTPKLTPDLITEF   62 (66)
Q Consensus        12 lC~~~~~~~~~v-~~G~~~a~~eCq~qF~~~RWNCs~~~------~~~~~~~~l~~g~   62 (66)
                      +|.-.|+.+|.+ .+++..|+..+..      =||+.+.      .-.+|-|+|.+|+
T Consensus        42 vclg~PG~LPvlN~~av~~Ai~~~~a------Lnc~i~~~~s~FdRK~YfYpDlPkGY   93 (478)
T TIGR00133        42 VCLGLPGALPVLNEEAVKKAIKLALA------LNSQINQPISVFDRKHYFYPDLPKGY   93 (478)
T ss_pred             cccCCCCCCCccCHHHHHHHHHHHHH------cCCEecCcceEEeccccccCCCCCCc
Confidence            688899988876 5556666666654      3887333      2245666776665


No 23 
>PF08748 DUF1789:  Domain of unknown function (DUF1789);  InterPro: IPR014859 This entry represents a putative uncharacterised protein found in phage-related conserved hypothetical protein from Bordetella. 
Probab=23.51  E-value=1.4e+02  Score=18.18  Aligned_cols=23  Identities=13%  Similarity=0.148  Sum_probs=19.8

Q ss_pred             hHhhcccchHHHHHHHHHHHHHH
Q psy11169         11 KICKGWTEIMPHVTKAAYLAANT   33 (66)
Q Consensus        11 ~lC~~~~~~~~~v~~G~~~a~~e   33 (66)
                      .|+..+|....+|.++...++.+
T Consensus       101 ~L~~~yp~a~~AI~~aY~~~l~~  123 (128)
T PF08748_consen  101 LLVDNYPGAAEAIVDAYYQALMG  123 (128)
T ss_pred             HHHHhCccHHHHHHHHHHHHHHH
Confidence            48899999999999998887754


No 24 
>PF08688 ASD1:  Apx/Shroom domain ASD1;  InterPro: IPR014800 Cell shape changes require the coordination of actin and microtubule cytoskeletons. The Shroom family is a small group of related proteins that are defined by sequence similarity and in most cases by some link to the actin cytoskeleton. The Shroom (Shrm) protein family is found only in animals. Proteins of this family are predicted to be utilised in multiple morphogenic and developmental processes across animal phyla to regulate cells shape or intracellular architecture in an actin and myosin-dependent manner []. While the founding member of the Shrm family is Shrm1 (formerly Apx), it appears that this protein is found only in Xenopus []. In mice and humans, the Shrm family of proteins consists of:  Shrm2 (formerly Apxl), a protein involved in the morphogenesis, maintenance, and/or function of vascular endothelial cells.  Shrm3 (formerly Shroom), a protein necessary for neural tube closure in vertebrate development as deficiency in Shrm results in spina bifida. Shrm3 is also conserved in some invertebrates, as orthologues can be found in sea urchins.  Shrm4, a regulator of cyto-skeletal architecture that may play an important role in vertebrate development. It is implicated in X-linked mental retardation in humans.    This protein family is based on the conservation of a specific arrangement of an N-terminal PDZ domain, a centrally positioned sequence motif termed ASD1 (Apx/Shrm Domain 1) and a C-terminal motif termed ASD2 [, , ]. Shrm2 and Shrm3 contain all three domains, while Shrm4 contains the PDZ and ASD2 domains, but lacks a discernible ASD1 element. To date, the ASD1 and ASD2 elements have only been found in Shrm-related proteins and do not appear in combination with other conserved domains. ASD1 is required for targeting actin, while ASD2 is capable of eliciting an actomyosin based constriction event [, ]. ASD2 is the most highly conserved sequence element shared by Shrm1, Shrm2, Shrm3, and Shrm4. It possesses a well conserved series of leucine residues that exhibit spacing consistent with that of a leucine zipper motif [].  This region is found in the actin binding protein Shroom. ASD1 has been implicated directly in F-actin binding. 
Probab=22.55  E-value=44  Score=21.70  Aligned_cols=21  Identities=24%  Similarity=0.109  Sum_probs=19.1

Q ss_pred             CCcHHHHhHhhcccchHHHHH
Q psy11169          4 GFSKGQTKICKGWTEIMPHVT   24 (66)
Q Consensus         4 ~l~~~Q~~lC~~~~~~~~~v~   24 (66)
                      -||..|+..|...|+=|.-|.
T Consensus       129 RlTaEQKkrSYSEPEKmneVG  149 (182)
T PF08688_consen  129 RLTAEQKKRSYSEPEKMNEVG  149 (182)
T ss_pred             cCCHHHhhhccCCchhhhhcc
Confidence            499999999999999999875


No 25 
>KOG3838|consensus
Probab=22.20  E-value=59  Score=23.99  Aligned_cols=20  Identities=15%  Similarity=0.408  Sum_probs=17.8

Q ss_pred             HHHHHHHHHHHHHhhCcCCC
Q psy11169         24 TKAAYLAANTCTTLFQDRRW   43 (66)
Q Consensus        24 ~~G~~~a~~eCq~qF~~~RW   43 (66)
                      .+|+..++.-|++-|||...
T Consensus       169 ~DGasQ~LssCqrDFRNkPy  188 (497)
T KOG3838|consen  169 GDGASQGLSSCQRDFRNKPY  188 (497)
T ss_pred             CccHHHHHHHhhHHhccCCC
Confidence            47999999999999999865


No 26 
>PF14445 Prok-RING_2:  Prokaryotic RING finger family 2
Probab=21.38  E-value=28  Score=18.35  Aligned_cols=8  Identities=50%  Similarity=1.207  Sum_probs=6.3

Q ss_pred             cCCCCCCC
Q psy11169         40 DRRWNCSS   47 (66)
Q Consensus        40 ~~RWNCs~   47 (66)
                      -.||.|++
T Consensus        28 CGRWaC~s   35 (57)
T PF14445_consen   28 CGRWACNS   35 (57)
T ss_pred             hchhhhhh
Confidence            47999975


No 27 
>COG3139 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=21.28  E-value=60  Score=18.69  Aligned_cols=12  Identities=17%  Similarity=0.398  Sum_probs=10.4

Q ss_pred             CCcHHHHhHhhc
Q psy11169          4 GFSKGQTKICKG   15 (66)
Q Consensus         4 ~l~~~Q~~lC~~   15 (66)
                      .||..|+..|.+
T Consensus        32 ~LtqeQke~clQ   43 (90)
T COG3139          32 ALTQEQKENCLQ   43 (90)
T ss_pred             cCCHHHHHHHHH
Confidence            489999999976


No 28 
>PF12010 DUF3502:  Domain of unknown function (DUF3502);  InterPro: IPR022627  This domain is about 140 amino acids in length and is functionally uncharacterised. It is found in bacteria C-terminal to PF01547 from PFAM. 
Probab=21.15  E-value=93  Score=18.61  Aligned_cols=23  Identities=4%  Similarity=-0.023  Sum_probs=17.1

Q ss_pred             cchHHHH-HHHHHHHHHHHHHhhC
Q psy11169         17 TEIMPHV-TKAAYLAANTCTTLFQ   39 (66)
Q Consensus        17 ~~~~~~v-~~G~~~a~~eCq~qF~   39 (66)
                      |+++..+ ..|+..-+.|.|+||.
T Consensus       104 ~~~~~kLk~AGidkV~~E~QkQld  127 (134)
T PF12010_consen  104 PEFNEKLKAAGIDKVIAELQKQLD  127 (134)
T ss_pred             HHHHHHHHHhChHHHHHHHHHHHH
Confidence            3445554 5679999999999984


No 29 
>PHA03356 tegument protein UL11; Provisional
Probab=20.67  E-value=95  Score=17.91  Aligned_cols=18  Identities=28%  Similarity=0.565  Sum_probs=11.7

Q ss_pred             cCCCCCCCCCCCCCcccc
Q psy11169         40 DRRWNCSSLFLTPKLTPD   57 (66)
Q Consensus        40 ~~RWNCs~~~~~~~~~~~   57 (66)
                      .++|.|+.....+.+.+.
T Consensus        74 ~r~~s~~g~~p~~~~~p~   91 (93)
T PHA03356         74 TRHWSPSGARPAPTFPPP   91 (93)
T ss_pred             ccccCCCCCCCCCCCCCC
Confidence            678999876554455443


No 30 
>TIGR00165 S18 ribosomal protein S18. This ribosomal small subunit protein is found in all eubacteria so far, as well as in chloroplasts. YER050C from Saccharomyces cerevisiae and a related protein from Caenorhabditis elegans appear to be homologous and may represent mitochondrial forms. The trusted cutoff is set high enough that these two candidate S18 proteins are not categorized automatically.
Probab=20.60  E-value=1.6e+02  Score=16.13  Aligned_cols=9  Identities=22%  Similarity=0.157  Sum_probs=5.3

Q ss_pred             CCCcHHHHh
Q psy11169          3 YGFSKGQTK   11 (66)
Q Consensus         3 ~~l~~~Q~~   11 (66)
                      .|++.+|++
T Consensus        42 Tgl~~k~Qr   50 (70)
T TIGR00165        42 TGTSAKYQR   50 (70)
T ss_pred             CCcCHHHHH
Confidence            456666655


Done!