BLAST Results

Query Summary

Your job contains 1 sequence.

Parameters
Threshold: 0.001
Maximum number of alignments shown: 100
BLAST filter: on

Query Sequence

>psy11169
MEYGFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSLFLTPKLTPDLIT
EFVDHF

High Scoring Gene Products

Symbol, full name Information P value
wnt11b-2
Protein Wnt-11b-2
protein from Xenopus (Silurana) tropicalis 8.1e-07
wnt11b-1
Protein Wnt-11b-1
protein from Xenopus (Silurana) tropicalis 8.1e-07
wnt11
wingless-type MMTV integration site family, member 11
gene_product from Danio rerio 1.7e-06
wnt11b
Protein Wnt-11b
protein from Xenopus laevis 7.7e-06
WNT4
Protein Wnt
protein from Homo sapiens 1.9e-05
wnt11
Protein Wnt-11
protein from Xenopus laevis 2.7e-05
WNT11
Protein Wnt-11
protein from Gallus gallus 2.7e-05
WNT11
Protein Wnt-11
protein from Coturnix japonica 2.7e-05
wnt11
Protein Wnt-11
protein from Xenopus (Silurana) tropicalis 3.5e-05
wnt4a
wingless-type MMTV integration site family, member 4a
gene_product from Danio rerio 3.5e-05
Q3Y524
Protein Wnt
protein from Mesocricetus auratus 4.5e-05
WNT11
Protein Wnt
protein from Homo sapiens 5.1e-05
wnt11r
wingless-type MMTV integration site family, member 11, related
gene_product from Danio rerio 5.7e-05
Wnt-11
Protein Wnt
protein from Oryctolagus cuniculus 5.8e-05
Wnt11
wingless-related MMTV integration site 11
protein from Mus musculus 5.8e-05
wnt4b
wingless-type MMTV integration site family, member 4b
gene_product from Danio rerio 5.9e-05
WNT5B
Protein Wnt
protein from Homo sapiens 8.1e-05
WNT5B
Protein Wnt
protein from Homo sapiens 8.1e-05
WNT5B
Protein Wnt
protein from Homo sapiens 8.1e-05
WNT4
Protein Wnt-4
protein from Gallus gallus 9.4e-05
WNT11
Protein Wnt-11
protein from Homo sapiens 9.5e-05
LOC100620317
Protein Wnt
protein from Sus scrofa 9.5e-05
LOC789600
Protein Wnt
protein from Bos taurus 0.00011
WNT4
Protein Wnt-4
protein from Homo sapiens 0.00012
WNT4
Protein Wnt
protein from Sus scrofa 0.00012
Wnt4
wingless-related MMTV integration site 4
protein from Mus musculus 0.00012
WNT11
Protein Wnt
protein from Bos taurus 0.00012
WNT11
Protein Wnt
protein from Canis lupus familiaris 0.00012
WNT11
Protein Wnt
protein from Ailuropoda melanoleuca 0.00012
WNT4
Protein Wnt
protein from Canis lupus familiaris 0.00013
WNT4
Protein Wnt-4
protein from Homo sapiens 0.00017
wnt4
Protein Wnt-4
protein from Xenopus laevis 0.00020
Wnt4
wingless-type MMTV integration site family, member 4
gene from Rattus norvegicus 0.00025
Wnt4
Protein Wnt-4
protein from Rattus norvegicus 0.00025
wnt5
Protein Wnt
protein from Ciona intestinalis 0.00027
cwn-2 gene from Caenorhabditis elegans 0.00027
wnt-2
Protein Wnt-2
protein from Caenorhabditis elegans 0.00027
WNT5B
Protein Wnt
protein from Homo sapiens 0.00030
WNT5B
Protein Wnt
protein from Canis lupus familiaris 0.00043
WNT5B
Protein Wnt-5b
protein from Pongo abelii 0.00044
Wnt5b
wingless-related MMTV integration site 5B
protein from Mus musculus 0.00044
WNT5B
Protein Wnt
protein from Bos taurus 0.00044
WNT5A
Protein Wnt
protein from Homo sapiens 0.00045
WNT3
Protein Wnt
protein from Canis lupus familiaris 0.00048
WNT3
Protein Wnt
protein from Bos taurus 0.00049
Wnt3
wingless-type MMTV integration site family, member 3
gene from Rattus norvegicus 0.00050
WNT3
Proto-oncogene Wnt-3
protein from Homo sapiens 0.00055
Wnt3
wingless-related MMTV integration site 3
protein from Mus musculus 0.00055
wnt3
wingless-type MMTV integration site family, member 3
gene_product from Danio rerio 0.00055
WNT5B
Protein Wnt
protein from Gallus gallus 0.00056
WNT5B
Protein Wnt-5b
protein from Homo sapiens 0.00056
Wnt5
Wnt oncogene analog 5
protein from Drosophila melanogaster 0.00062
LOC100514950
Protein Wnt
protein from Sus scrofa 0.00069
wnt3a
wingless-type MMTV integration site family, member 3A
gene_product from Danio rerio 0.00073
wnt5b
wingless-type MMTV integration site family, member 5b
gene_product from Danio rerio 0.00078
WNT4
Protein Wnt
protein from Homo sapiens 0.00087
WNT3A
Protein Wnt-3a
protein from Gallus gallus 0.00089
wnt5a
wingless-type MMTV integration site family, member 5a
gene_product from Danio rerio 0.00098
WNT3A
Protein Wnt
protein from Gallus gallus 0.00099

The BLAST search returned 5 gene products which did not match your query constraints. Please see the full BLAST report below for the details.

Back to top

Raw Blast Data

BLASTP 2.0MP-WashU [04-May-2006] [linux26-i686-ILP32F64 2006-05-09T11:47:08]

Copyright (C) 1996-2006 Washington University, Saint Louis, Missouri USA.
All Rights Reserved.

Reference:  Gish, W. (1996-2006) http://blast.wustl.edu

Query=  psy11169
        (66 letters)

Database:  go_20130330-seqdb.fasta
           368,745 sequences; 169,044,731 total letters.
Searching....10....20....30....40....50....60....70....80....90....100% done

                                                                     Smallest
                                                                       Sum
                                                              High  Probability
Sequences producing High-scoring Segment Pairs:              Score  P(N)      N

UNIPROTKB|Q28J82 - symbol:wnt11b-2 "Protein Wnt-11b-2" sp...   120  8.1e-07   1
UNIPROTKB|Q66II0 - symbol:wnt11b-1 "Protein Wnt-11b-1" sp...   120  8.1e-07   1
ZFIN|ZDB-GENE-990603-12 - symbol:wnt11 "wingless-type MMT...   117  1.7e-06   1
UNIPROTKB|P49893 - symbol:wnt11b "Protein Wnt-11b" specie...   111  7.7e-06   1
UNIPROTKB|H0Y663 - symbol:WNT4 "Protein Wnt" species:9606...   100  1.9e-05   1
UNIPROTKB|Q670P5 - symbol:wnt11 "Protein Wnt-11" species:...   106  2.7e-05   1
UNIPROTKB|P49339 - symbol:WNT11 "Protein Wnt-11" species:...   106  2.7e-05   1
UNIPROTKB|P51891 - symbol:WNT11 "Protein Wnt-11" species:...   106  2.7e-05   1
UNIPROTKB|B2GUT4 - symbol:wnt11 "Protein Wnt-11" species:...   105  3.5e-05   1
ZFIN|ZDB-GENE-980526-352 - symbol:wnt4a "wingless-type MM...   105  3.5e-05   1
UNIPROTKB|Q3Y524 - symbol:Q3Y524 "Protein Wnt" species:10...   104  4.5e-05   1
UNIPROTKB|G3V819 - symbol:Wnt11 "Protein Wnt" species:101...   104  4.5e-05   1
UNIPROTKB|E9PJL6 - symbol:WNT11 "Protein Wnt" species:960...   101  5.1e-05   1
ZFIN|ZDB-GENE-980526-249 - symbol:wnt11r "wingless-type M...   103  5.7e-05   1
UNIPROTKB|Q27Q51 - symbol:Wnt-11 "Protein Wnt" species:99...   103  5.8e-05   1
MGI|MGI:101948 - symbol:Wnt11 "wingless-related MMTV inte...   103  5.8e-05   1
ZFIN|ZDB-GENE-000411-1 - symbol:wnt4b "wingless-type MMTV...   103  5.9e-05   1
UNIPROTKB|F5GYM2 - symbol:WNT5B "Protein Wnt" species:960...    94  8.1e-05   1
UNIPROTKB|F5H034 - symbol:WNT5B "Protein Wnt" species:960...    94  8.1e-05   1
UNIPROTKB|F5H364 - symbol:WNT5B "Protein Wnt" species:960...    94  8.1e-05   1
UNIPROTKB|P49337 - symbol:WNT4 "Protein Wnt-4" species:90...   101  9.4e-05   1
UNIPROTKB|O96014 - symbol:WNT11 "Protein Wnt-11" species:...   101  9.5e-05   1
UNIPROTKB|F1SUL7 - symbol:LOC100620317 "Protein Wnt" spec...   101  9.5e-05   1
UNIPROTKB|F1MZV4 - symbol:LOC789600 "Protein Wnt" species...   100  0.00011   1
UNIPROTKB|P56705 - symbol:WNT4 "Protein Wnt-4" species:96...   100  0.00012   1
UNIPROTKB|I3LRC0 - symbol:WNT4 "Protein Wnt" species:9823...   100  0.00012   1
MGI|MGI:98957 - symbol:Wnt4 "wingless-related MMTV integr...   100  0.00012   1
UNIPROTKB|F1N4C0 - symbol:WNT11 "Protein Wnt" species:991...   100  0.00012   1
UNIPROTKB|E2QXQ3 - symbol:WNT11 "Protein Wnt" species:961...   100  0.00012   1
UNIPROTKB|D2H1C6 - symbol:WNT11 "Protein Wnt" species:964...   100  0.00012   1
UNIPROTKB|F1NP78 - symbol:WNT11B "Protein Wnt" species:90...   100  0.00012   1
UNIPROTKB|F1P7Z1 - symbol:WNT4 "Protein Wnt" species:9615...   100  0.00013   1
UNIPROTKB|F1NX78 - symbol:WNT5A "Protein Wnt" species:903...    90  0.00014   2
UNIPROTKB|B1AJZ6 - symbol:WNT4 "Protein Wnt-4" species:96...    91  0.00017   1
UNIPROTKB|P49338 - symbol:wnt4 "Protein Wnt-4" species:83...    98  0.00020   1
RGD|621348 - symbol:Wnt4 "wingless-type MMTV integration ...    97  0.00025   1
UNIPROTKB|Q9QXQ5 - symbol:Wnt4 "Protein Wnt-4" species:10...    97  0.00025   1
UNIPROTKB|Q9U6V0 - symbol:wnt5 "Protein Wnt" species:7719...    97  0.00027   1
WB|WBGene00000858 - symbol:cwn-2 species:6239 "Caenorhabd...    97  0.00027   1
UNIPROTKB|P34889 - symbol:wnt-2 "Protein Wnt-2" species:6...    97  0.00027   1
UNIPROTKB|F5H7Q6 - symbol:WNT5B "Protein Wnt" species:960...    94  0.00030   1
UNIPROTKB|F1Q0S4 - symbol:WNT5B "Protein Wnt" species:961...    95  0.00043   1
UNIPROTKB|Q5NVK2 - symbol:WNT5B "Protein Wnt-5b" species:...    95  0.00044   1
MGI|MGI:98959 - symbol:Wnt5b "wingless-related MMTV integ...    95  0.00044   1
UNIPROTKB|F1MP15 - symbol:WNT5B "Protein Wnt" species:991...    95  0.00044   1
UNIPROTKB|C9J8I8 - symbol:WNT5A "Protein Wnt" species:960...    91  0.00045   1
UNIPROTKB|E2RHR6 - symbol:WNT3 "Protein Wnt" species:9615...    94  0.00048   1
UNIPROTKB|F1N5R1 - symbol:WNT3 "Protein Wnt" species:9913...    94  0.00049   1
UNIPROTKB|F1NMK4 - symbol:WNT5B "Protein Wnt" species:903...    94  0.00049   1
RGD|3972 - symbol:Wnt3 "wingless-type MMTV integration si...    94  0.00050   1
UNIPROTKB|F1NVM5 - symbol:Gga.99 "Protein Wnt" species:90...    93  0.00054   1
UNIPROTKB|P56703 - symbol:WNT3 "Proto-oncogene Wnt-3" spe...    94  0.00055   1
MGI|MGI:98955 - symbol:Wnt3 "wingless-related MMTV integr...    94  0.00055   1
ZFIN|ZDB-GENE-081003-1 - symbol:wnt3 "wingless-type MMTV ...    94  0.00055   1
UNIPROTKB|F1NMK6 - symbol:WNT5B "Protein Wnt" species:903...    94  0.00056   1
UNIPROTKB|Q9H1J7 - symbol:WNT5B "Protein Wnt-5b" species:...    94  0.00056   1
FB|FBgn0010194 - symbol:Wnt5 "Wnt oncogene analog 5" spec...    99  0.00062   1
UNIPROTKB|I3LBV3 - symbol:WNT3A "Protein Wnt" species:982...    93  0.00069   1
ZFIN|ZDB-GENE-001106-1 - symbol:wnt3a "wingless-type MMTV...    93  0.00073   1
ZFIN|ZDB-GENE-980526-87 - symbol:wnt5b "wingless-type MMT...    93  0.00078   1
UNIPROTKB|B4DJF9 - symbol:WNT4 "Protein Wnt" species:9606...    91  0.00087   1
UNIPROTKB|Q2LMP1 - symbol:WNT3A "Protein Wnt-3a" species:...    92  0.00089   1
ZFIN|ZDB-GENE-060328-3 - symbol:wnt5a "wingless-type MMTV...    92  0.00098   1
UNIPROTKB|F1N8G8 - symbol:WNT3A "Protein Wnt" species:903...    92  0.00099   1


>UNIPROTKB|Q28J82 [details] [associations]
            symbol:wnt11b-2 "Protein Wnt-11b-2" species:8364 "Xenopus
            (Silurana) tropicalis" [GO:0005576 "extracellular region"
            evidence=ISS] InterPro:IPR005817 Pfam:PF00110 PRINTS:PR01349
            SMART:SM00097 PANTHER:PTHR12027 GO:GO:0005576 GO:GO:0016055
            GO:GO:0005578 GO:GO:0007369 InterPro:IPR018161 PROSITE:PS00246
            CTD:7481 HOVERGEN:HBG001595 KO:K01384 EMBL:CR760014
            RefSeq:NP_001016735.1 UniGene:Str.27098 ProteinModelPortal:Q28J82
            STRING:Q28J82 GeneID:549489 KEGG:xtr:549489 Xenbase:XB-GENE-5858981
            eggNOG:KOG3913 Bgee:Q28J82 Uniprot:Q28J82
        Length = 353

 Score = 120 (47.3 bits), Expect = 8.1e-07, P = 8.1e-07
 Identities = 25/55 (45%), Positives = 30/55 (54%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSLFLTPKLTPDL 58
             G    Q+++CK   E+M  V  AA  A  TC   F D RWNCSS+   P  TPDL
Sbjct:    48 GLVPEQSQLCKRNLELMQSVVNAAKQAKLTCQMTFSDMRWNCSSVENAPNFTPDL 102


>UNIPROTKB|Q66II0 [details] [associations]
            symbol:wnt11b-1 "Protein Wnt-11b-1" species:8364 "Xenopus
            (Silurana) tropicalis" [GO:0001664 "G-protein coupled receptor
            binding" evidence=ISS] [GO:0005576 "extracellular region"
            evidence=ISS] [GO:0005615 "extracellular space" evidence=ISS]
            [GO:0005886 "plasma membrane" evidence=ISS] [GO:0007492 "endoderm
            development" evidence=ISS] [GO:0009798 "axis specification"
            evidence=ISS] [GO:0009952 "anterior/posterior pattern
            specification" evidence=ISS] [GO:0060070 "canonical Wnt receptor
            signaling pathway" evidence=ISS] InterPro:IPR005817 Pfam:PF00110
            PRINTS:PR01349 SMART:SM00097 PANTHER:PTHR12027 GO:GO:0005886
            GO:GO:0005615 GO:GO:0009952 GO:GO:0005578 GO:GO:0001664
            GO:GO:0007492 GO:GO:0009798 GO:GO:0060070 GO:GO:0007369
            InterPro:IPR018161 PROSITE:PS00246 EMBL:BC081341
            RefSeq:NP_001008133.1 UniGene:Str.3082 STRING:Q66II0 GeneID:493495
            KEGG:xtr:493495 CTD:7481 eggNOG:NOG273917 HOGENOM:HOG000039529
            HOVERGEN:HBG001595 InParanoid:Q66II0 KO:K01384 OrthoDB:EOG4MPHS2
            Uniprot:Q66II0
        Length = 353

 Score = 120 (47.3 bits), Expect = 8.1e-07, P = 8.1e-07
 Identities = 25/55 (45%), Positives = 30/55 (54%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSLFLTPKLTPDL 58
             G    Q+++CK   E+M  V  AA  A  TC   F D RWNCSS+   P  TPDL
Sbjct:    48 GLVPEQSQLCKRNLELMQSVVNAAKQAKLTCQMTFSDMRWNCSSVENAPNFTPDL 102


>ZFIN|ZDB-GENE-990603-12 [details] [associations]
            symbol:wnt11 "wingless-type MMTV integration site
            family, member 11" species:7955 "Danio rerio" [GO:0016055 "Wnt
            receptor signaling pathway" evidence=IEA] [GO:0007275
            "multicellular organismal development" evidence=IEA] [GO:0005102
            "receptor binding" evidence=IEA] [GO:0005576 "extracellular region"
            evidence=IEA] [GO:0060027 "convergent extension involved in
            gastrulation" evidence=IGI;IMP] [GO:0042074 "cell migration
            involved in gastrulation" evidence=IGI;IMP] [GO:0001947 "heart
            looping" evidence=IGI] [GO:0070121 "Kupffer's vesicle development"
            evidence=IGI] [GO:0009952 "anterior/posterior pattern
            specification" evidence=IBA] [GO:0007492 "endoderm development"
            evidence=IBA] [GO:0005615 "extracellular space" evidence=IBA]
            [GO:0009798 "axis specification" evidence=IBA] [GO:0001664
            "G-protein coupled receptor binding" evidence=IBA] [GO:0000132
            "establishment of mitotic spindle orientation" evidence=IMP]
            [GO:0005886 "plasma membrane" evidence=IDA;IMP] [GO:0030100
            "regulation of endocytosis" evidence=IMP] [GO:0016337 "cell-cell
            adhesion" evidence=IGI;IMP] [GO:0001702 "gastrulation with mouth
            forming second" evidence=IMP] [GO:0045859 "regulation of protein
            kinase activity" evidence=IMP] [GO:0016477 "cell migration"
            evidence=IMP] [GO:0048048 "embryonic eye morphogenesis"
            evidence=IGI;IMP] [GO:0007417 "central nervous system development"
            evidence=IMP] [GO:0008078 "mesodermal cell migration"
            evidence=IGI;IMP] [GO:0043010 "camera-type eye development"
            evidence=IMP] [GO:0030335 "positive regulation of cell migration"
            evidence=ISS] [GO:0030295 "protein kinase activator activity"
            evidence=ISS] [GO:0005099 "Ras GTPase activator activity"
            evidence=ISS] [GO:0006468 "protein phosphorylation" evidence=ISS]
            [GO:0030336 "negative regulation of cell migration" evidence=ISS]
            [GO:0034394 "protein localization to cell surface" evidence=ISS]
            [GO:0045892 "negative regulation of transcription, DNA-dependent"
            evidence=ISS] [GO:0060548 "negative regulation of cell death"
            evidence=ISS] [GO:0090037 "positive regulation of protein kinase C
            signaling cascade" evidence=ISS] [GO:0045860 "positive regulation
            of protein kinase activity" evidence=ISS] [GO:0005737 "cytoplasm"
            evidence=ISS] [GO:0010628 "positive regulation of gene expression"
            evidence=ISS] [GO:0044212 "transcription regulatory region DNA
            binding" evidence=ISS] [GO:0032320 "positive regulation of Ras
            GTPase activity" evidence=ISS] [GO:0045893 "positive regulation of
            transcription, DNA-dependent" evidence=ISS] [GO:0043066 "negative
            regulation of apoptotic process" evidence=ISS] [GO:0060021 "palate
            development" evidence=ISS] [GO:0051496 "positive regulation of
            stress fiber assembly" evidence=ISS] [GO:0061101 "neuroendocrine
            cell differentiation" evidence=ISS] [GO:0090090 "negative
            regulation of canonical Wnt receptor signaling pathway"
            evidence=IGI;ISS] [GO:0030308 "negative regulation of cell growth"
            evidence=ISS] [GO:0060026 "convergent extension" evidence=IGI]
            [GO:0031016 "pancreas development" evidence=IMP] [GO:0007507 "heart
            development" evidence=IGI;IMP] [GO:0060031 "mediolateral
            intercalation" evidence=IMP] [GO:0005578 "proteinaceous
            extracellular matrix" evidence=IEA] [GO:0001839 "neural plate
            morphogenesis" evidence=IMP] [GO:0060898 "eye field cell fate
            commitment involved in camera-type eye formation" evidence=IMP]
            [GO:0035567 "non-canonical Wnt receptor signaling pathway"
            evidence=IMP] [GO:0008104 "protein localization" evidence=IGI]
            InterPro:IPR005817 Pfam:PF00110 PRINTS:PR01349 SMART:SM00097
            ZFIN:ZDB-GENE-990603-12 PANTHER:PTHR12027 GO:GO:0005886
            GO:GO:0000132 GO:GO:0005737 GO:GO:0045892 GO:GO:0045893
            GO:GO:0043066 GO:GO:0005615 GO:GO:0030308 GO:GO:0009952
            GO:GO:0005099 GO:GO:0005578 GO:GO:0051496 GO:GO:0006468
            GO:GO:0007417 GO:GO:0030295 GO:GO:0030336 GO:GO:0044212
            GO:GO:0030100 GO:GO:0016337 GO:GO:0001702 GO:GO:0090037
            GO:GO:0030335 GO:GO:0090090 GO:GO:0001947 GO:GO:0070121
            GO:GO:0060021 GO:GO:0001664 GO:GO:0034394 GO:GO:0007492
            GO:GO:0009798 GO:GO:0008078 GO:GO:0061101 GO:GO:0001839
            GO:GO:0060031 GO:GO:0035567 InterPro:IPR018161 PROSITE:PS00246
            eggNOG:NOG273917 HOGENOM:HOG000039529 HOVERGEN:HBG001595
            OrthoDB:EOG4MPHS2 EMBL:AF067429 IPI:IPI00481789 UniGene:Dr.75830
            STRING:O73864 InParanoid:O73864 ArrayExpress:O73864 GO:GO:0060898
            Uniprot:O73864
        Length = 354

 Score = 117 (46.2 bits), Expect = 1.7e-06, P = 1.7e-06
 Identities = 23/55 (41%), Positives = 31/55 (56%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSLFLTPKLTPDL 58
             G    Q ++CK   E+M  + +AA L  + CT+ F D RWN SS+   P  TPDL
Sbjct:    49 GLVPDQQQLCKRNLELMHSIVRAARLTKSACTSSFSDMRWNWSSIESAPHFTPDL 103


>UNIPROTKB|P49893 [details] [associations]
            symbol:wnt11b "Protein Wnt-11b" species:8355 "Xenopus
            laevis" [GO:0001755 "neural crest cell migration" evidence=IMP]
            [GO:0005099 "Ras GTPase activator activity" evidence=ISS]
            [GO:0005109 "frizzled binding" evidence=IPI] [GO:0005515 "protein
            binding" evidence=IPI] [GO:0005576 "extracellular region"
            evidence=ISS] [GO:0005578 "proteinaceous extracellular matrix"
            evidence=IDA] [GO:0005615 "extracellular space" evidence=IDA]
            [GO:0005737 "cytoplasm" evidence=ISS] [GO:0005886 "plasma membrane"
            evidence=IPI] [GO:0006468 "protein phosphorylation" evidence=ISS]
            [GO:0006897 "endocytosis" evidence=IMP] [GO:0007507 "heart
            development" evidence=IMP] [GO:0009950 "dorsal/ventral axis
            specification" evidence=IGI;IMP] [GO:0010628 "positive regulation
            of gene expression" evidence=ISS] [GO:0016055 "Wnt receptor
            signaling pathway" evidence=IGI] [GO:0017147 "Wnt-protein binding"
            evidence=IPI] [GO:0019838 "growth factor binding" evidence=IPI]
            [GO:0030295 "protein kinase activator activity" evidence=ISS]
            [GO:0030308 "negative regulation of cell growth" evidence=ISS]
            [GO:0030335 "positive regulation of cell migration" evidence=ISS]
            [GO:0030336 "negative regulation of cell migration" evidence=ISS]
            [GO:0032320 "positive regulation of Ras GTPase activity"
            evidence=ISS] [GO:0034394 "protein localization to cell surface"
            evidence=ISS] [GO:0035567 "non-canonical Wnt receptor signaling
            pathway" evidence=IGI;NAS;IMP] [GO:0042074 "cell migration involved
            in gastrulation" evidence=IMP;IPI] [GO:0042803 "protein
            homodimerization activity" evidence=IDA] [GO:0043066 "negative
            regulation of apoptotic process" evidence=ISS] [GO:0043234 "protein
            complex" evidence=IPI] [GO:0044212 "transcription regulatory region
            DNA binding" evidence=ISS] [GO:0045860 "positive regulation of
            protein kinase activity" evidence=ISS] [GO:0045892 "negative
            regulation of transcription, DNA-dependent" evidence=ISS]
            [GO:0045893 "positive regulation of transcription, DNA-dependent"
            evidence=ISS] [GO:0046330 "positive regulation of JNK cascade"
            evidence=IDA] [GO:0048793 "pronephros development" evidence=IMP]
            [GO:0051496 "positive regulation of stress fiber assembly"
            evidence=ISS] [GO:0060021 "palate development" evidence=ISS]
            [GO:0060027 "convergent extension involved in gastrulation"
            evidence=IMP] [GO:0060070 "canonical Wnt receptor signaling
            pathway" evidence=IGI;IMP] [GO:0060071 "Wnt receptor signaling
            pathway, planar cell polarity pathway" evidence=IGI] [GO:0060548
            "negative regulation of cell death" evidence=ISS] [GO:0060914
            "heart formation" evidence=IMP] [GO:0061101 "neuroendocrine cell
            differentiation" evidence=ISS] [GO:0090037 "positive regulation of
            protein kinase C signaling cascade" evidence=ISS] [GO:0090090
            "negative regulation of canonical Wnt receptor signaling pathway"
            evidence=ISS] [GO:0003129 "heart induction" evidence=IMP]
            [GO:0014036 "neural crest cell fate specification" evidence=IMP]
            InterPro:IPR005817 Pfam:PF00110 PRINTS:PR01349 SMART:SM00097
            PANTHER:PTHR12027 GO:GO:0005886 GO:GO:0005737 GO:GO:0045892
            GO:GO:0045893 GO:GO:0043066 GO:GO:0005615 GO:GO:0043234
            GO:GO:0042803 GO:GO:0030308 GO:GO:0005099 GO:GO:0001755
            GO:GO:0005578 GO:GO:0046330 GO:GO:0051496 GO:GO:0006897
            GO:GO:0006468 GO:GO:0030295 GO:GO:0030336 GO:GO:0044212
            GO:GO:0090037 GO:GO:0030335 GO:GO:0090090 GO:GO:0060021
            GO:GO:0042074 GO:GO:0034394 GO:GO:0060070 GO:GO:0060914
            GO:GO:0060027 GO:GO:0009950 GO:GO:0061101 GO:GO:0048793
            GO:GO:0060071 InterPro:IPR018161 PROSITE:PS00246 HOVERGEN:HBG001595
            KO:K01384 EMBL:L23542 EMBL:BC084745 PIR:I51572
            RefSeq:NP_001084327.1 UniGene:Xl.24008 IntAct:P49893 GeneID:399441
            KEGG:xla:399441 CTD:399441 Xenbase:XB-GENE-6079153 Uniprot:P49893
        Length = 353

 Score = 111 (44.1 bits), Expect = 7.7e-06, P = 7.7e-06
 Identities = 23/55 (41%), Positives = 28/55 (50%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSLFLTPKLTPDL 58
             G    Q+++CK   E+M  V  AA     TC     D RWNCSS+   P  TPDL
Sbjct:    48 GLVPDQSQLCKRNLELMQSVVNAAKQTKLTCQMTLSDMRWNCSSVENAPSFTPDL 102


>UNIPROTKB|H0Y663 [details] [associations]
            symbol:WNT4 "Protein Wnt" species:9606 "Homo sapiens"
            [GO:0005102 "receptor binding" evidence=IEA] [GO:0007275
            "multicellular organismal development" evidence=IEA] [GO:0016055
            "Wnt receptor signaling pathway" evidence=IEA] [GO:0005578
            "proteinaceous extracellular matrix" evidence=IEA]
            InterPro:IPR005817 InterPro:IPR009142 Pfam:PF00110 PRINTS:PR01844
            SMART:SM00097 PANTHER:PTHR12027 GO:GO:0007275 GO:GO:0016055
            GO:GO:0005578 EMBL:AL031281 PANTHER:PTHR12027:SF19 EMBL:AL445253
            HGNC:HGNC:12783 ProteinModelPortal:H0Y663 Ensembl:ENST00000415567
            Uniprot:H0Y663
        Length = 150

 Score = 100 (40.3 bits), Expect = 1.9e-05, P = 1.9e-05
 Identities = 20/49 (40%), Positives = 28/49 (57%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSLFLTP 52
             G  + Q ++CK   E+M  V + A LA   C   F++RRWNCS+L   P
Sbjct:    23 GLIQRQVQMCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLP 71


>UNIPROTKB|Q670P5 [details] [associations]
            symbol:wnt11 "Protein Wnt-11" species:8355 "Xenopus laevis"
            [GO:0000578 "embryonic axis specification" evidence=IDA]
            [GO:0001755 "neural crest cell migration" evidence=IMP] [GO:0003007
            "heart morphogenesis" evidence=IMP] [GO:0005576 "extracellular
            region" evidence=IDA] [GO:0010470 "regulation of gastrulation"
            evidence=IMP] [GO:0033337 "dorsal fin development" evidence=IMP]
            [GO:0035567 "non-canonical Wnt receptor signaling pathway"
            evidence=IMP] [GO:0046330 "positive regulation of JNK cascade"
            evidence=IMP] [GO:0048793 "pronephros development" evidence=IMP]
            [GO:0090090 "negative regulation of canonical Wnt receptor
            signaling pathway" evidence=IDA] [GO:0014036 "neural crest cell
            fate specification" evidence=IMP] InterPro:IPR005817 Pfam:PF00110
            PRINTS:PR01349 SMART:SM00097 PANTHER:PTHR12027 GO:GO:0005576
            GO:GO:0003007 GO:GO:0001755 GO:GO:0005578 GO:GO:0046330
            GO:GO:0090090 GO:GO:0007369 GO:GO:0000578 GO:GO:0048793
            GO:GO:0010470 GO:GO:0035567 InterPro:IPR018161 PROSITE:PS00246
            CTD:7481 HOVERGEN:HBG001595 KO:K01384 InterPro:IPR026536
            PANTHER:PTHR12027:SF7 EMBL:AY695415 EMBL:BC078589 EMBL:BC169466
            EMBL:BC169468 RefSeq:NP_001087079.1 UniGene:Xl.13686 GeneID:446915
            KEGG:xla:446915 Xenbase:XB-GENE-866540 GO:GO:0033337 Uniprot:Q670P5
        Length = 352

 Score = 106 (42.4 bits), Expect = 2.7e-05, P = 2.7e-05
 Identities = 21/55 (38%), Positives = 27/55 (49%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSLFLTPKLTPDL 58
             G    Q ++C+   E+M  +  AA     TC   F D RWNCSS+ L P    DL
Sbjct:    48 GLVSSQMQLCRSNLELMQTIIHAAKEVKKTCVKAFTDMRWNCSSIELAPTFHQDL 102


>UNIPROTKB|P49339 [details] [associations]
            symbol:WNT11 "Protein Wnt-11" species:9031 "Gallus gallus"
            [GO:0001649 "osteoblast differentiation" evidence=IBA] [GO:0001664
            "G-protein coupled receptor binding" evidence=IBA] [GO:0003151
            "outflow tract morphogenesis" evidence=IBA] [GO:0005615
            "extracellular space" evidence=IBA] [GO:0005886 "plasma membrane"
            evidence=IBA] [GO:0007492 "endoderm development" evidence=IBA]
            [GO:0009798 "axis specification" evidence=IBA] [GO:0009952
            "anterior/posterior pattern specification" evidence=IBA]
            [GO:0030282 "bone mineralization" evidence=IBA] [GO:0032915
            "positive regulation of transforming growth factor beta2
            production" evidence=IBA] [GO:0048844 "artery morphogenesis"
            evidence=IBA] [GO:0060021 "palate development" evidence=ISS;IBA]
            [GO:0060412 "ventricular septum morphogenesis" evidence=IBA]
            [GO:0070830 "tight junction assembly" evidence=IBA] [GO:0090090
            "negative regulation of canonical Wnt receptor signaling pathway"
            evidence=ISS;IBA] [GO:0005578 "proteinaceous extracellular matrix"
            evidence=IEA] [GO:0030325 "adrenal gland development" evidence=IEA]
            [GO:0035567 "non-canonical Wnt receptor signaling pathway"
            evidence=IEA] [GO:0043065 "positive regulation of apoptotic
            process" evidence=IEA] [GO:0048706 "embryonic skeletal system
            development" evidence=IEA] [GO:0060070 "canonical Wnt receptor
            signaling pathway" evidence=IEA] [GO:0060197 "cloacal septation"
            evidence=IEA] [GO:0060484 "lung-associated mesenchyme development"
            evidence=IEA] [GO:0060675 "ureteric bud morphogenesis"
            evidence=IEA] [GO:0072177 "mesonephric duct development"
            evidence=IEA] [GO:0072201 "negative regulation of mesenchymal cell
            proliferation" evidence=IEA] [GO:0090272 "negative regulation of
            fibroblast growth factor production" evidence=IEA] [GO:0006468
            "protein phosphorylation" evidence=ISS] [GO:0010628 "positive
            regulation of gene expression" evidence=ISS] [GO:0030308 "negative
            regulation of cell growth" evidence=ISS] [GO:0030335 "positive
            regulation of cell migration" evidence=ISS] [GO:0032320 "positive
            regulation of Ras GTPase activity" evidence=ISS] [GO:0034394
            "protein localization to cell surface" evidence=ISS] [GO:0043066
            "negative regulation of apoptotic process" evidence=ISS]
            [GO:0045893 "positive regulation of transcription, DNA-dependent"
            evidence=ISS] [GO:0051496 "positive regulation of stress fiber
            assembly" evidence=ISS] [GO:0060548 "negative regulation of cell
            death" evidence=ISS] [GO:0061101 "neuroendocrine cell
            differentiation" evidence=ISS] [GO:0090037 "positive regulation of
            protein kinase C signaling cascade" evidence=ISS] [GO:0005099 "Ras
            GTPase activator activity" evidence=ISS] [GO:0044212 "transcription
            regulatory region DNA binding" evidence=ISS] [GO:0030295 "protein
            kinase activator activity" evidence=ISS] [GO:0005737 "cytoplasm"
            evidence=ISS] [GO:0045892 "negative regulation of transcription,
            DNA-dependent" evidence=ISS] [GO:0030336 "negative regulation of
            cell migration" evidence=ISS] InterPro:IPR005817 Pfam:PF00110
            PRINTS:PR01349 SMART:SM00097 PANTHER:PTHR12027 GO:GO:0005886
            GO:GO:0005737 GO:GO:0045892 GO:GO:0045893 GO:GO:0043066
            GO:GO:0005615 GO:GO:0030308 GO:GO:0009952 GO:GO:0005099
            GO:GO:0005578 GO:GO:0051496 GO:GO:0006468 GO:GO:0030295
            GO:GO:0030336 GO:GO:0044212 GO:GO:0043065 GO:GO:0090037
            GO:GO:0030335 GO:GO:0090090 GO:GO:0001649 GO:GO:0060021
            GO:GO:0030282 GO:GO:0001664 GO:GO:0048844 GO:GO:0034394
            GO:GO:0007492 GO:GO:0003151 GO:GO:0009798 GO:GO:0060070
            GO:GO:0070830 GO:GO:0032915 GO:GO:0061101 GO:GO:0060412
            GO:GO:0072201 GO:GO:0035567 InterPro:IPR018161 PROSITE:PS00246
            CTD:7481 eggNOG:NOG273917 HOGENOM:HOG000039529 HOVERGEN:HBG001595
            KO:K01384 EMBL:D31901 IPI:IPI00571216 PIR:JC4152 RefSeq:NP_990115.1
            UniGene:Gga.306 STRING:P49339 PRIDE:P49339
            Ensembl:ENSGALT00000001231 GeneID:395562 KEGG:gga:395562
            GeneTree:ENSGT00700000104317 InParanoid:P49339 OMA:ELIYLQS
            OrthoDB:EOG4FR0RT NextBio:20815637 InterPro:IPR026536
            PANTHER:PTHR12027:SF7 Uniprot:P49339
        Length = 354

 Score = 106 (42.4 bits), Expect = 2.7e-05, P = 2.7e-05
 Identities = 21/55 (38%), Positives = 28/55 (50%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSLFLTPKLTPDL 58
             G    Q ++C+   E+M  + +AA     TC   F D RWNCSS+ L P    DL
Sbjct:    50 GLVVSQVQLCRSNLELMQTIIQAAREVIKTCRKTFSDMRWNCSSIELAPNYLLDL 104


>UNIPROTKB|P51891 [details] [associations]
            symbol:WNT11 "Protein Wnt-11" species:93934 "Coturnix
            japonica" [GO:0005099 "Ras GTPase activator activity" evidence=ISS]
            [GO:0005737 "cytoplasm" evidence=ISS] [GO:0006468 "protein
            phosphorylation" evidence=ISS] [GO:0010628 "positive regulation of
            gene expression" evidence=ISS] [GO:0030295 "protein kinase
            activator activity" evidence=ISS] [GO:0030308 "negative regulation
            of cell growth" evidence=ISS] [GO:0030335 "positive regulation of
            cell migration" evidence=ISS] [GO:0030336 "negative regulation of
            cell migration" evidence=ISS] [GO:0032320 "positive regulation of
            Ras GTPase activity" evidence=ISS] [GO:0034394 "protein
            localization to cell surface" evidence=ISS] [GO:0043066 "negative
            regulation of apoptotic process" evidence=ISS] [GO:0044212
            "transcription regulatory region DNA binding" evidence=ISS]
            [GO:0045860 "positive regulation of protein kinase activity"
            evidence=ISS] [GO:0045892 "negative regulation of transcription,
            DNA-dependent" evidence=ISS] [GO:0045893 "positive regulation of
            transcription, DNA-dependent" evidence=ISS] [GO:0051496 "positive
            regulation of stress fiber assembly" evidence=ISS] [GO:0060021
            "palate development" evidence=ISS] [GO:0060548 "negative regulation
            of cell death" evidence=ISS] [GO:0061101 "neuroendocrine cell
            differentiation" evidence=ISS] [GO:0090037 "positive regulation of
            protein kinase C signaling cascade" evidence=ISS] [GO:0090090
            "negative regulation of canonical Wnt receptor signaling pathway"
            evidence=ISS] InterPro:IPR005817 Pfam:PF00110 PRINTS:PR01349
            SMART:SM00097 PANTHER:PTHR12027 GO:GO:0007275 GO:GO:0005737
            GO:GO:0045892 GO:GO:0045893 GO:GO:0043066 GO:GO:0030308
            GO:GO:0016055 GO:GO:0005099 GO:GO:0005578 GO:GO:0051496
            GO:GO:0006468 GO:GO:0030295 GO:GO:0030336 GO:GO:0044212
            GO:GO:0090037 GO:GO:0030335 GO:GO:0090090 GO:GO:0060021
            GO:GO:0034394 GO:GO:0061101 InterPro:IPR018161 PROSITE:PS00246
            HOVERGEN:HBG001595 InterPro:IPR026536 PANTHER:PTHR12027:SF7
            EMBL:X97549 Uniprot:P51891
        Length = 354

 Score = 106 (42.4 bits), Expect = 2.7e-05, P = 2.7e-05
 Identities = 21/55 (38%), Positives = 28/55 (50%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSLFLTPKLTPDL 58
             G    Q ++C+   E+M  + +AA     TC   F D RWNCSS+ L P    DL
Sbjct:    50 GLVVSQVQLCRSNLELMQTIIQAAREVIKTCRKTFSDMRWNCSSIELAPNYLLDL 104


>UNIPROTKB|B2GUT4 [details] [associations]
            symbol:wnt11 "Protein Wnt-11" species:8364 "Xenopus
            (Silurana) tropicalis" [GO:0001755 "neural crest cell migration"
            evidence=ISS] [GO:0003007 "heart morphogenesis" evidence=ISS]
            [GO:0005099 "Ras GTPase activator activity" evidence=ISS]
            [GO:0005576 "extracellular region" evidence=ISS] [GO:0005737
            "cytoplasm" evidence=ISS] [GO:0006468 "protein phosphorylation"
            evidence=ISS] [GO:0010470 "regulation of gastrulation"
            evidence=ISS] [GO:0010628 "positive regulation of gene expression"
            evidence=ISS] [GO:0030295 "protein kinase activator activity"
            evidence=ISS] [GO:0030308 "negative regulation of cell growth"
            evidence=ISS] [GO:0030335 "positive regulation of cell migration"
            evidence=ISS] [GO:0030336 "negative regulation of cell migration"
            evidence=ISS] [GO:0032320 "positive regulation of Ras GTPase
            activity" evidence=ISS] [GO:0033337 "dorsal fin development"
            evidence=ISS] [GO:0034394 "protein localization to cell surface"
            evidence=ISS] [GO:0035567 "non-canonical Wnt receptor signaling
            pathway" evidence=ISS] [GO:0043066 "negative regulation of
            apoptotic process" evidence=ISS] [GO:0044212 "transcription
            regulatory region DNA binding" evidence=ISS] [GO:0045860 "positive
            regulation of protein kinase activity" evidence=ISS] [GO:0045892
            "negative regulation of transcription, DNA-dependent" evidence=ISS]
            [GO:0045893 "positive regulation of transcription, DNA-dependent"
            evidence=ISS] [GO:0046330 "positive regulation of JNK cascade"
            evidence=ISS] [GO:0048793 "pronephros development" evidence=ISS]
            [GO:0051496 "positive regulation of stress fiber assembly"
            evidence=ISS] [GO:0060021 "palate development" evidence=ISS]
            [GO:0060548 "negative regulation of cell death" evidence=ISS]
            [GO:0061101 "neuroendocrine cell differentiation" evidence=ISS]
            [GO:0090037 "positive regulation of protein kinase C signaling
            cascade" evidence=ISS] [GO:0090090 "negative regulation of
            canonical Wnt receptor signaling pathway" evidence=ISS] [GO:0014036
            "neural crest cell fate specification" evidence=ISS]
            InterPro:IPR005817 Pfam:PF00110 PRINTS:PR01349 SMART:SM00097
            PANTHER:PTHR12027 GO:GO:0005737 GO:GO:0045892 GO:GO:0045893
            GO:GO:0043066 GO:GO:0005576 GO:GO:0030308 GO:GO:0005099
            GO:GO:0003007 GO:GO:0001755 GO:GO:0005578 GO:GO:0046330
            GO:GO:0051496 GO:GO:0006468 GO:GO:0030295 GO:GO:0030336
            GO:GO:0044212 GO:GO:0090037 GO:GO:0030335 GO:GO:0090090
            GO:GO:0060021 GO:GO:0042074 GO:GO:0034394 GO:GO:0061101
            GO:GO:0048793 GO:GO:0010470 GO:GO:0035567 InterPro:IPR018161
            PROSITE:PS00246 eggNOG:NOG273917 HOGENOM:HOG000039529
            HOVERGEN:HBG001595 KO:K01384 OrthoDB:EOG4FR0RT InterPro:IPR026536
            PANTHER:PTHR12027:SF7 GO:GO:0033337 EMBL:BC166399
            RefSeq:NP_001121530.1 UniGene:Str.57693 ProteinModelPortal:B2GUT4
            STRING:B2GUT4 GeneID:100158655 KEGG:xtr:100158655 CTD:30283
            Xenbase:XB-GENE-854158 Bgee:B2GUT4 Uniprot:B2GUT4
        Length = 352

 Score = 105 (42.0 bits), Expect = 3.5e-05, P = 3.5e-05
 Identities = 21/55 (38%), Positives = 27/55 (49%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSLFLTPKLTPDL 58
             G    Q ++C+   E+M  +  AA     TC   F D RWNCSS+ L P    DL
Sbjct:    48 GLVSSQMQLCRSNLELMQTIIHAAKEVKKTCIKAFTDMRWNCSSIELAPTFHQDL 102


>ZFIN|ZDB-GENE-980526-352 [details] [associations]
            symbol:wnt4a "wingless-type MMTV integration site
            family, member 4a" species:7955 "Danio rerio" [GO:0005102 "receptor
            binding" evidence=IEA] [GO:0005576 "extracellular region"
            evidence=IEA] [GO:0016055 "Wnt receptor signaling pathway"
            evidence=IEA] [GO:0007275 "multicellular organismal development"
            evidence=IEA;IMP] [GO:0060129 "thyroid-stimulating
            hormone-secreting cell differentiation" evidence=IBA] [GO:0009798
            "axis specification" evidence=IBA] [GO:0051145 "smooth muscle cell
            differentiation" evidence=IBA] [GO:0009952 "anterior/posterior
            pattern specification" evidence=IBA] [GO:0005615 "extracellular
            space" evidence=IBA] [GO:0008584 "male gonad development"
            evidence=IBA] [GO:0060126 "somatotropin secreting cell
            differentiation" evidence=IBA] [GO:0008585 "female gonad
            development" evidence=IBA] [GO:0001658 "branching involved in
            ureteric bud morphogenesis" evidence=IBA] [GO:0005794 "Golgi
            apparatus" evidence=IBA] [GO:0005886 "plasma membrane"
            evidence=IBA] [GO:0072164 "mesonephric tubule development"
            evidence=IBA] [GO:0040037 "negative regulation of fibroblast growth
            factor receptor signaling pathway" evidence=IBA] [GO:0001656
            "metanephros development" evidence=IBA] [GO:0001664 "G-protein
            coupled receptor binding" evidence=IBA] [GO:0048599 "oocyte
            development" evidence=IBA] [GO:0007492 "endoderm development"
            evidence=IBA] [GO:0072033 "renal vesicle formation" evidence=IBA]
            [GO:0060748 "tertiary branching involved in mammary gland duct
            morphogenesis" evidence=IBA] [GO:0060070 "canonical Wnt receptor
            signaling pathway" evidence=IBA] [GO:0070654 "sensory epithelium
            regeneration" evidence=IEP] [GO:0021986 "habenula development"
            evidence=IMP] [GO:0045893 "positive regulation of transcription,
            DNA-dependent" evidence=IPI] [GO:0007507 "heart development"
            evidence=IGI] [GO:0042074 "cell migration involved in gastrulation"
            evidence=IMP] [GO:0005578 "proteinaceous extracellular matrix"
            evidence=IEA] InterPro:IPR005817 InterPro:IPR009142 Pfam:PF00110
            PRINTS:PR01349 PRINTS:PR01844 SMART:SM00097
            ZFIN:ZDB-GENE-980526-352 PANTHER:PTHR12027 GO:GO:0005886
            GO:GO:0005794 GO:GO:0045893 GO:GO:0005615 GO:GO:0007507
            GO:GO:0008585 GO:GO:0009952 GO:GO:0005578 GO:GO:0008584
            GO:GO:0051145 GO:GO:0001664 GO:GO:0042074 GO:GO:0060748
            GO:GO:0007492 GO:GO:0001658 GO:GO:0009798 GO:GO:0060070
            GO:GO:0001656 GO:GO:0048599 GO:GO:0070654 GO:GO:0060129
            GO:GO:0040037 GO:GO:0072033 InterPro:IPR018161 PROSITE:PS00246
            KO:K00408 GO:GO:0021986 GO:GO:0072164 GO:GO:0060126
            HOVERGEN:HBG001595 GeneTree:ENSGT00690000101771 OMA:QVQICKR
            PANTHER:PTHR12027:SF19 EMBL:BC115247 EMBL:BC163457 EMBL:BC163474
            IPI:IPI00500843 RefSeq:NP_001035477.1 UniGene:Dr.385 STRING:Q1RLW9
            GeneID:30123 KEGG:dre:30123 CTD:30123 InParanoid:Q1RLW9
            NextBio:20806602 Uniprot:Q1RLW9
        Length = 352

 Score = 105 (42.0 bits), Expect = 3.5e-05, P = 3.5e-05
 Identities = 21/49 (42%), Positives = 29/49 (59%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSLFLTP 52
             G  + Q +ICK   E+M  V + A LA + C   F++RRWNCS+L   P
Sbjct:    48 GLIQRQVQICKRNVEVMDAVRRGAQLAIDECQYQFRNRRWNCSTLESVP 96


>UNIPROTKB|Q3Y524 [details] [associations]
            symbol:Q3Y524 "Protein Wnt" species:10036 "Mesocricetus
            auratus" [GO:0005099 "Ras GTPase activator activity" evidence=ISS]
            [GO:0005737 "cytoplasm" evidence=ISS] [GO:0006468 "protein
            phosphorylation" evidence=ISS] [GO:0010628 "positive regulation of
            gene expression" evidence=ISS] [GO:0030295 "protein kinase
            activator activity" evidence=ISS] [GO:0030308 "negative regulation
            of cell growth" evidence=ISS] [GO:0030335 "positive regulation of
            cell migration" evidence=ISS] [GO:0030336 "negative regulation of
            cell migration" evidence=ISS] [GO:0032320 "positive regulation of
            Ras GTPase activity" evidence=ISS] [GO:0034394 "protein
            localization to cell surface" evidence=ISS] [GO:0043066 "negative
            regulation of apoptotic process" evidence=ISS] [GO:0044212
            "transcription regulatory region DNA binding" evidence=ISS]
            [GO:0045860 "positive regulation of protein kinase activity"
            evidence=ISS] [GO:0045892 "negative regulation of transcription,
            DNA-dependent" evidence=ISS] [GO:0045893 "positive regulation of
            transcription, DNA-dependent" evidence=ISS] [GO:0051496 "positive
            regulation of stress fiber assembly" evidence=ISS] [GO:0060021
            "palate development" evidence=ISS] [GO:0060548 "negative regulation
            of cell death" evidence=ISS] [GO:0061101 "neuroendocrine cell
            differentiation" evidence=ISS] [GO:0090037 "positive regulation of
            protein kinase C signaling cascade" evidence=ISS] [GO:0090090
            "negative regulation of canonical Wnt receptor signaling pathway"
            evidence=ISS] InterPro:IPR005817 Pfam:PF00110 PRINTS:PR01349
            SMART:SM00097 PANTHER:PTHR12027 GO:GO:0007275 GO:GO:0005737
            GO:GO:0045892 GO:GO:0045893 GO:GO:0043066 GO:GO:0030308
            GO:GO:0016055 GO:GO:0005099 GO:GO:0005578 GO:GO:0051496
            GO:GO:0006468 GO:GO:0030295 GO:GO:0030336 GO:GO:0044212
            GO:GO:0090037 GO:GO:0030335 GO:GO:0090090 GO:GO:0060021
            GO:GO:0034394 GO:GO:0061101 InterPro:IPR018161 PROSITE:PS00246
            HOVERGEN:HBG001595 InterPro:IPR026536 PANTHER:PTHR12027:SF7
            EMBL:DQ159287 Uniprot:Q3Y524
        Length = 354

 Score = 104 (41.7 bits), Expect = 4.5e-05, P = 4.5e-05
 Identities = 21/55 (38%), Positives = 27/55 (49%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSLFLTPKLTPDL 58
             G    Q ++C+   E+M  +  AA  A   C   F D RWNCSS+ L P    DL
Sbjct:    50 GLVSAQVQLCRSNLELMRTIVHAAREAMKACRRAFADMRWNCSSIELAPNYLLDL 104


>UNIPROTKB|G3V819 [details] [associations]
            symbol:Wnt11 "Protein Wnt" species:10116 "Rattus
            norvegicus" [GO:0001649 "osteoblast differentiation" evidence=IEA]
            [GO:0003151 "outflow tract morphogenesis" evidence=IEA] [GO:0005099
            "Ras GTPase activator activity" evidence=IEA] [GO:0005102 "receptor
            binding" evidence=IEA] [GO:0005578 "proteinaceous extracellular
            matrix" evidence=IEA] [GO:0005737 "cytoplasm" evidence=IEA]
            [GO:0006468 "protein phosphorylation" evidence=IEA] [GO:0030282
            "bone mineralization" evidence=IEA] [GO:0030295 "protein kinase
            activator activity" evidence=IEA] [GO:0030308 "negative regulation
            of cell growth" evidence=IEA] [GO:0030325 "adrenal gland
            development" evidence=IEA] [GO:0030335 "positive regulation of cell
            migration" evidence=IEA] [GO:0030336 "negative regulation of cell
            migration" evidence=IEA] [GO:0032915 "positive regulation of
            transforming growth factor beta2 production" evidence=IEA]
            [GO:0034394 "protein localization to cell surface" evidence=IEA]
            [GO:0035567 "non-canonical Wnt receptor signaling pathway"
            evidence=IEA] [GO:0043065 "positive regulation of apoptotic
            process" evidence=IEA] [GO:0043066 "negative regulation of
            apoptotic process" evidence=IEA] [GO:0044212 "transcription
            regulatory region DNA binding" evidence=IEA] [GO:0045892 "negative
            regulation of transcription, DNA-dependent" evidence=IEA]
            [GO:0045893 "positive regulation of transcription, DNA-dependent"
            evidence=IEA] [GO:0048706 "embryonic skeletal system development"
            evidence=IEA] [GO:0048844 "artery morphogenesis" evidence=IEA]
            [GO:0051496 "positive regulation of stress fiber assembly"
            evidence=IEA] [GO:0060021 "palate development" evidence=IEA]
            [GO:0060070 "canonical Wnt receptor signaling pathway"
            evidence=IEA] [GO:0060197 "cloacal septation" evidence=IEA]
            [GO:0060412 "ventricular septum morphogenesis" evidence=IEA]
            [GO:0060484 "lung-associated mesenchyme development" evidence=IEA]
            [GO:0060675 "ureteric bud morphogenesis" evidence=IEA] [GO:0061101
            "neuroendocrine cell differentiation" evidence=IEA] [GO:0070830
            "tight junction assembly" evidence=IEA] [GO:0072177 "mesonephric
            duct development" evidence=IEA] [GO:0072201 "negative regulation of
            mesenchymal cell proliferation" evidence=IEA] [GO:0090037 "positive
            regulation of protein kinase C signaling cascade" evidence=IEA]
            [GO:0090090 "negative regulation of canonical Wnt receptor
            signaling pathway" evidence=IEA] [GO:0090272 "negative regulation
            of fibroblast growth factor production" evidence=IEA]
            InterPro:IPR005817 Pfam:PF00110 PRINTS:PR01349 SMART:SM00097
            RGD:621463 PANTHER:PTHR12027 GO:GO:0007275 GO:GO:0016055
            EMBL:CH473956 GO:GO:0005578 InterPro:IPR018161 PROSITE:PS00246
            CTD:7481 KO:K01384 GeneTree:ENSGT00700000104317 OMA:ELIYLQS
            InterPro:IPR026536 PANTHER:PTHR12027:SF7 RefSeq:NP_536326.1
            UniGene:Rn.222290 Ensembl:ENSRNOT00000021674 GeneID:140584
            KEGG:rno:140584 NextBio:620518 Uniprot:G3V819
        Length = 354

 Score = 104 (41.7 bits), Expect = 4.5e-05, P = 4.5e-05
 Identities = 21/55 (38%), Positives = 27/55 (49%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSLFLTPKLTPDL 58
             G    Q ++C+   E+M  +  AA  A   C   F D RWNCSS+ L P    DL
Sbjct:    50 GLVSAQVQLCRSNLELMRTIVHAAREAMKACRRAFADMRWNCSSIELAPNYLLDL 104


>UNIPROTKB|E9PJL6 [details] [associations]
            symbol:WNT11 "Protein Wnt" species:9606 "Homo sapiens"
            [GO:0005102 "receptor binding" evidence=IEA] [GO:0007275
            "multicellular organismal development" evidence=IEA] [GO:0016055
            "Wnt receptor signaling pathway" evidence=IEA] [GO:0005578
            "proteinaceous extracellular matrix" evidence=IEA]
            InterPro:IPR005817 Pfam:PF00110 PRINTS:PR01349 SMART:SM00097
            PANTHER:PTHR12027 GO:GO:0007275 GO:GO:0016055 GO:GO:0005578
            InterPro:IPR026536 PANTHER:PTHR12027:SF7 HGNC:HGNC:12776
            EMBL:AP000785 IPI:IPI00977509 Ensembl:ENST00000531317
            ArrayExpress:E9PJL6 Bgee:E9PJL6 Uniprot:E9PJL6
        Length = 253

 Score = 101 (40.6 bits), Expect = 5.1e-05, P = 5.1e-05
 Identities = 21/55 (38%), Positives = 26/55 (47%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSLFLTPKLTPDL 58
             G    Q ++C+   E+M  V  AA      C   F D RWNCSS+ L P    DL
Sbjct:    50 GLVSAQVQLCRSNLELMHTVVHAAREVMKACRRAFADMRWNCSSIELAPNYLLDL 104


>ZFIN|ZDB-GENE-980526-249 [details] [associations]
            symbol:wnt11r "wingless-type MMTV integration site
            family, member 11, related" species:7955 "Danio rerio" [GO:0005102
            "receptor binding" evidence=IEA] [GO:0005576 "extracellular region"
            evidence=IEA] [GO:0016055 "Wnt receptor signaling pathway"
            evidence=IEA] [GO:0007275 "multicellular organismal development"
            evidence=IEA] [GO:0030282 "bone mineralization" evidence=IBA]
            [GO:0005886 "plasma membrane" evidence=IBA] [GO:0001649 "osteoblast
            differentiation" evidence=IBA] [GO:0009798 "axis specification"
            evidence=IBA] [GO:0070830 "tight junction assembly" evidence=IBA]
            [GO:0090090 "negative regulation of canonical Wnt receptor
            signaling pathway" evidence=IBA] [GO:0003151 "outflow tract
            morphogenesis" evidence=IBA] [GO:0005615 "extracellular space"
            evidence=IBA] [GO:0009952 "anterior/posterior pattern
            specification" evidence=IBA] [GO:0032915 "positive regulation of
            transforming growth factor beta2 production" evidence=IBA]
            [GO:0048844 "artery morphogenesis" evidence=IBA] [GO:0007492
            "endoderm development" evidence=IBA] [GO:0060021 "palate
            development" evidence=IBA] [GO:0001664 "G-protein coupled receptor
            binding" evidence=IBA] [GO:0060412 "ventricular septum
            morphogenesis" evidence=IBA] [GO:0005578 "proteinaceous
            extracellular matrix" evidence=IEA] [GO:0042074 "cell migration
            involved in gastrulation" evidence=IMP] [GO:0007507 "heart
            development" evidence=IGI] InterPro:IPR005817 Pfam:PF00110
            PRINTS:PR01349 SMART:SM00097 ZFIN:ZDB-GENE-980526-249
            PANTHER:PTHR12027 GO:GO:0005886 GO:GO:0005615 GO:GO:0016055
            GO:GO:0009952 GO:GO:0005578 GO:GO:0090090 GO:GO:0001649
            GO:GO:0060021 GO:GO:0030282 GO:GO:0001664 GO:GO:0042074
            GO:GO:0048844 GO:GO:0007492 GO:GO:0003151 GO:GO:0009798
            GO:GO:0070830 GO:GO:0032915 GO:GO:0060412 InterPro:IPR018161
            PROSITE:PS00246 eggNOG:NOG273917 HOGENOM:HOG000039529
            HOVERGEN:HBG001595 KO:K01384 GeneTree:ENSGT00700000104317
            OMA:ELIYLQS OrthoDB:EOG4FR0RT InterPro:IPR026536
            PANTHER:PTHR12027:SF7 CTD:30283 EMBL:CU467651 EMBL:AF249266
            EMBL:BC066498 IPI:IPI00508897 RefSeq:NP_571151.1 UniGene:Dr.76466
            STRING:Q9I9I2 Ensembl:ENSDART00000099880 GeneID:30283
            KEGG:dre:30283 InParanoid:Q9I9I2 NextBio:20806727 Uniprot:Q9I9I2
        Length = 352

 Score = 103 (41.3 bits), Expect = 5.7e-05, P = 5.7e-05
 Identities = 21/55 (38%), Positives = 28/55 (50%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSLFLTPKLTPDL 58
             G    Q ++C+   E+M  + +AA      C   F D RWNCSS+   PK  PDL
Sbjct:    48 GLVSSQAQLCRSNLELMQTIIQAAREVKKVCQKTFTDMRWNCSSID-GPKFLPDL 101


>UNIPROTKB|Q27Q51 [details] [associations]
            symbol:Wnt-11 "Protein Wnt" species:9986 "Oryctolagus
            cuniculus" [GO:0005099 "Ras GTPase activator activity"
            evidence=ISS] [GO:0005737 "cytoplasm" evidence=ISS] [GO:0006468
            "protein phosphorylation" evidence=ISS] [GO:0010628 "positive
            regulation of gene expression" evidence=ISS] [GO:0030295 "protein
            kinase activator activity" evidence=ISS] [GO:0030308 "negative
            regulation of cell growth" evidence=ISS] [GO:0030335 "positive
            regulation of cell migration" evidence=ISS] [GO:0030336 "negative
            regulation of cell migration" evidence=ISS] [GO:0032320 "positive
            regulation of Ras GTPase activity" evidence=ISS] [GO:0034394
            "protein localization to cell surface" evidence=ISS] [GO:0043066
            "negative regulation of apoptotic process" evidence=ISS]
            [GO:0044212 "transcription regulatory region DNA binding"
            evidence=ISS] [GO:0045892 "negative regulation of transcription,
            DNA-dependent" evidence=ISS] [GO:0045893 "positive regulation of
            transcription, DNA-dependent" evidence=ISS] [GO:0051496 "positive
            regulation of stress fiber assembly" evidence=ISS] [GO:0060021
            "palate development" evidence=ISS] [GO:0060548 "negative regulation
            of cell death" evidence=ISS] [GO:0061101 "neuroendocrine cell
            differentiation" evidence=ISS] [GO:0090037 "positive regulation of
            protein kinase C signaling cascade" evidence=ISS] [GO:0090090
            "negative regulation of canonical Wnt receptor signaling pathway"
            evidence=ISS] InterPro:IPR005817 Pfam:PF00110 PRINTS:PR01349
            SMART:SM00097 PANTHER:PTHR12027 GO:GO:0005737 GO:GO:0045892
            GO:GO:0045893 GO:GO:0043066 GO:GO:0030308 GO:GO:0030325
            GO:GO:0005099 GO:GO:0005578 GO:GO:0051496 GO:GO:0006468
            GO:GO:0030295 GO:GO:0030336 GO:GO:0044212 GO:GO:0043065
            GO:GO:0090037 GO:GO:0030335 GO:GO:0090090 GO:GO:0001649
            GO:GO:0060021 GO:GO:0030282 GO:GO:0048844 GO:GO:0034394
            GO:GO:0003151 GO:GO:0060070 GO:GO:0070830 GO:GO:0032915
            GO:GO:0048706 GO:GO:0061101 GO:GO:0060197 GO:GO:0060675
            GO:GO:0090272 GO:GO:0060412 GO:GO:0072201 GO:GO:0060484
            GO:GO:0035567 GO:GO:0072177 InterPro:IPR018161 PROSITE:PS00246
            eggNOG:NOG273917 HOGENOM:HOG000039529 HOVERGEN:HBG001595
            GeneTree:ENSGT00700000104317 OMA:ELIYLQS OrthoDB:EOG4FR0RT
            InterPro:IPR026536 PANTHER:PTHR12027:SF7 EMBL:AAGW02008246
            EMBL:DQ388601 RefSeq:NP_001075693.1 UniGene:Ocu.2575
            Ensembl:ENSOCUT00000001725 GeneID:100009030 CTD:100009030
            Uniprot:Q27Q51
        Length = 354

 Score = 103 (41.3 bits), Expect = 5.8e-05, P = 5.8e-05
 Identities = 20/55 (36%), Positives = 27/55 (49%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSLFLTPKLTPDL 58
             G    Q ++C+   E+M  + +AA      C   F D RWNCSS+ L P    DL
Sbjct:    50 GLVSAQVQLCRSNLELMHTIVRAAREVMKACRRAFADMRWNCSSIELAPNYLLDL 104


>MGI|MGI:101948 [details] [associations]
            symbol:Wnt11 "wingless-related MMTV integration site 11"
            species:10090 "Mus musculus" [GO:0000122 "negative regulation of
            transcription from RNA polymerase II promoter" evidence=IBA]
            [GO:0001649 "osteoblast differentiation" evidence=IGI] [GO:0001664
            "G-protein coupled receptor binding" evidence=IBA] [GO:0001822
            "kidney development" evidence=IDA] [GO:0003151 "outflow tract
            morphogenesis" evidence=IMP] [GO:0005099 "Ras GTPase activator
            activity" evidence=ISO] [GO:0005102 "receptor binding"
            evidence=TAS] [GO:0005515 "protein binding" evidence=IPI]
            [GO:0005576 "extracellular region" evidence=IDA] [GO:0005578
            "proteinaceous extracellular matrix" evidence=IEA] [GO:0005615
            "extracellular space" evidence=IBA] [GO:0005737 "cytoplasm"
            evidence=ISO;IDA] [GO:0005886 "plasma membrane" evidence=IBA]
            [GO:0006468 "protein phosphorylation" evidence=ISO] [GO:0007165
            "signal transduction" evidence=TAS] [GO:0007267 "cell-cell
            signaling" evidence=TAS] [GO:0007275 "multicellular organismal
            development" evidence=IEA] [GO:0007492 "endoderm development"
            evidence=IBA] [GO:0009798 "axis specification" evidence=IBA]
            [GO:0009887 "organ morphogenesis" evidence=TAS] [GO:0009952
            "anterior/posterior pattern specification" evidence=IBA]
            [GO:0010628 "positive regulation of gene expression" evidence=ISO]
            [GO:0016055 "Wnt receptor signaling pathway" evidence=IEA]
            [GO:0030282 "bone mineralization" evidence=IGI] [GO:0030295
            "protein kinase activator activity" evidence=ISO] [GO:0030308
            "negative regulation of cell growth" evidence=ISO] [GO:0030335
            "positive regulation of cell migration" evidence=ISO] [GO:0030336
            "negative regulation of cell migration" evidence=ISO] [GO:0031012
            "extracellular matrix" evidence=IDA] [GO:0032320 "positive
            regulation of Ras GTPase activity" evidence=ISO] [GO:0032915
            "positive regulation of transforming growth factor beta2
            production" evidence=IMP] [GO:0034394 "protein localization to cell
            surface" evidence=ISO] [GO:0035567 "non-canonical Wnt receptor
            signaling pathway" evidence=IMP] [GO:0043065 "positive regulation
            of apoptotic process" evidence=IMP] [GO:0043066 "negative
            regulation of apoptotic process" evidence=ISO] [GO:0044212
            "transcription regulatory region DNA binding" evidence=ISO]
            [GO:0045860 "positive regulation of protein kinase activity"
            evidence=ISO] [GO:0045892 "negative regulation of transcription,
            DNA-dependent" evidence=ISO] [GO:0045893 "positive regulation of
            transcription, DNA-dependent" evidence=ISO] [GO:0048844 "artery
            morphogenesis" evidence=IMP] [GO:0051496 "positive regulation of
            stress fiber assembly" evidence=ISO] [GO:0060021 "palate
            development" evidence=ISO;IMP] [GO:0060070 "canonical Wnt receptor
            signaling pathway" evidence=IDA] [GO:0060412 "ventricular septum
            morphogenesis" evidence=IMP] [GO:0060548 "negative regulation of
            cell death" evidence=ISO] [GO:0061101 "neuroendocrine cell
            differentiation" evidence=ISO] [GO:0070830 "tight junction
            assembly" evidence=IMP] [GO:0072201 "negative regulation of
            mesenchymal cell proliferation" evidence=IMP] [GO:0090037 "positive
            regulation of protein kinase C signaling cascade" evidence=ISO]
            [GO:0090090 "negative regulation of canonical Wnt receptor
            signaling pathway" evidence=ISO;IDA] [GO:0090272 "negative
            regulation of fibroblast growth factor production" evidence=IMP]
            InterPro:IPR005817 Pfam:PF00110 PRINTS:PR01349 SMART:SM00097
            MGI:MGI:101948 PANTHER:PTHR12027 GO:GO:0005886 GO:GO:0005737
            GO:GO:0045893 GO:GO:0043066 GO:GO:0005615 GO:GO:0030308
            GO:GO:0030325 GO:GO:0009952 GO:GO:0005099 GO:GO:0005578
            GO:GO:0051496 GO:GO:0006468 GO:GO:0007267 GO:GO:0030295
            GO:GO:0000122 GO:GO:0030336 GO:GO:0044212 GO:GO:0043065
            GO:GO:0001822 GO:GO:0090037 GO:GO:0030335 GO:GO:0031012
            GO:GO:0090090 GO:GO:0001649 GO:GO:0060021 GO:GO:0030282
            GO:GO:0001664 GO:GO:0048844 GO:GO:0034394 GO:GO:0007492
            GO:GO:0003151 GO:GO:0009798 GO:GO:0060070 GO:GO:0070830
            GO:GO:0032915 GO:GO:0048706 GO:GO:0061101 GO:GO:0060197
            GO:GO:0060675 GO:GO:0090272 GO:GO:0060412 GO:GO:0072201
            GO:GO:0060484 GO:GO:0035567 GO:GO:0072177 InterPro:IPR018161
            PROSITE:PS00246 CTD:7481 eggNOG:NOG273917 HOGENOM:HOG000039529
            HOVERGEN:HBG001595 KO:K01384 OMA:ELIYLQS OrthoDB:EOG4FR0RT
            InterPro:IPR026536 PANTHER:PTHR12027:SF7 EMBL:X70800
            IPI:IPI00113832 PIR:S34378 RefSeq:NP_033545.1 UniGene:Mm.22182
            ProteinModelPortal:P48615 STRING:P48615 PhosphoSite:P48615
            PRIDE:P48615 Ensembl:ENSMUST00000067495 Ensembl:ENSMUST00000167303
            GeneID:22411 KEGG:mmu:22411 InParanoid:P48615 NextBio:302813
            Bgee:P48615 CleanEx:MM_WNT11 Genevestigator:P48615
            GermOnline:ENSMUSG00000015957 Uniprot:P48615
        Length = 354

 Score = 103 (41.3 bits), Expect = 5.8e-05, P = 5.8e-05
 Identities = 21/55 (38%), Positives = 27/55 (49%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSLFLTPKLTPDL 58
             G    Q ++C+   E+M  +  AA  A   C   F D RWNCSS+ L P    DL
Sbjct:    50 GLVSAQVQLCRSNLELMRTIVHAARGAMKACRRAFADMRWNCSSIELAPNYLLDL 104


>ZFIN|ZDB-GENE-000411-1 [details] [associations]
            symbol:wnt4b "wingless-type MMTV integration site
            family, member 4b" species:7955 "Danio rerio" [GO:0005102 "receptor
            binding" evidence=IEA] [GO:0005576 "extracellular region"
            evidence=IEA] [GO:0016055 "Wnt receptor signaling pathway"
            evidence=IEA] [GO:0007275 "multicellular organismal development"
            evidence=IEA] [GO:0048599 "oocyte development" evidence=IBA]
            [GO:0072033 "renal vesicle formation" evidence=IBA] [GO:0060070
            "canonical Wnt receptor signaling pathway" evidence=IBA]
            [GO:0009798 "axis specification" evidence=IBA] [GO:0005615
            "extracellular space" evidence=IBA] [GO:0009952 "anterior/posterior
            pattern specification" evidence=IBA] [GO:0008585 "female gonad
            development" evidence=IBA] [GO:0060126 "somatotropin secreting cell
            differentiation" evidence=IBA] [GO:0040037 "negative regulation of
            fibroblast growth factor receptor signaling pathway" evidence=IBA]
            [GO:0005794 "Golgi apparatus" evidence=IBA] [GO:0001658 "branching
            involved in ureteric bud morphogenesis" evidence=IBA] [GO:0072164
            "mesonephric tubule development" evidence=IBA] [GO:0001664
            "G-protein coupled receptor binding" evidence=IBA] [GO:0005886
            "plasma membrane" evidence=IBA] [GO:0008584 "male gonad
            development" evidence=IBA] [GO:0051145 "smooth muscle cell
            differentiation" evidence=IBA] [GO:0060748 "tertiary branching
            involved in mammary gland duct morphogenesis" evidence=IBA]
            [GO:0007492 "endoderm development" evidence=IBA] [GO:0060129
            "thyroid-stimulating hormone-secreting cell differentiation"
            evidence=IBA] [GO:0001656 "metanephros development" evidence=IBA]
            [GO:0005578 "proteinaceous extracellular matrix" evidence=IEA]
            InterPro:IPR005817 InterPro:IPR009142 Pfam:PF00110 PRINTS:PR01349
            SMART:SM00097 ZFIN:ZDB-GENE-000411-1 PANTHER:PTHR12027
            GO:GO:0005886 GO:GO:0005794 GO:GO:0005615 GO:GO:0008585
            GO:GO:0009952 GO:GO:0005578 GO:GO:0008584 GO:GO:0051145
            GO:GO:0001664 GO:GO:0060748 GO:GO:0007492 GO:GO:0001658
            GO:GO:0009798 GO:GO:0060070 GO:GO:0001656 GO:GO:0048599
            GO:GO:0060129 GO:GO:0040037 GO:GO:0072033 InterPro:IPR018161
            PROSITE:PS00246 GO:GO:0072164 GO:GO:0060126 HOVERGEN:HBG001595
            PANTHER:PTHR12027:SF19 EMBL:AF139536 IPI:IPI00487317
            RefSeq:NP_571575.1 UniGene:Dr.81321 STRING:Q9IAU3 PRIDE:Q9IAU3
            GeneID:791993 KEGG:dre:791993 CTD:791993 InParanoid:Q9IAU3
            NextBio:20930876 Bgee:Q9IAU3 Uniprot:Q9IAU3
        Length = 358

 Score = 103 (41.3 bits), Expect = 5.9e-05, P = 5.9e-05
 Identities = 20/50 (40%), Positives = 29/50 (58%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSLFLTPK 53
             G S GQ  +C+   E+M  V KA+ +    C   F++RRWNCS+   TP+
Sbjct:    52 GLSPGQVGVCRARGEVMESVRKASEMVIEECQHQFRNRRWNCST---TPR 98


>UNIPROTKB|F5GYM2 [details] [associations]
            symbol:WNT5B "Protein Wnt" species:9606 "Homo sapiens"
            [GO:0005102 "receptor binding" evidence=IEA] [GO:0007275
            "multicellular organismal development" evidence=IEA] [GO:0016055
            "Wnt receptor signaling pathway" evidence=IEA] [GO:0005578
            "proteinaceous extracellular matrix" evidence=IEA]
            InterPro:IPR005817 Pfam:PF00110 SMART:SM00097 PANTHER:PTHR12027
            GO:GO:0007275 GO:GO:0016055 GO:GO:0005578 InterPro:IPR026537
            PANTHER:PTHR12027:SF23 HGNC:HGNC:16265 ChiTaRS:WNT5B EMBL:AC004671
            EMBL:AC005182 IPI:IPI01016020 Ensembl:ENST00000542408
            ArrayExpress:F5GYM2 Bgee:F5GYM2 Uniprot:F5GYM2
        Length = 112

 Score = 94 (38.1 bits), Expect = 8.1e-05, P = 8.1e-05
 Identities = 17/44 (38%), Positives = 25/44 (56%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSS 47
             G S GQ K+C+ + E M ++ + A      C   F+ RRWNCS+
Sbjct:    53 GLSPGQRKLCQLYQEHMAYIGEGAKTGIKECQHQFRQRRWNCST 96


>UNIPROTKB|F5H034 [details] [associations]
            symbol:WNT5B "Protein Wnt" species:9606 "Homo sapiens"
            [GO:0005102 "receptor binding" evidence=IEA] [GO:0007275
            "multicellular organismal development" evidence=IEA] [GO:0016055
            "Wnt receptor signaling pathway" evidence=IEA] [GO:0009986 "cell
            surface" evidence=IEA] [GO:0045600 "positive regulation of fat cell
            differentiation" evidence=IEA] [GO:0090090 "negative regulation of
            canonical Wnt receptor signaling pathway" evidence=IEA] [GO:0005578
            "proteinaceous extracellular matrix" evidence=IEA]
            InterPro:IPR005817 Pfam:PF00110 SMART:SM00097 PANTHER:PTHR12027
            GO:GO:0007275 GO:GO:0009986 GO:GO:0016055 GO:GO:0005578
            GO:GO:0045600 GO:GO:0042060 GO:GO:0090090 InterPro:IPR026537
            PANTHER:PTHR12027:SF23 HGNC:HGNC:16265 ChiTaRS:WNT5B EMBL:AC004671
            EMBL:AC005182 IPI:IPI01011558 Ensembl:ENST00000539198
            ArrayExpress:F5H034 Bgee:F5H034 Uniprot:F5H034
        Length = 118

 Score = 94 (38.1 bits), Expect = 8.1e-05, P = 8.1e-05
 Identities = 17/44 (38%), Positives = 25/44 (56%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSS 47
             G S GQ K+C+ + E M ++ + A      C   F+ RRWNCS+
Sbjct:    53 GLSPGQRKLCQLYQEHMAYIGEGAKTGIKECQHQFRQRRWNCST 96


>UNIPROTKB|F5H364 [details] [associations]
            symbol:WNT5B "Protein Wnt" species:9606 "Homo sapiens"
            [GO:0005102 "receptor binding" evidence=IEA] [GO:0007275
            "multicellular organismal development" evidence=IEA] [GO:0016055
            "Wnt receptor signaling pathway" evidence=IEA] [GO:0009986 "cell
            surface" evidence=IEA] [GO:0045600 "positive regulation of fat cell
            differentiation" evidence=IEA] [GO:0090090 "negative regulation of
            canonical Wnt receptor signaling pathway" evidence=IEA] [GO:0005578
            "proteinaceous extracellular matrix" evidence=IEA]
            InterPro:IPR005817 Pfam:PF00110 PRINTS:PR01349 SMART:SM00097
            PANTHER:PTHR12027 GO:GO:0007275 GO:GO:0009986 GO:GO:0016055
            GO:GO:0005578 GO:GO:0045600 GO:GO:0042060 GO:GO:0090090
            InterPro:IPR026537 PANTHER:PTHR12027:SF23 HGNC:HGNC:16265
            ChiTaRS:WNT5B EMBL:AC004671 EMBL:AC005182 IPI:IPI00747307
            Ensembl:ENST00000545811 ArrayExpress:F5H364 Bgee:F5H364
            Uniprot:F5H364
        Length = 157

 Score = 94 (38.1 bits), Expect = 8.1e-05, P = 8.1e-05
 Identities = 17/44 (38%), Positives = 25/44 (56%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSS 47
             G S GQ K+C+ + E M ++ + A      C   F+ RRWNCS+
Sbjct:    53 GLSPGQRKLCQLYQEHMAYIGEGAKTGIKECQHQFRQRRWNCST 96


>UNIPROTKB|P49337 [details] [associations]
            symbol:WNT4 "Protein Wnt-4" species:9031 "Gallus gallus"
            [GO:0001656 "metanephros development" evidence=IBA] [GO:0001658
            "branching involved in ureteric bud morphogenesis" evidence=IBA]
            [GO:0001664 "G-protein coupled receptor binding" evidence=IBA]
            [GO:0005615 "extracellular space" evidence=IBA] [GO:0005794 "Golgi
            apparatus" evidence=IBA] [GO:0005886 "plasma membrane"
            evidence=IBA] [GO:0007492 "endoderm development" evidence=IBA]
            [GO:0008584 "male gonad development" evidence=IBA] [GO:0008585
            "female gonad development" evidence=IBA] [GO:0009798 "axis
            specification" evidence=IBA] [GO:0009952 "anterior/posterior
            pattern specification" evidence=IBA] [GO:0040037 "negative
            regulation of fibroblast growth factor receptor signaling pathway"
            evidence=IBA] [GO:0048599 "oocyte development" evidence=IBA]
            [GO:0051145 "smooth muscle cell differentiation" evidence=IBA]
            [GO:0060070 "canonical Wnt receptor signaling pathway"
            evidence=IBA] [GO:0060126 "somatotropin secreting cell
            differentiation" evidence=IBA] [GO:0060129 "thyroid-stimulating
            hormone-secreting cell differentiation" evidence=IBA] [GO:0060748
            "tertiary branching involved in mammary gland duct morphogenesis"
            evidence=IBA] [GO:0072033 "renal vesicle formation" evidence=IBA]
            [GO:0072164 "mesonephric tubule development" evidence=IBA]
            [GO:0005578 "proteinaceous extracellular matrix" evidence=IEA]
            [GO:0001837 "epithelial to mesenchymal transition" evidence=IEA]
            [GO:0001838 "embryonic epithelial tube formation" evidence=IEA]
            [GO:0001889 "liver development" evidence=IEA] [GO:0003714
            "transcription corepressor activity" evidence=IEA] [GO:0005109
            "frizzled binding" evidence=IEA] [GO:0006702 "androgen biosynthetic
            process" evidence=IEA] [GO:0009986 "cell surface" evidence=IEA]
            [GO:0018345 "protein palmitoylation" evidence=IEA] [GO:0022407
            "regulation of cell-cell adhesion" evidence=IEA] [GO:0030237
            "female sex determination" evidence=IEA] [GO:0030325 "adrenal gland
            development" evidence=IEA] [GO:0030501 "positive regulation of bone
            mineralization" evidence=IEA] [GO:0032349 "positive regulation of
            aldosterone biosynthetic process" evidence=IEA] [GO:0032967
            "positive regulation of collagen biosynthetic process"
            evidence=IEA] [GO:0033080 "immature T cell proliferation in thymus"
            evidence=IEA] [GO:0038030 "non-canonical Wnt receptor signaling
            pathway via MAPK cascade" evidence=IEA] [GO:0043066 "negative
            regulation of apoptotic process" evidence=IEA] [GO:0045596
            "negative regulation of cell differentiation" evidence=IEA]
            [GO:0045669 "positive regulation of osteoblast differentiation"
            evidence=IEA] [GO:0045836 "positive regulation of meiosis"
            evidence=IEA] [GO:0045892 "negative regulation of transcription,
            DNA-dependent" evidence=IEA] [GO:0060231 "mesenchymal to epithelial
            transition" evidence=IEA] [GO:0061184 "positive regulation of
            dermatome development" evidence=IEA] [GO:0061369 "negative
            regulation of testicular blood vessel morphogenesis" evidence=IEA]
            [GO:0071560 "cellular response to transforming growth factor beta
            stimulus" evidence=IEA] [GO:0072034 "renal vesicle induction"
            evidence=IEA] [GO:0072273 "metanephric nephron morphogenesis"
            evidence=IEA] [GO:0090002 "establishment of protein localization to
            plasma membrane" evidence=IEA] [GO:0090090 "negative regulation of
            canonical Wnt receptor signaling pathway" evidence=IEA] [GO:0090263
            "positive regulation of canonical Wnt receptor signaling pathway"
            evidence=IEA] [GO:2000019 "negative regulation of male gonad
            development" evidence=IEA] [GO:2000066 "positive regulation of
            cortisol biosynthetic process" evidence=IEA] [GO:2000225 "negative
            regulation of testosterone biosynthetic process" evidence=IEA]
            InterPro:IPR005817 InterPro:IPR009142 Pfam:PF00110 PRINTS:PR01349
            PRINTS:PR01844 SMART:SM00097 PANTHER:PTHR12027 GO:GO:0005886
            GO:GO:0005794 GO:GO:0003714 GO:GO:0045892 GO:GO:0045893
            GO:GO:0043066 GO:GO:0005615 GO:GO:0009986 GO:GO:0006702
            GO:GO:0071560 GO:GO:0008585 GO:GO:0009952 GO:GO:0005578
            GO:GO:0032967 GO:GO:0008584 GO:GO:0030501 GO:GO:0045669
            GO:GO:0051145 GO:GO:0022407 GO:GO:0090090 GO:GO:0018345
            GO:GO:0090263 GO:GO:0045836 GO:GO:0001664 GO:GO:0060748
            GO:GO:0007492 GO:GO:0001658 GO:GO:0009798 GO:GO:0060070
            GO:GO:0001656 GO:GO:0048599 GO:GO:0060129 GO:GO:0032349
            GO:GO:0040037 GO:GO:0072033 GO:GO:0045596 GO:GO:0010894
            InterPro:IPR018161 PROSITE:PS00246 KO:K00408 GO:GO:0072164
            GO:GO:0061184 GO:GO:0060126 GO:GO:0072034 HOGENOM:HOG000039529
            HOVERGEN:HBG001595 GeneTree:ENSGT00690000101771 eggNOG:NOG284879
            OMA:QVQICKR EMBL:D31900 IPI:IPI00595359 PIR:JC2451
            RefSeq:NP_990114.1 UniGene:Gga.305 STRING:P49337
            Ensembl:ENSGALT00000007645 GeneID:395561 KEGG:gga:395561 CTD:54361
            InParanoid:P49337 OrthoDB:EOG49P9ZP NextBio:20815636
            ArrayExpress:P49337 GO:GO:2000019 GO:GO:0061369 GO:GO:0038030
            GO:GO:2000066 PANTHER:PTHR12027:SF19 Uniprot:P49337
        Length = 351

 Score = 101 (40.6 bits), Expect = 9.4e-05, P = 9.4e-05
 Identities = 20/49 (40%), Positives = 28/49 (57%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSLFLTP 52
             G  + Q ++CK   E+M  V + A LA   C   F++RRWNCS+L   P
Sbjct:    48 GLIQRQVQMCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDTLP 96


>UNIPROTKB|O96014 [details] [associations]
            symbol:WNT11 "Protein Wnt-11" species:9606 "Homo sapiens"
            [GO:0035567 "non-canonical Wnt receptor signaling pathway"
            evidence=IEA] [GO:0043065 "positive regulation of apoptotic
            process" evidence=IEA] [GO:0060070 "canonical Wnt receptor
            signaling pathway" evidence=IEA] [GO:0072201 "negative regulation
            of mesenchymal cell proliferation" evidence=IEA] [GO:0090272
            "negative regulation of fibroblast growth factor production"
            evidence=IEA] [GO:0005578 "proteinaceous extracellular matrix"
            evidence=IEA] [GO:0001649 "osteoblast differentiation"
            evidence=IBA] [GO:0001664 "G-protein coupled receptor binding"
            evidence=IBA] [GO:0003151 "outflow tract morphogenesis"
            evidence=IBA] [GO:0005615 "extracellular space" evidence=IBA]
            [GO:0005886 "plasma membrane" evidence=IBA] [GO:0007492 "endoderm
            development" evidence=IBA] [GO:0009798 "axis specification"
            evidence=IBA] [GO:0009952 "anterior/posterior pattern
            specification" evidence=IBA] [GO:0030282 "bone mineralization"
            evidence=IBA] [GO:0032915 "positive regulation of transforming
            growth factor beta2 production" evidence=IBA] [GO:0048844 "artery
            morphogenesis" evidence=IBA] [GO:0060412 "ventricular septum
            morphogenesis" evidence=IBA] [GO:0070830 "tight junction assembly"
            evidence=IBA] [GO:0044212 "transcription regulatory region DNA
            binding" evidence=IDA] [GO:0045893 "positive regulation of
            transcription, DNA-dependent" evidence=IMP] [GO:0061101
            "neuroendocrine cell differentiation" evidence=IMP] [GO:0060548
            "negative regulation of cell death" evidence=IMP] [GO:0010628
            "positive regulation of gene expression" evidence=IMP] [GO:0043066
            "negative regulation of apoptotic process" evidence=IMP]
            [GO:0045892 "negative regulation of transcription, DNA-dependent"
            evidence=IMP] [GO:0030335 "positive regulation of cell migration"
            evidence=IMP] [GO:0030295 "protein kinase activator activity"
            evidence=IMP] [GO:0071300 "cellular response to retinoic acid"
            evidence=ISS] [GO:0048706 "embryonic skeletal system development"
            evidence=IEP] [GO:0072177 "mesonephric duct development"
            evidence=IEP] [GO:0060675 "ureteric bud morphogenesis"
            evidence=IEP] [GO:0060484 "lung-associated mesenchyme development"
            evidence=IEP] [GO:0061037 "negative regulation of cartilage
            development" evidence=NAS] [GO:0030325 "adrenal gland development"
            evidence=IEP] [GO:0060197 "cloacal septation" evidence=IEP]
            [GO:0005737 "cytoplasm" evidence=IDA] [GO:0090090 "negative
            regulation of canonical Wnt receptor signaling pathway"
            evidence=IMP] [GO:0034394 "protein localization to cell surface"
            evidence=IMP] [GO:0006468 "protein phosphorylation" evidence=IMP]
            [GO:0030308 "negative regulation of cell growth" evidence=IMP]
            [GO:0090037 "positive regulation of protein kinase C signaling
            cascade" evidence=IMP] [GO:0051496 "positive regulation of stress
            fiber assembly" evidence=IMP] [GO:0032320 "positive regulation of
            Ras GTPase activity" evidence=IMP] [GO:0005099 "Ras GTPase
            activator activity" evidence=IMP] [GO:0030336 "negative regulation
            of cell migration" evidence=IMP] [GO:0030182 "neuron
            differentiation" evidence=ISS] [GO:0060021 "palate development"
            evidence=IMP] [GO:0045860 "positive regulation of protein kinase
            activity" evidence=IMP] InterPro:IPR005817 Pfam:PF00110
            PRINTS:PR01349 SMART:SM00097 PANTHER:PTHR12027 GO:GO:0005886
            GO:GO:0005737 Reactome:REACT_111102 GO:GO:0045892 GO:GO:0045893
            GO:GO:0043066 GO:GO:0005615 GO:GO:0030308 GO:GO:0030182
            GO:GO:0030325 GO:GO:0009952 GO:GO:0005099 GO:GO:0071300
            GO:GO:0005578 GO:GO:0051496 GO:GO:0006468 GO:GO:0030295
            GO:GO:0030336 GO:GO:0044212 GO:GO:0043065 GO:GO:0090037
            GO:GO:0030335 GO:GO:0090090 GO:GO:0001649 GO:GO:0060021
            GO:GO:0030282 GO:GO:0001664 GO:GO:0048844 GO:GO:0034394
            GO:GO:0007492 GO:GO:0003151 GO:GO:0009798 GO:GO:0060070
            GO:GO:0070830 GO:GO:0032915 GO:GO:0048706 GO:GO:0061101
            GO:GO:0060197 GO:GO:0060675 GO:GO:0090272
            Pathway_Interaction_DB:wnt_calcium_pathway GO:GO:0060412
            GO:GO:0072201 GO:GO:0060484
            Pathway_Interaction_DB:wnt_signaling_pathway GO:GO:0035567
            GO:GO:0061037 GO:GO:0072177 InterPro:IPR018161 PROSITE:PS00246
            CTD:7481 eggNOG:NOG273917 HOGENOM:HOG000039529 HOVERGEN:HBG001595
            KO:K01384 OMA:ELIYLQS OrthoDB:EOG4FR0RT InterPro:IPR026536
            PANTHER:PTHR12027:SF7 EMBL:Y13843 EMBL:Y13844 EMBL:Y13845
            EMBL:Y13846 EMBL:Y13847 EMBL:Y12692 EMBL:AB070218 EMBL:AK313570
            EMBL:BC074790 EMBL:BC074791 EMBL:BC113386 EMBL:BC113388
            IPI:IPI00014069 RefSeq:NP_004617.2 UniGene:Hs.108219
            ProteinModelPortal:O96014 STRING:O96014 PhosphoSite:O96014
            PRIDE:O96014 DNASU:7481 Ensembl:ENST00000322563 GeneID:7481
            KEGG:hsa:7481 UCSC:uc001oxe.3 GeneCards:GC11M075897 HGNC:HGNC:12776
            HPA:HPA050101 MIM:603699 neXtProt:NX_O96014 PharmGKB:PA37378
            InParanoid:O96014 PhylomeDB:O96014 GenomeRNAi:7481 NextBio:29304
            ArrayExpress:O96014 Bgee:O96014 CleanEx:HS_WNT11
            Genevestigator:O96014 GermOnline:ENSG00000085741 Uniprot:O96014
        Length = 354

 Score = 101 (40.6 bits), Expect = 9.5e-05, P = 9.5e-05
 Identities = 21/55 (38%), Positives = 26/55 (47%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSLFLTPKLTPDL 58
             G    Q ++C+   E+M  V  AA      C   F D RWNCSS+ L P    DL
Sbjct:    50 GLVSAQVQLCRSNLELMHTVVHAAREVMKACRRAFADMRWNCSSIELAPNYLLDL 104


>UNIPROTKB|F1SUL7 [details] [associations]
            symbol:LOC100620317 "Protein Wnt" species:9823 "Sus scrofa"
            [GO:0005578 "proteinaceous extracellular matrix" evidence=IEA]
            [GO:0016055 "Wnt receptor signaling pathway" evidence=IEA]
            [GO:0007275 "multicellular organismal development" evidence=IEA]
            [GO:0005102 "receptor binding" evidence=IEA] InterPro:IPR005817
            Pfam:PF00110 PRINTS:PR01349 SMART:SM00097 PANTHER:PTHR12027
            GO:GO:0007275 GO:GO:0016055 GO:GO:0005578 InterPro:IPR018161
            PROSITE:PS00246 CTD:7481 KO:K01384 GeneTree:ENSGT00700000104317
            OMA:ELIYLQS InterPro:IPR026536 PANTHER:PTHR12027:SF7 EMBL:CU942407
            EMBL:CU694805 RefSeq:XP_003129716.3 RefSeq:XP_003357253.1
            Ensembl:ENSSSCT00000024218 Ensembl:ENSSSCT00000025742
            GeneID:100521912 GeneID:100620317 KEGG:ssc:100521912
            KEGG:ssc:100620317 Uniprot:F1SUL7
        Length = 354

 Score = 101 (40.6 bits), Expect = 9.5e-05, P = 9.5e-05
 Identities = 21/55 (38%), Positives = 26/55 (47%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSLFLTPKLTPDL 58
             G    Q ++C+   E+M  V  AA      C   F D RWNCSS+ L P    DL
Sbjct:    50 GLVSAQVQLCRSNLELMHTVVHAAREVMKACRRAFADMRWNCSSIELAPNYLLDL 104


>UNIPROTKB|F1MZV4 [details] [associations]
            symbol:LOC789600 "Protein Wnt" species:9913 "Bos taurus"
            [GO:0005578 "proteinaceous extracellular matrix" evidence=IEA]
            [GO:2000225 "negative regulation of testosterone biosynthetic
            process" evidence=IEA] [GO:2000066 "positive regulation of cortisol
            biosynthetic process" evidence=IEA] [GO:2000019 "negative
            regulation of male gonad development" evidence=IEA] [GO:0090263
            "positive regulation of canonical Wnt receptor signaling pathway"
            evidence=IEA] [GO:0090090 "negative regulation of canonical Wnt
            receptor signaling pathway" evidence=IEA] [GO:0090002
            "establishment of protein localization to plasma membrane"
            evidence=IEA] [GO:0072273 "metanephric nephron morphogenesis"
            evidence=IEA] [GO:0072164 "mesonephric tubule development"
            evidence=IEA] [GO:0072034 "renal vesicle induction" evidence=IEA]
            [GO:0072033 "renal vesicle formation" evidence=IEA] [GO:0071560
            "cellular response to transforming growth factor beta stimulus"
            evidence=IEA] [GO:0061369 "negative regulation of testicular blood
            vessel morphogenesis" evidence=IEA] [GO:0061184 "positive
            regulation of dermatome development" evidence=IEA] [GO:0060748
            "tertiary branching involved in mammary gland duct morphogenesis"
            evidence=IEA] [GO:0060231 "mesenchymal to epithelial transition"
            evidence=IEA] [GO:0060129 "thyroid-stimulating hormone-secreting
            cell differentiation" evidence=IEA] [GO:0060126 "somatotropin
            secreting cell differentiation" evidence=IEA] [GO:0051145 "smooth
            muscle cell differentiation" evidence=IEA] [GO:0048599 "oocyte
            development" evidence=IEA] [GO:0045892 "negative regulation of
            transcription, DNA-dependent" evidence=IEA] [GO:0045836 "positive
            regulation of meiosis" evidence=IEA] [GO:0045669 "positive
            regulation of osteoblast differentiation" evidence=IEA] [GO:0045596
            "negative regulation of cell differentiation" evidence=IEA]
            [GO:0043066 "negative regulation of apoptotic process"
            evidence=IEA] [GO:0040037 "negative regulation of fibroblast growth
            factor receptor signaling pathway" evidence=IEA] [GO:0038030
            "non-canonical Wnt receptor signaling pathway via MAPK cascade"
            evidence=IEA] [GO:0033080 "immature T cell proliferation in thymus"
            evidence=IEA] [GO:0032967 "positive regulation of collagen
            biosynthetic process" evidence=IEA] [GO:0032349 "positive
            regulation of aldosterone biosynthetic process" evidence=IEA]
            [GO:0030501 "positive regulation of bone mineralization"
            evidence=IEA] [GO:0030325 "adrenal gland development" evidence=IEA]
            [GO:0030237 "female sex determination" evidence=IEA] [GO:0022407
            "regulation of cell-cell adhesion" evidence=IEA] [GO:0018345
            "protein palmitoylation" evidence=IEA] [GO:0009986 "cell surface"
            evidence=IEA] [GO:0008585 "female gonad development" evidence=IEA]
            [GO:0006702 "androgen biosynthetic process" evidence=IEA]
            [GO:0005737 "cytoplasm" evidence=IEA] [GO:0005615 "extracellular
            space" evidence=IEA] [GO:0005109 "frizzled binding" evidence=IEA]
            [GO:0003714 "transcription corepressor activity" evidence=IEA]
            [GO:0001889 "liver development" evidence=IEA] [GO:0001838
            "embryonic epithelial tube formation" evidence=IEA] [GO:0001837
            "epithelial to mesenchymal transition" evidence=IEA] [GO:0001658
            "branching involved in ureteric bud morphogenesis" evidence=IEA]
            InterPro:IPR005817 InterPro:IPR009142 Pfam:PF00110 PRINTS:PR01349
            PRINTS:PR01844 SMART:SM00097 PANTHER:PTHR12027 GO:GO:0005737
            GO:GO:0003714 GO:GO:0045892 GO:GO:0045893 GO:GO:0043066
            GO:GO:0005615 GO:GO:0009986 GO:GO:0006702 GO:GO:0030325
            GO:GO:0071560 GO:GO:0008585 GO:GO:0005578 GO:GO:0032967
            GO:GO:0001889 GO:GO:0008584 GO:GO:0030501 GO:GO:0045669
            GO:GO:0051145 GO:GO:0022407 GO:GO:0090090 GO:GO:0018345
            GO:GO:0001837 GO:GO:0090263 GO:GO:0045836 GO:GO:0060748
            GO:GO:0001658 GO:GO:0060070 GO:GO:0048599 GO:GO:0060231
            GO:GO:0060129 GO:GO:0032349 GO:GO:0040037 GO:GO:0072033
            GO:GO:0030237 GO:GO:0045596 GO:GO:0010894 GO:GO:0061205
            InterPro:IPR018161 PROSITE:PS00246 GO:GO:0072164 GO:GO:0061184
            GO:GO:0060126 GO:GO:0001838 GO:GO:0072034
            GeneTree:ENSGT00690000101771 OMA:QVQICKR GO:GO:2000019
            GO:GO:0061369 GO:GO:0038030 GO:GO:2000066 PANTHER:PTHR12027:SF19
            GO:GO:0033080 GO:GO:0072273 EMBL:DAAA02006467 IPI:IPI00693282
            Ensembl:ENSBTAT00000030742 Uniprot:F1MZV4
        Length = 325

 Score = 100 (40.3 bits), Expect = 0.00011, P = 0.00011
 Identities = 20/49 (40%), Positives = 28/49 (57%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSLFLTP 52
             G  + Q ++CK   E+M  V + A LA   C   F++RRWNCS+L   P
Sbjct:    22 GLIQRQVQMCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLP 70


>UNIPROTKB|P56705 [details] [associations]
            symbol:WNT4 "Protein Wnt-4" species:9606 "Homo sapiens"
            [GO:0001838 "embryonic epithelial tube formation" evidence=IEA]
            [GO:0005109 "frizzled binding" evidence=IEA] [GO:0022407
            "regulation of cell-cell adhesion" evidence=IEA] [GO:0033080
            "immature T cell proliferation in thymus" evidence=IEA] [GO:0043066
            "negative regulation of apoptotic process" evidence=IEA]
            [GO:0045596 "negative regulation of cell differentiation"
            evidence=IEA] [GO:0045836 "positive regulation of meiosis"
            evidence=IEA] [GO:0060231 "mesenchymal to epithelial transition"
            evidence=IEA] [GO:0072034 "renal vesicle induction" evidence=IEA]
            [GO:0072273 "metanephric nephron morphogenesis" evidence=IEA]
            [GO:0005578 "proteinaceous extracellular matrix" evidence=IEA]
            [GO:0001656 "metanephros development" evidence=IBA] [GO:0001658
            "branching involved in ureteric bud morphogenesis" evidence=IBA]
            [GO:0001664 "G-protein coupled receptor binding" evidence=IBA]
            [GO:0005794 "Golgi apparatus" evidence=IBA] [GO:0005886 "plasma
            membrane" evidence=IBA] [GO:0007492 "endoderm development"
            evidence=IBA] [GO:0008585 "female gonad development"
            evidence=ISS;IBA] [GO:0009798 "axis specification" evidence=IBA]
            [GO:0009952 "anterior/posterior pattern specification"
            evidence=IBA] [GO:0033077 "T cell differentiation in thymus"
            evidence=IBA] [GO:0040037 "negative regulation of fibroblast growth
            factor receptor signaling pathway" evidence=IBA] [GO:0048599
            "oocyte development" evidence=IBA] [GO:0051145 "smooth muscle cell
            differentiation" evidence=IBA] [GO:0060126 "somatotropin secreting
            cell differentiation" evidence=IBA] [GO:0060129
            "thyroid-stimulating hormone-secreting cell differentiation"
            evidence=IBA] [GO:0060748 "tertiary branching involved in mammary
            gland duct morphogenesis" evidence=IBA] [GO:0072033 "renal vesicle
            formation" evidence=IBA] [GO:0072164 "mesonephric tubule
            development" evidence=IBA] [GO:0005201 "extracellular matrix
            structural constituent" evidence=NAS] [GO:0007267 "cell-cell
            signaling" evidence=NAS] [GO:0061369 "negative regulation of
            testicular blood vessel morphogenesis" evidence=IMP] [GO:2000225
            "negative regulation of testosterone biosynthetic process"
            evidence=IMP] [GO:2000066 "positive regulation of cortisol
            biosynthetic process" evidence=IDA] [GO:0032349 "positive
            regulation of aldosterone biosynthetic process" evidence=IDA]
            [GO:0045893 "positive regulation of transcription, DNA-dependent"
            evidence=ISS;IDA] [GO:0045892 "negative regulation of
            transcription, DNA-dependent" evidence=ISS;IMP] [GO:0030325
            "adrenal gland development" evidence=IEP] [GO:0008584 "male gonad
            development" evidence=IEP;IMP] [GO:0090090 "negative regulation of
            canonical Wnt receptor signaling pathway" evidence=IDA] [GO:0090002
            "establishment of protein localization to plasma membrane"
            evidence=IDA] [GO:0001837 "epithelial to mesenchymal transition"
            evidence=IEP] [GO:0061180 "mammary gland epithelium development"
            evidence=IEP] [GO:0072162 "metanephric mesenchymal cell
            differentiation" evidence=NAS] [GO:2000019 "negative regulation of
            male gonad development" evidence=IMP] [GO:0090263 "positive
            regulation of canonical Wnt receptor signaling pathway"
            evidence=IDA] [GO:0010894 "negative regulation of steroid
            biosynthetic process" evidence=IDA] [GO:0005615 "extracellular
            space" evidence=IDA] [GO:0005737 "cytoplasm" evidence=IDA]
            [GO:0006702 "androgen biosynthetic process" evidence=IDA]
            [GO:0071560 "cellular response to transforming growth factor beta
            stimulus" evidence=IEP] [GO:0001889 "liver development"
            evidence=IEP] [GO:0001822 "kidney development" evidence=IEP]
            [GO:0030237 "female sex determination" evidence=IMP] [GO:0003714
            "transcription corepressor activity" evidence=ISS] [GO:0009986
            "cell surface" evidence=ISS] [GO:0060070 "canonical Wnt receptor
            signaling pathway" evidence=IDA] [GO:0018345 "protein
            palmitoylation" evidence=IDA] [GO:0010629 "negative regulation of
            gene expression" evidence=IDA] [GO:0061205 "paramesonephric duct
            development" evidence=IMP] [GO:0061184 "positive regulation of
            dermatome development" evidence=IDA] [GO:0048018 "receptor agonist
            activity" evidence=IC] [GO:0045669 "positive regulation of
            osteoblast differentiation" evidence=IDA] [GO:0032967 "positive
            regulation of collagen biosynthetic process" evidence=IDA]
            [GO:0030501 "positive regulation of bone mineralization"
            evidence=IDA] [GO:0038030 "non-canonical Wnt receptor signaling
            pathway via MAPK cascade" evidence=IDA] InterPro:IPR005817
            InterPro:IPR009142 Pfam:PF00110 PRINTS:PR01349 PRINTS:PR01844
            SMART:SM00097 PANTHER:PTHR12027 GO:GO:0005886 GO:GO:0005794
            Reactome:REACT_111102 GO:GO:0003714 GO:GO:0045892 GO:GO:0045893
            GO:GO:0043066 GO:GO:0005615 GO:GO:0009986 GO:GO:0006702
            GO:GO:0030325 GO:GO:0071560 GO:GO:0008585 GO:GO:0009952
            GO:GO:0005578 GO:GO:0032967 GO:GO:0007267 GO:GO:0001889
            GO:GO:0008584 GO:GO:0030501 GO:GO:0045669 GO:GO:0051145
            GO:GO:0033077 GO:GO:0022407 GO:GO:0090090 GO:GO:0090002
            GO:GO:0018345 GO:GO:0001837 GO:GO:0090263 GO:GO:0045836
            GO:GO:0001664 GO:GO:0060748 GO:GO:0007492 GO:GO:0001658
            GO:GO:0009798 GO:GO:0060070 GO:GO:0048599 GO:GO:0071392
            GO:GO:0060231 GO:GO:0060129 GO:GO:0032349 GO:GO:0005201
            EMBL:AL031281 Pathway_Interaction_DB:wnt_calcium_pathway
            GO:GO:0040037 GO:GO:0071464 GO:GO:0072033 GO:GO:0048018
            GO:GO:0030237 GO:GO:0045596
            Pathway_Interaction_DB:wnt_signaling_pathway GO:GO:0061205
            InterPro:IPR018161 PROSITE:PS00246 KO:K00408 GO:GO:0072162
            GO:GO:0072164 GO:GO:0061184 GO:GO:0060126 GO:GO:0001838
            GO:GO:0072034 HOGENOM:HOG000039529 HOVERGEN:HBG001595
            eggNOG:NOG284879 OMA:QVQICKR CTD:54361 OrthoDB:EOG49P9ZP
            GO:GO:2000019 GO:GO:0061369 GO:GO:0038030 GO:GO:2000066
            PANTHER:PTHR12027:SF19 EMBL:AY009398 EMBL:AF316543 EMBL:AY358947
            EMBL:BT020125 EMBL:AL445253 EMBL:BC057781 EMBL:AF335591
            EMBL:AH010731 IPI:IPI00011028 RefSeq:NP_110388.2 UniGene:Hs.25766
            ProteinModelPortal:P56705 IntAct:P56705 STRING:P56705
            PhosphoSite:P56705 DMDM:20532425 PRIDE:P56705 DNASU:54361
            Ensembl:ENST00000290167 GeneID:54361 KEGG:hsa:54361 UCSC:uc001bfs.4
            GeneCards:GC01M022443 HGNC:HGNC:12783 HPA:HPA011397 MIM:158330
            MIM:277000 MIM:603490 MIM:611812 neXtProt:NX_P56705 Orphanet:247768
            Orphanet:139466 PharmGKB:PA37384 InParanoid:P56705 PhylomeDB:P56705
            GenomeRNAi:54361 NextBio:56599 ArrayExpress:P56705 Bgee:P56705
            CleanEx:HS_WNT4 Genevestigator:P56705 GermOnline:ENSG00000162552
            GO:GO:0033080 GO:GO:0072273 GO:GO:2000225 Uniprot:P56705
        Length = 351

 Score = 100 (40.3 bits), Expect = 0.00012, P = 0.00012
 Identities = 20/49 (40%), Positives = 28/49 (57%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSLFLTP 52
             G  + Q ++CK   E+M  V + A LA   C   F++RRWNCS+L   P
Sbjct:    48 GLIQRQVQMCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLP 96


>UNIPROTKB|I3LRC0 [details] [associations]
            symbol:WNT4 "Protein Wnt" species:9823 "Sus scrofa"
            [GO:0005578 "proteinaceous extracellular matrix" evidence=IEA]
            [GO:0016055 "Wnt receptor signaling pathway" evidence=IEA]
            [GO:0007275 "multicellular organismal development" evidence=IEA]
            [GO:0005102 "receptor binding" evidence=IEA] InterPro:IPR005817
            InterPro:IPR009142 Pfam:PF00110 PRINTS:PR01349 PRINTS:PR01844
            SMART:SM00097 PANTHER:PTHR12027 GO:GO:0007275 GO:GO:0016055
            GO:GO:0005578 GeneTree:ENSGT00690000101857 InterPro:IPR018161
            PROSITE:PS00246 OMA:QVQICKR PANTHER:PTHR12027:SF19 EMBL:CU633957
            Ensembl:ENSSSCT00000032147 Uniprot:I3LRC0
        Length = 351

 Score = 100 (40.3 bits), Expect = 0.00012, P = 0.00012
 Identities = 20/49 (40%), Positives = 28/49 (57%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSLFLTP 52
             G  + Q ++CK   E+M  V + A LA   C   F++RRWNCS+L   P
Sbjct:    48 GLIQRQVQMCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLP 96


>MGI|MGI:98957 [details] [associations]
            symbol:Wnt4 "wingless-related MMTV integration site 4"
            species:10090 "Mus musculus" [GO:0000122 "negative regulation of
            transcription from RNA polymerase II promoter" evidence=IBA]
            [GO:0001656 "metanephros development" evidence=IMP;TAS] [GO:0001658
            "branching involved in ureteric bud morphogenesis" evidence=IMP]
            [GO:0001823 "mesonephros development" evidence=IMP] [GO:0001838
            "embryonic epithelial tube formation" evidence=IDA] [GO:0003714
            "transcription corepressor activity" evidence=IDA] [GO:0005102
            "receptor binding" evidence=TAS] [GO:0005109 "frizzled binding"
            evidence=IPI] [GO:0005515 "protein binding" evidence=IPI]
            [GO:0005576 "extracellular region" evidence=IEA] [GO:0005578
            "proteinaceous extracellular matrix" evidence=IEA] [GO:0005615
            "extracellular space" evidence=ISO;IBA] [GO:0005737 "cytoplasm"
            evidence=ISO] [GO:0005794 "Golgi apparatus" evidence=ISO;IBA]
            [GO:0005886 "plasma membrane" evidence=IBA] [GO:0006702 "androgen
            biosynthetic process" evidence=ISO] [GO:0007165 "signal
            transduction" evidence=TAS] [GO:0007267 "cell-cell signaling"
            evidence=TAS] [GO:0007275 "multicellular organismal development"
            evidence=IEA] [GO:0007276 "gamete generation" evidence=IGI]
            [GO:0007492 "endoderm development" evidence=IBA] [GO:0007548 "sex
            differentiation" evidence=IMP] [GO:0008584 "male gonad development"
            evidence=ISO;ISS;IMP] [GO:0008585 "female gonad development"
            evidence=IMP] [GO:0009798 "axis specification" evidence=IBA]
            [GO:0009952 "anterior/posterior pattern specification"
            evidence=IBA] [GO:0009986 "cell surface" evidence=IDA] [GO:0010629
            "negative regulation of gene expression" evidence=ISO;IMP]
            [GO:0010894 "negative regulation of steroid biosynthetic process"
            evidence=ISO] [GO:0016055 "Wnt receptor signaling pathway"
            evidence=IEA] [GO:0018345 "protein palmitoylation" evidence=ISO]
            [GO:0022407 "regulation of cell-cell adhesion" evidence=IMP]
            [GO:0030154 "cell differentiation" evidence=IMP] [GO:0030237
            "female sex determination" evidence=ISO;ISS] [GO:0030501 "positive
            regulation of bone mineralization" evidence=ISO] [GO:0031012
            "extracellular matrix" evidence=IDA] [GO:0032349 "positive
            regulation of aldosterone biosynthetic process" evidence=ISO]
            [GO:0032967 "positive regulation of collagen biosynthetic process"
            evidence=ISO] [GO:0033077 "T cell differentiation in thymus"
            evidence=IDA] [GO:0033080 "immature T cell proliferation in thymus"
            evidence=IMP] [GO:0035239 "tube morphogenesis" evidence=IMP]
            [GO:0035567 "non-canonical Wnt receptor signaling pathway"
            evidence=IDA] [GO:0038030 "non-canonical Wnt receptor signaling
            pathway via MAPK cascade" evidence=ISO] [GO:0040037 "negative
            regulation of fibroblast growth factor receptor signaling pathway"
            evidence=IGI] [GO:0042445 "hormone metabolic process" evidence=IMP]
            [GO:0043066 "negative regulation of apoptotic process"
            evidence=IGI] [GO:0045165 "cell fate commitment" evidence=IMP]
            [GO:0045596 "negative regulation of cell differentiation"
            evidence=IMP] [GO:0045669 "positive regulation of osteoblast
            differentiation" evidence=ISO] [GO:0045836 "positive regulation of
            meiosis" evidence=IGI] [GO:0045892 "negative regulation of
            transcription, DNA-dependent" evidence=ISO;ISS;IMP;IDA] [GO:0045893
            "positive regulation of transcription, DNA-dependent"
            evidence=ISO;IMP;IDA] [GO:0048599 "oocyte development"
            evidence=IGI;IMP] [GO:0048754 "branching morphogenesis of an
            epithelial tube" evidence=IGI] [GO:0048856 "anatomical structure
            development" evidence=IGI] [GO:0051145 "smooth muscle cell
            differentiation" evidence=IMP;IDA] [GO:0060070 "canonical Wnt
            receptor signaling pathway" evidence=ISO;IGI;IDA] [GO:0060126
            "somatotropin secreting cell differentiation" evidence=IMP]
            [GO:0060129 "thyroid-stimulating hormone-secreting cell
            differentiation" evidence=IMP] [GO:0060231 "mesenchymal to
            epithelial transition" evidence=IMP] [GO:0060748 "tertiary
            branching involved in mammary gland duct morphogenesis"
            evidence=IMP] [GO:0061184 "positive regulation of dermatome
            development" evidence=ISO;ISS] [GO:0061205 "paramesonephric duct
            development" evidence=ISO;IMP] [GO:0061369 "negative regulation of
            testicular blood vessel morphogenesis" evidence=ISO] [GO:0072033
            "renal vesicle formation" evidence=IMP] [GO:0072034 "renal vesicle
            induction" evidence=IDA] [GO:0072162 "metanephric mesenchymal cell
            differentiation" evidence=NAS] [GO:0072164 "mesonephric tubule
            development" evidence=IGI] [GO:0072273 "metanephric nephron
            morphogenesis" evidence=IMP] [GO:0090002 "establishment of protein
            localization to plasma membrane" evidence=ISO;IMP] [GO:0090090
            "negative regulation of canonical Wnt receptor signaling pathway"
            evidence=ISO] [GO:0090263 "positive regulation of canonical Wnt
            receptor signaling pathway" evidence=ISO] [GO:2000019 "negative
            regulation of male gonad development" evidence=ISO] [GO:2000066
            "positive regulation of cortisol biosynthetic process"
            evidence=ISO] [GO:2000225 "negative regulation of testosterone
            biosynthetic process" evidence=ISO;IMP] InterPro:IPR005817
            InterPro:IPR009142 Pfam:PF00110 PRINTS:PR01349 PRINTS:PR01844
            SMART:SM00097 MGI:MGI:98957 PANTHER:PTHR12027 GO:GO:0005886
            GO:GO:0005794 GO:GO:0003714 GO:GO:0045893 GO:GO:0043066
            GO:GO:0005615 GO:GO:0009986 GO:GO:0006702 GO:GO:0030325
            GO:GO:0071560 GO:GO:0008585 GO:GO:0009952 GO:GO:0005578
            GO:GO:0051496 GO:GO:0032967 GO:GO:0005102 GO:GO:0001889
            GO:GO:0008584 GO:GO:0000122 GO:GO:0030336 GO:GO:0030501
            GO:GO:0045669 GO:GO:0051145 GO:GO:0022407 GO:GO:0031012
            GO:GO:0090090 GO:GO:0032321 GO:GO:0090002 GO:GO:0018345
            GO:GO:0001837 GO:GO:0090263 GO:GO:0045836 GO:GO:0060748
            GO:GO:0007492 GO:GO:0001658 GO:GO:0009798 GO:GO:0060070
            GO:GO:0048599 GO:GO:0071392 GO:GO:0060231 GO:GO:0060129
            GO:GO:0032349 GO:GO:0040037 GO:GO:0071464 GO:GO:0061045
            GO:GO:0072033 GO:GO:0030237 GO:GO:0051894 GO:GO:0045596
            GO:GO:0035567 GO:GO:0061205 InterPro:IPR018161 PROSITE:PS00246
            KO:K00408 GO:GO:0072162 GO:GO:0072164 GO:GO:0061184 GO:GO:0060126
            GO:GO:0001838 GO:GO:0072034 HOGENOM:HOG000039529 HOVERGEN:HBG001595
            eggNOG:NOG284879 OMA:QVQICKR CTD:54361 OrthoDB:EOG49P9ZP
            GO:GO:2000019 GO:GO:0061369 GO:GO:0038030 GO:GO:2000066
            PANTHER:PTHR12027:SF19 GO:GO:0033080 GO:GO:0072273 GO:GO:2000225
            EMBL:M89797 IPI:IPI00131373 PIR:C36470 RefSeq:NP_033549.1
            UniGene:Mm.20355 ProteinModelPortal:P22724 IntAct:P22724
            STRING:P22724 PhosphoSite:P22724 PRIDE:P22724
            Ensembl:ENSMUST00000045747 GeneID:22417 KEGG:mmu:22417
            InParanoid:P22724 NextBio:302837 Bgee:P22724 CleanEx:MM_WNT4
            Genevestigator:P22724 GermOnline:ENSMUSG00000036856 Uniprot:P22724
        Length = 351

 Score = 100 (40.3 bits), Expect = 0.00012, P = 0.00012
 Identities = 20/49 (40%), Positives = 28/49 (57%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSLFLTP 52
             G  + Q ++CK   E+M  V + A LA   C   F++RRWNCS+L   P
Sbjct:    48 GLIQRQVQMCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLP 96


>UNIPROTKB|F1N4C0 [details] [associations]
            symbol:WNT11 "Protein Wnt" species:9913 "Bos taurus"
            [GO:0005578 "proteinaceous extracellular matrix" evidence=IEA]
            [GO:0090272 "negative regulation of fibroblast growth factor
            production" evidence=IEA] [GO:0090090 "negative regulation of
            canonical Wnt receptor signaling pathway" evidence=IEA] [GO:0090037
            "positive regulation of protein kinase C signaling cascade"
            evidence=IEA] [GO:0072201 "negative regulation of mesenchymal cell
            proliferation" evidence=IEA] [GO:0072177 "mesonephric duct
            development" evidence=IEA] [GO:0070830 "tight junction assembly"
            evidence=IEA] [GO:0061101 "neuroendocrine cell differentiation"
            evidence=IEA] [GO:0060675 "ureteric bud morphogenesis"
            evidence=IEA] [GO:0060484 "lung-associated mesenchyme development"
            evidence=IEA] [GO:0060412 "ventricular septum morphogenesis"
            evidence=IEA] [GO:0060197 "cloacal septation" evidence=IEA]
            [GO:0060070 "canonical Wnt receptor signaling pathway"
            evidence=IEA] [GO:0060021 "palate development" evidence=IEA]
            [GO:0051496 "positive regulation of stress fiber assembly"
            evidence=IEA] [GO:0048844 "artery morphogenesis" evidence=IEA]
            [GO:0048706 "embryonic skeletal system development" evidence=IEA]
            [GO:0045893 "positive regulation of transcription, DNA-dependent"
            evidence=IEA] [GO:0045892 "negative regulation of transcription,
            DNA-dependent" evidence=IEA] [GO:0044212 "transcription regulatory
            region DNA binding" evidence=IEA] [GO:0043066 "negative regulation
            of apoptotic process" evidence=IEA] [GO:0043065 "positive
            regulation of apoptotic process" evidence=IEA] [GO:0035567
            "non-canonical Wnt receptor signaling pathway" evidence=IEA]
            [GO:0034394 "protein localization to cell surface" evidence=IEA]
            [GO:0032915 "positive regulation of transforming growth factor
            beta2 production" evidence=IEA] [GO:0030336 "negative regulation of
            cell migration" evidence=IEA] [GO:0030335 "positive regulation of
            cell migration" evidence=IEA] [GO:0030325 "adrenal gland
            development" evidence=IEA] [GO:0030308 "negative regulation of cell
            growth" evidence=IEA] [GO:0030295 "protein kinase activator
            activity" evidence=IEA] [GO:0030282 "bone mineralization"
            evidence=IEA] [GO:0006468 "protein phosphorylation" evidence=IEA]
            [GO:0005737 "cytoplasm" evidence=IEA] [GO:0005099 "Ras GTPase
            activator activity" evidence=IEA] [GO:0003151 "outflow tract
            morphogenesis" evidence=IEA] [GO:0001649 "osteoblast
            differentiation" evidence=IEA] [GO:0005102 "receptor binding"
            evidence=IEA] InterPro:IPR005817 Pfam:PF00110 PRINTS:PR01349
            SMART:SM00097 PANTHER:PTHR12027 GO:GO:0005737 GO:GO:0045892
            GO:GO:0045893 GO:GO:0043066 GO:GO:0030308 GO:GO:0030325
            GO:GO:0005099 GO:GO:0005578 GO:GO:0051496 GO:GO:0006468
            GO:GO:0030295 GO:GO:0030336 GO:GO:0044212 GO:GO:0043065
            GO:GO:0090037 GO:GO:0030335 GO:GO:0090090 GO:GO:0001649
            GO:GO:0060021 GO:GO:0030282 GO:GO:0048844 GO:GO:0034394
            GO:GO:0003151 GO:GO:0060070 GO:GO:0070830 GO:GO:0032915
            GO:GO:0048706 GO:GO:0061101 GO:GO:0060197 GO:GO:0060675
            GO:GO:0090272 GO:GO:0060412 GO:GO:0072201 GO:GO:0060484
            GO:GO:0035567 GO:GO:0072177 InterPro:IPR018161 PROSITE:PS00246
            GeneTree:ENSGT00700000104317 OMA:ELIYLQS InterPro:IPR026536
            PANTHER:PTHR12027:SF7 EMBL:DAAA02041087 IPI:IPI00711911
            UniGene:Bt.21876 Ensembl:ENSBTAT00000014355 Uniprot:F1N4C0
        Length = 354

 Score = 100 (40.3 bits), Expect = 0.00012, P = 0.00012
 Identities = 20/55 (36%), Positives = 26/55 (47%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSLFLTPKLTPDL 58
             G    Q ++C+   E+M  +  AA      C   F D RWNCSS+ L P    DL
Sbjct:    50 GLVSAQVQLCRSNLELMHTIVHAAREVMKACRRAFADMRWNCSSIELAPNYLLDL 104


>UNIPROTKB|E2QXQ3 [details] [associations]
            symbol:WNT11 "Protein Wnt" species:9615 "Canis lupus
            familiaris" [GO:0005578 "proteinaceous extracellular matrix"
            evidence=IEA] [GO:0090272 "negative regulation of fibroblast growth
            factor production" evidence=IEA] [GO:0090090 "negative regulation
            of canonical Wnt receptor signaling pathway" evidence=IEA]
            [GO:0090037 "positive regulation of protein kinase C signaling
            cascade" evidence=IEA] [GO:0072201 "negative regulation of
            mesenchymal cell proliferation" evidence=IEA] [GO:0072177
            "mesonephric duct development" evidence=IEA] [GO:0070830 "tight
            junction assembly" evidence=IEA] [GO:0061101 "neuroendocrine cell
            differentiation" evidence=IEA] [GO:0060675 "ureteric bud
            morphogenesis" evidence=IEA] [GO:0060484 "lung-associated
            mesenchyme development" evidence=IEA] [GO:0060412 "ventricular
            septum morphogenesis" evidence=IEA] [GO:0060197 "cloacal septation"
            evidence=IEA] [GO:0060070 "canonical Wnt receptor signaling
            pathway" evidence=IEA] [GO:0060021 "palate development"
            evidence=IEA] [GO:0051496 "positive regulation of stress fiber
            assembly" evidence=IEA] [GO:0048844 "artery morphogenesis"
            evidence=IEA] [GO:0048706 "embryonic skeletal system development"
            evidence=IEA] [GO:0045893 "positive regulation of transcription,
            DNA-dependent" evidence=IEA] [GO:0045892 "negative regulation of
            transcription, DNA-dependent" evidence=IEA] [GO:0044212
            "transcription regulatory region DNA binding" evidence=IEA]
            [GO:0043066 "negative regulation of apoptotic process"
            evidence=IEA] [GO:0043065 "positive regulation of apoptotic
            process" evidence=IEA] [GO:0035567 "non-canonical Wnt receptor
            signaling pathway" evidence=IEA] [GO:0034394 "protein localization
            to cell surface" evidence=IEA] [GO:0032915 "positive regulation of
            transforming growth factor beta2 production" evidence=IEA]
            [GO:0030336 "negative regulation of cell migration" evidence=IEA]
            [GO:0030335 "positive regulation of cell migration" evidence=IEA]
            [GO:0030325 "adrenal gland development" evidence=IEA] [GO:0030308
            "negative regulation of cell growth" evidence=IEA] [GO:0030295
            "protein kinase activator activity" evidence=IEA] [GO:0030282 "bone
            mineralization" evidence=IEA] [GO:0006468 "protein phosphorylation"
            evidence=IEA] [GO:0005737 "cytoplasm" evidence=IEA] [GO:0005099
            "Ras GTPase activator activity" evidence=IEA] [GO:0003151 "outflow
            tract morphogenesis" evidence=IEA] [GO:0001649 "osteoblast
            differentiation" evidence=IEA] [GO:0005102 "receptor binding"
            evidence=IEA] InterPro:IPR005817 Pfam:PF00110 PRINTS:PR01349
            SMART:SM00097 PANTHER:PTHR12027 GO:GO:0005737 GO:GO:0045892
            GO:GO:0045893 GO:GO:0043066 GO:GO:0030308 GO:GO:0030325
            GO:GO:0005099 GO:GO:0005578 GO:GO:0051496 GO:GO:0006468
            GO:GO:0030295 GO:GO:0030336 GO:GO:0044212 GO:GO:0043065
            GO:GO:0090037 GO:GO:0030335 GO:GO:0090090 GO:GO:0001649
            GO:GO:0060021 GO:GO:0030282 GO:GO:0048844 GO:GO:0034394
            GO:GO:0003151 GO:GO:0060070 GO:GO:0070830 GO:GO:0032915
            GO:GO:0048706 GO:GO:0061101 GO:GO:0060197 GO:GO:0060675
            GO:GO:0090272 GO:GO:0060412 GO:GO:0072201 GO:GO:0060484
            GO:GO:0035567 GO:GO:0072177 InterPro:IPR018161 PROSITE:PS00246
            CTD:7481 KO:K01384 GeneTree:ENSGT00700000104317 OMA:ELIYLQS
            InterPro:IPR026536 PANTHER:PTHR12027:SF7 EMBL:AAEX03012795
            RefSeq:XP_542301.2 Ensembl:ENSCAFT00000008531 GeneID:485183
            KEGG:cfa:485183 NextBio:20859223 Uniprot:E2QXQ3
        Length = 354

 Score = 100 (40.3 bits), Expect = 0.00012, P = 0.00012
 Identities = 20/55 (36%), Positives = 26/55 (47%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSLFLTPKLTPDL 58
             G    Q ++C+   E+M  +  AA      C   F D RWNCSS+ L P    DL
Sbjct:    50 GLVSAQVQLCRSNLELMHTIVHAAREVMKACRRAFADMRWNCSSIELAPNYLLDL 104


>UNIPROTKB|D2H1C6 [details] [associations]
            symbol:WNT11 "Protein Wnt" species:9646 "Ailuropoda
            melanoleuca" [GO:0005099 "Ras GTPase activator activity"
            evidence=ISS] [GO:0005737 "cytoplasm" evidence=ISS] [GO:0006468
            "protein phosphorylation" evidence=ISS] [GO:0010628 "positive
            regulation of gene expression" evidence=ISS] [GO:0030295 "protein
            kinase activator activity" evidence=ISS] [GO:0030308 "negative
            regulation of cell growth" evidence=ISS] [GO:0030335 "positive
            regulation of cell migration" evidence=ISS] [GO:0030336 "negative
            regulation of cell migration" evidence=ISS] [GO:0032320 "positive
            regulation of Ras GTPase activity" evidence=ISS] [GO:0034394
            "protein localization to cell surface" evidence=ISS] [GO:0043066
            "negative regulation of apoptotic process" evidence=ISS]
            [GO:0044212 "transcription regulatory region DNA binding"
            evidence=ISS] [GO:0045892 "negative regulation of transcription,
            DNA-dependent" evidence=ISS] [GO:0045893 "positive regulation of
            transcription, DNA-dependent" evidence=ISS] [GO:0051496 "positive
            regulation of stress fiber assembly" evidence=ISS] [GO:0060021
            "palate development" evidence=ISS] [GO:0060548 "negative regulation
            of cell death" evidence=ISS] [GO:0061101 "neuroendocrine cell
            differentiation" evidence=ISS] [GO:0090037 "positive regulation of
            protein kinase C signaling cascade" evidence=ISS] [GO:0090090
            "negative regulation of canonical Wnt receptor signaling pathway"
            evidence=ISS] InterPro:IPR005817 Pfam:PF00110 PRINTS:PR01349
            SMART:SM00097 PANTHER:PTHR12027 GO:GO:0005737 GO:GO:0045892
            GO:GO:0045893 GO:GO:0043066 GO:GO:0030308 GO:GO:0030325
            GO:GO:0005099 GO:GO:0005578 GO:GO:0051496 GO:GO:0006468
            GO:GO:0030295 GO:GO:0030336 GO:GO:0044212 GO:GO:0043065
            GO:GO:0090037 GO:GO:0030335 GO:GO:0090090 GO:GO:0001649
            GO:GO:0060021 GO:GO:0030282 GO:GO:0048844 GO:GO:0034394
            GO:GO:0003151 GO:GO:0060070 GO:GO:0070830 GO:GO:0032915
            GO:GO:0048706 GO:GO:0061101 GO:GO:0060197 GO:GO:0060675
            GO:GO:0090272 GO:GO:0060412 GO:GO:0072201 GO:GO:0060484
            GO:GO:0035567 GO:GO:0072177 InterPro:IPR018161 PROSITE:PS00246
            CTD:7481 HOGENOM:HOG000039529 KO:K01384
            GeneTree:ENSGT00700000104317 OMA:ELIYLQS InterPro:IPR026536
            PANTHER:PTHR12027:SF7 EMBL:ACTA01074012 EMBL:GL192425
            RefSeq:XP_002915341.1 Ensembl:ENSAMET00000018617 GeneID:100468561
            KEGG:aml:100468561 Uniprot:D2H1C6
        Length = 354

 Score = 100 (40.3 bits), Expect = 0.00012, P = 0.00012
 Identities = 20/55 (36%), Positives = 26/55 (47%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSLFLTPKLTPDL 58
             G    Q ++C+   E+M  +  AA      C   F D RWNCSS+ L P    DL
Sbjct:    50 GLVSAQVQLCRSNLELMHTIVHAAREVMKACRRAFADMRWNCSSIELAPNYLLDL 104


>UNIPROTKB|F1NP78 [details] [associations]
            symbol:WNT11B "Protein Wnt" species:9031 "Gallus gallus"
            [GO:0005102 "receptor binding" evidence=IEA] [GO:0007275
            "multicellular organismal development" evidence=IEA] [GO:0016055
            "Wnt receptor signaling pathway" evidence=IEA] [GO:0005578
            "proteinaceous extracellular matrix" evidence=IEA]
            InterPro:IPR005817 Pfam:PF00110 PRINTS:PR01349 SMART:SM00097
            PANTHER:PTHR12027 GO:GO:0007275 GO:GO:0016055 GO:GO:0005578
            InterPro:IPR018161 PROSITE:PS00246 GeneTree:ENSGT00700000104317
            EMBL:AADN02013130 IPI:IPI00680208 Ensembl:ENSGALT00000032418
            OMA:VKTCWKG Uniprot:F1NP78
        Length = 355

 Score = 100 (40.3 bits), Expect = 0.00012, P = 0.00012
 Identities = 19/56 (33%), Positives = 28/56 (50%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSLFLTPKLTPDLI 59
             G    Q ++C+   E+M  + +AA    + C   F   RWNCSS+   P   PDL+
Sbjct:    51 GLVPDQVQVCRRNLEVMHSIVQAASETKSICQKTFAGMRWNCSSIQRAPSFGPDLL 106


>UNIPROTKB|F1P7Z1 [details] [associations]
            symbol:WNT4 "Protein Wnt" species:9615 "Canis lupus
            familiaris" [GO:0005578 "proteinaceous extracellular matrix"
            evidence=IEA] [GO:0016055 "Wnt receptor signaling pathway"
            evidence=IEA] [GO:0007275 "multicellular organismal development"
            evidence=IEA] [GO:0005102 "receptor binding" evidence=IEA]
            InterPro:IPR005817 InterPro:IPR009142 Pfam:PF00110 PRINTS:PR01349
            PRINTS:PR01844 SMART:SM00097 PANTHER:PTHR12027 GO:GO:0007275
            GO:GO:0016055 GO:GO:0005578 InterPro:IPR018161 PROSITE:PS00246
            GeneTree:ENSGT00690000101771 OMA:QVQICKR PANTHER:PTHR12027:SF19
            EMBL:AAEX03001772 Ensembl:ENSCAFT00000023308 Uniprot:F1P7Z1
        Length = 360

 Score = 100 (40.3 bits), Expect = 0.00013, P = 0.00013
 Identities = 20/49 (40%), Positives = 28/49 (57%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSLFLTP 52
             G  + Q ++CK   E+M  V + A LA   C   F++RRWNCS+L   P
Sbjct:    57 GLIQRQVQMCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLP 105


>UNIPROTKB|F1NX78 [details] [associations]
            symbol:WNT5A "Protein Wnt" species:9031 "Gallus gallus"
            [GO:0005578 "proteinaceous extracellular matrix" evidence=IEA]
            [GO:0001667 "ameboidal cell migration" evidence=IEA] [GO:0001736
            "establishment of planar polarity" evidence=IEA] [GO:0001756
            "somitogenesis" evidence=IEA] [GO:0001837 "epithelial to
            mesenchymal transition" evidence=IEA] [GO:0001843 "neural tube
            closure" evidence=IEA] [GO:0001938 "positive regulation of
            endothelial cell proliferation" evidence=IEA] [GO:0001947 "heart
            looping" evidence=IEA] [GO:0002053 "positive regulation of
            mesenchymal cell proliferation" evidence=IEA] [GO:0002741 "positive
            regulation of cytokine secretion involved in immune response"
            evidence=IEA] [GO:0003323 "type B pancreatic cell development"
            evidence=IEA] [GO:0003700 "sequence-specific DNA binding
            transcription factor activity" evidence=IEA] [GO:0005110
            "frizzled-2 binding" evidence=IEA] [GO:0005115 "receptor tyrosine
            kinase-like orphan receptor binding" evidence=IEA] [GO:0005125
            "cytokine activity" evidence=IEA] [GO:0005615 "extracellular space"
            evidence=IEA] [GO:0007223 "Wnt receptor signaling pathway, calcium
            modulating pathway" evidence=IEA] [GO:0007257 "activation of JUN
            kinase activity" evidence=IEA] [GO:0007411 "axon guidance"
            evidence=IEA] [GO:0007442 "hindgut morphogenesis" evidence=IEA]
            [GO:0007494 "midgut development" evidence=IEA] [GO:0008584 "male
            gonad development" evidence=IEA] [GO:0008595 "anterior/posterior
            axis specification, embryo" evidence=IEA] [GO:0009986 "cell
            surface" evidence=IEA] [GO:0010595 "positive regulation of
            endothelial cell migration" evidence=IEA] [GO:0010800 "positive
            regulation of peptidyl-threonine phosphorylation" evidence=IEA]
            [GO:0010820 "positive regulation of T cell chemotaxis"
            evidence=IEA] [GO:0010976 "positive regulation of neuron projection
            development" evidence=IEA] [GO:0019904 "protein domain specific
            binding" evidence=IEA] [GO:0021891 "olfactory bulb interneuron
            development" evidence=IEA] [GO:0030216 "keratinocyte
            differentiation" evidence=IEA] [GO:0030324 "lung development"
            evidence=IEA] [GO:0030514 "negative regulation of BMP signaling
            pathway" evidence=IEA] [GO:0030825 "positive regulation of cGMP
            metabolic process" evidence=IEA] [GO:0032148 "activation of protein
            kinase B activity" evidence=IEA] [GO:0032729 "positive regulation
            of interferon-gamma production" evidence=IEA] [GO:0032755 "positive
            regulation of interleukin-6 production" evidence=IEA] [GO:0033138
            "positive regulation of peptidyl-serine phosphorylation"
            evidence=IEA] [GO:0034613 "cellular protein localization"
            evidence=IEA] [GO:0036342 "post-anal tail morphogenesis"
            evidence=IEA] [GO:0038031 "non-canonical Wnt receptor signaling
            pathway via JNK cascade" evidence=IEA] [GO:0040037 "negative
            regulation of fibroblast growth factor receptor signaling pathway"
            evidence=IEA] [GO:0042060 "wound healing" evidence=IEA] [GO:0042733
            "embryonic digit morphogenesis" evidence=IEA] [GO:0043032 "positive
            regulation of macrophage activation" evidence=IEA] [GO:0043066
            "negative regulation of apoptotic process" evidence=IEA]
            [GO:0044212 "transcription regulatory region DNA binding"
            evidence=IEA] [GO:0045080 "positive regulation of chemokine
            biosynthetic process" evidence=IEA] [GO:0045599 "negative
            regulation of fat cell differentiation" evidence=IEA] [GO:0045732
            "positive regulation of protein catabolic process" evidence=IEA]
            [GO:0045766 "positive regulation of angiogenesis" evidence=IEA]
            [GO:0045778 "positive regulation of ossification" evidence=IEA]
            [GO:0045836 "positive regulation of meiosis" evidence=IEA]
            [GO:0045892 "negative regulation of transcription, DNA-dependent"
            evidence=IEA] [GO:0045944 "positive regulation of transcription
            from RNA polymerase II promoter" evidence=IEA] [GO:0046330
            "positive regulation of JNK cascade" evidence=IEA] [GO:0048146
            "positive regulation of fibroblast proliferation" evidence=IEA]
            [GO:0048706 "embryonic skeletal system development" evidence=IEA]
            [GO:0048843 "negative regulation of axon extension involved in axon
            guidance" evidence=IEA] [GO:0048850 "hypophysis morphogenesis"
            evidence=IEA] [GO:0050680 "negative regulation of epithelial cell
            proliferation" evidence=IEA] [GO:0050718 "positive regulation of
            interleukin-1 beta secretion" evidence=IEA] [GO:0050729 "positive
            regulation of inflammatory response" evidence=IEA] [GO:0050919
            "negative chemotaxis" evidence=IEA] [GO:0051092 "positive
            regulation of NF-kappaB transcription factor activity"
            evidence=IEA] [GO:0051964 "negative regulation of synapse assembly"
            evidence=IEA] [GO:0060021 "palate development" evidence=IEA]
            [GO:0060029 "convergent extension involved in organogenesis"
            evidence=IEA] [GO:0060065 "uterus development" evidence=IEA]
            [GO:0060067 "cervix development" evidence=IEA] [GO:0060068 "vagina
            development" evidence=IEA] [GO:0060070 "canonical Wnt receptor
            signaling pathway" evidence=IEA] [GO:0060157 "urinary bladder
            development" evidence=IEA] [GO:0060324 "face development"
            evidence=IEA] [GO:0060340 "positive regulation of type I
            interferon-mediated signaling pathway" evidence=IEA] [GO:0060599
            "lateral sprouting involved in mammary gland duct morphogenesis"
            evidence=IEA] [GO:0060638 "mesenchymal-epithelial cell signaling"
            evidence=IEA] [GO:0060686 "negative regulation of prostatic bud
            formation" evidence=IEA] [GO:0060744 "mammary gland branching
            involved in thelarche" evidence=IEA] [GO:0060750 "epithelial cell
            proliferation involved in mammary gland duct elongation"
            evidence=IEA] [GO:0060762 "regulation of branching involved in
            mammary gland duct morphogenesis" evidence=IEA] [GO:0060907
            "positive regulation of macrophage cytokine production"
            evidence=IEA] [GO:0061036 "positive regulation of cartilage
            development" evidence=IEA] [GO:0061347 "planar cell polarity
            pathway involved in outflow tract morphogenesis" evidence=IEA]
            [GO:0061348 "planar cell polarity pathway involved in ventricular
            septum morphogenesis" evidence=IEA] [GO:0061349 "planar cell
            polarity pathway involved in cardiac right atrium morphogenesis"
            evidence=IEA] [GO:0061350 "planar cell polarity pathway involved in
            cardiac muscle tissue morphogenesis" evidence=IEA] [GO:0061354
            "planar cell polarity pathway involved in pericardium
            morphogenesis" evidence=IEA] [GO:0070245 "positive regulation of
            thymocyte apoptotic process" evidence=IEA] [GO:0071222 "cellular
            response to lipopolysaccharide" evidence=IEA] [GO:0071277 "cellular
            response to calcium ion" evidence=IEA] [GO:0071346 "cellular
            response to interferon-gamma" evidence=IEA] [GO:0071425
            "hematopoietic stem cell proliferation" evidence=IEA] [GO:0071542
            "dopaminergic neuron differentiation" evidence=IEA] [GO:0071560
            "cellular response to transforming growth factor beta stimulus"
            evidence=IEA] [GO:0072201 "negative regulation of mesenchymal cell
            proliferation" evidence=IEA] [GO:0090009 "primitive streak
            formation" evidence=IEA] [GO:0090037 "positive regulation of
            protein kinase C signaling cascade" evidence=IEA] [GO:0090090
            "negative regulation of canonical Wnt receptor signaling pathway"
            evidence=IEA] [GO:0090103 "cochlea morphogenesis" evidence=IEA]
            [GO:0090179 "planar cell polarity pathway involved in neural tube
            closure" evidence=IEA] [GO:2000049 "positive regulation of
            cell-cell adhesion mediated by cadherin" evidence=IEA] [GO:2000484
            "positive regulation of interleukin-8 secretion" evidence=IEA]
            InterPro:IPR005817 Pfam:PF00110 PRINTS:PR01349 SMART:SM00097
            PANTHER:PTHR12027 GO:GO:0007275 GO:GO:0045892 GO:GO:0043066
            GO:GO:0009986 GO:GO:0034613 GO:GO:0071560 GO:GO:0071277
            GO:GO:0001938 GO:GO:0005578 GO:GO:0046330 GO:GO:2000049
            GO:GO:0045944 GO:GO:0032755 GO:GO:0050729 GO:GO:0003700
            GO:GO:0010800 GO:GO:0045766 GO:GO:0010595 GO:GO:0044212
            GO:GO:0010820 GO:GO:0090037 GO:GO:0032148 GO:GO:0051092
            GO:GO:0070245 GO:GO:0045599 GO:GO:0042060 GO:GO:0090090
            GO:GO:0071346 GO:GO:0050718 GO:GO:0048146 GO:GO:0033138
            GO:GO:0045732 GO:GO:0045836 GO:GO:0050680 GO:GO:0060070
            GO:GO:0032729 GO:GO:2000484 GO:GO:0007257 GO:GO:0002053
            GO:GO:0061036 GO:GO:0045778 GO:GO:0060686 GO:GO:0030514
            GO:GO:0001667 GO:GO:0060762 GO:GO:0043032 GO:GO:0060907
            GO:GO:0090179 GO:GO:0040037 GO:GO:0072201 GO:GO:0038031
            GO:GO:0060340 GO:GO:0007223 GO:GO:0030825 GO:GO:0045080
            GO:GO:0060638 InterPro:IPR018161 PROSITE:PS00246 GO:GO:0050919
            GO:GO:0002741 GeneTree:ENSGT00700000104304 OMA:IVERCHC
            InterPro:IPR026538 PANTHER:PTHR12027:SF33 EMBL:AADN02013996
            EMBL:AADN02013997 IPI:IPI00586369 Ensembl:ENSGALT00000008687
            ArrayExpress:F1NX78 Uniprot:F1NX78
        Length = 383

 Score = 90 (36.7 bits), Expect = 0.00014, Sum P(2) = 0.00014
 Identities = 16/45 (35%), Positives = 26/45 (57%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSL 48
             G S+GQ K+C+ + + M  + + A      C   F+ RRWNCS++
Sbjct:    77 GLSQGQKKLCQLYQDHMQFIGEGAKTGIKECQYQFRHRRWNCSTV 121

 Score = 29 (15.3 bits), Expect = 0.00014, Sum P(2) = 0.00014
 Identities = 6/9 (66%), Positives = 6/9 (66%)

Query:    58 LITEFVDHF 66
             L TE VD F
Sbjct:   372 LCTEIVDQF 380


>UNIPROTKB|B1AJZ6 [details] [associations]
            symbol:WNT4 "Protein Wnt-4" species:9606 "Homo sapiens"
            [GO:0005102 "receptor binding" evidence=IEA] [GO:0005576
            "extracellular region" evidence=IEA] [GO:0007275 "multicellular
            organismal development" evidence=IEA] [GO:0016055 "Wnt receptor
            signaling pathway" evidence=IEA] InterPro:IPR005817
            InterPro:IPR009142 Pfam:PF00110 PRINTS:PR01844 PANTHER:PTHR12027
            GO:GO:0007275 GO:GO:0016055 GO:GO:0005578 EMBL:AL031281
            PANTHER:PTHR12027:SF19 EMBL:AL445253 UniGene:Hs.25766
            HGNC:HGNC:12783 IPI:IPI00641087 Ensembl:ENST00000441048
            Uniprot:B1AJZ6
        Length = 52

 Score = 91 (37.1 bits), Expect = 0.00017, P = 0.00017
 Identities = 18/41 (43%), Positives = 24/41 (58%)

Query:    12 ICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSLFLTP 52
             +CK   E+M  V + A LA   C   F++RRWNCS+L   P
Sbjct:     1 MCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLP 41


>UNIPROTKB|P49338 [details] [associations]
            symbol:wnt4 "Protein Wnt-4" species:8355 "Xenopus laevis"
            [GO:0005576 "extracellular region" evidence=IDA] [GO:0009880
            "embryonic pattern specification" evidence=IMP] [GO:0039018
            "nephrostome development" evidence=IMP] [GO:0039020 "pronephric
            nephron tubule development" evidence=IMP] [GO:0072013 "glomus
            development" evidence=IMP] InterPro:IPR005817 InterPro:IPR009142
            Pfam:PF00110 PRINTS:PR01349 PRINTS:PR01844 SMART:SM00097
            PANTHER:PTHR12027 GO:GO:0005576 GO:GO:0016055 GO:GO:0005578
            GO:GO:0009880 GO:GO:0072013 GO:GO:0039020 InterPro:IPR018161
            PROSITE:PS00246 KO:K00408 HOVERGEN:HBG001595 CTD:54361
            PANTHER:PTHR12027:SF19 EMBL:U13183 EMBL:BC087460 EMBL:M55055
            PIR:A49146 RefSeq:NP_001081197.1 RefSeq:NP_001239014.1
            UniGene:Xl.952 GeneID:397706 KEGG:xla:397706 Xenbase:XB-GENE-865047
            GO:GO:0039018 Uniprot:P49338
        Length = 351

 Score = 98 (39.6 bits), Expect = 0.00020, P = 0.00020
 Identities = 19/44 (43%), Positives = 26/44 (59%)

Query:     9 QTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSLFLTP 52
             Q ++CK   E+M  V + A LA   C   F++RRWNCS+L   P
Sbjct:    53 QVQMCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDTLP 96


>RGD|621348 [details] [associations]
            symbol:Wnt4 "wingless-type MMTV integration site family, member
            4" species:10116 "Rattus norvegicus" [GO:0001656 "metanephros
            development" evidence=ISO;IBA] [GO:0001658 "branching involved in
            ureteric bud morphogenesis" evidence=IEA;ISO;IBA] [GO:0001664
            "G-protein coupled receptor binding" evidence=IBA] [GO:0001822
            "kidney development" evidence=ISO] [GO:0001823 "mesonephros
            development" evidence=ISO] [GO:0001837 "epithelial to mesenchymal
            transition" evidence=IEA;ISO] [GO:0001838 "embryonic epithelial
            tube formation" evidence=IEA;ISO] [GO:0001889 "liver development"
            evidence=IEA;ISO] [GO:0003674 "molecular_function" evidence=ND]
            [GO:0003714 "transcription corepressor activity" evidence=IEA;ISO]
            [GO:0005109 "frizzled binding" evidence=IEA;ISO] [GO:0005578
            "proteinaceous extracellular matrix" evidence=IEA] [GO:0005615
            "extracellular space" evidence=IEA;ISO;IBA] [GO:0005737 "cytoplasm"
            evidence=IEA;ISO;IDA] [GO:0005794 "Golgi apparatus" evidence=IDA]
            [GO:0005886 "plasma membrane" evidence=IBA] [GO:0006702 "androgen
            biosynthetic process" evidence=IEA;ISO] [GO:0007276 "gamete
            generation" evidence=ISO] [GO:0007492 "endoderm development"
            evidence=IBA] [GO:0007548 "sex differentiation" evidence=ISO]
            [GO:0008584 "male gonad development" evidence=ISO;IBA] [GO:0008585
            "female gonad development" evidence=IEA;ISO;IBA] [GO:0009798 "axis
            specification" evidence=IBA] [GO:0009952 "anterior/posterior
            pattern specification" evidence=IBA] [GO:0009986 "cell surface"
            evidence=IEA;ISO] [GO:0010629 "negative regulation of gene
            expression" evidence=ISO] [GO:0010894 "negative regulation of
            steroid biosynthetic process" evidence=ISO] [GO:0018345 "protein
            palmitoylation" evidence=IEA;ISO] [GO:0022407 "regulation of
            cell-cell adhesion" evidence=IEA;ISO] [GO:0030154 "cell
            differentiation" evidence=ISO] [GO:0030237 "female sex
            determination" evidence=IEA;ISO] [GO:0030325 "adrenal gland
            development" evidence=IEA;ISO] [GO:0030501 "positive regulation of
            bone mineralization" evidence=IEA;ISO] [GO:0031012 "extracellular
            matrix" evidence=ISO] [GO:0032349 "positive regulation of
            aldosterone biosynthetic process" evidence=IEA;ISO] [GO:0032355
            "response to estradiol stimulus" evidence=IEP] [GO:0032967
            "positive regulation of collagen biosynthetic process"
            evidence=IEA;ISO] [GO:0033077 "T cell differentiation in thymus"
            evidence=ISO;IBA] [GO:0033080 "immature T cell proliferation in
            thymus" evidence=IEA;ISO] [GO:0035239 "tube morphogenesis"
            evidence=ISO] [GO:0035567 "non-canonical Wnt receptor signaling
            pathway" evidence=ISO] [GO:0038030 "non-canonical Wnt receptor
            signaling pathway via MAPK cascade" evidence=IEA;ISO] [GO:0040037
            "negative regulation of fibroblast growth factor receptor signaling
            pathway" evidence=IEA;ISO;IBA] [GO:0042445 "hormone metabolic
            process" evidence=ISO] [GO:0043066 "negative regulation of
            apoptotic process" evidence=IEA;ISO] [GO:0045165 "cell fate
            commitment" evidence=ISO] [GO:0045596 "negative regulation of cell
            differentiation" evidence=IEA;ISO] [GO:0045669 "positive regulation
            of osteoblast differentiation" evidence=IEA;ISO] [GO:0045836
            "positive regulation of meiosis" evidence=IEA;ISO] [GO:0045892
            "negative regulation of transcription, DNA-dependent"
            evidence=IEA;ISO] [GO:0045893 "positive regulation of
            transcription, DNA-dependent" evidence=ISO] [GO:0048599 "oocyte
            development" evidence=IEA;ISO;IBA] [GO:0048754 "branching
            morphogenesis of an epithelial tube" evidence=ISO] [GO:0048856
            "anatomical structure development" evidence=ISO] [GO:0051145
            "smooth muscle cell differentiation" evidence=IEA;ISO;IBA]
            [GO:0060070 "canonical Wnt receptor signaling pathway"
            evidence=ISO;IBA] [GO:0060126 "somatotropin secreting cell
            differentiation" evidence=IEA;ISO;IBA] [GO:0060129
            "thyroid-stimulating hormone-secreting cell differentiation"
            evidence=IEA;ISO;IBA] [GO:0060231 "mesenchymal to epithelial
            transition" evidence=IEA;ISO] [GO:0060748 "tertiary branching
            involved in mammary gland duct morphogenesis" evidence=IEA;ISO;IBA]
            [GO:0061180 "mammary gland epithelium development" evidence=ISO]
            [GO:0061184 "positive regulation of dermatome development"
            evidence=IEA;ISO] [GO:0061205 "paramesonephric duct development"
            evidence=ISO] [GO:0061369 "negative regulation of testicular blood
            vessel morphogenesis" evidence=IEA;ISO] [GO:0071392 "cellular
            response to estradiol stimulus" evidence=IEP] [GO:0071464 "cellular
            response to hydrostatic pressure" evidence=IEP] [GO:0071560
            "cellular response to transforming growth factor beta stimulus"
            evidence=IEA;ISO] [GO:0072033 "renal vesicle formation"
            evidence=IEA;ISO;IBA] [GO:0072034 "renal vesicle induction"
            evidence=IEA;ISO] [GO:0072164 "mesonephric tubule development"
            evidence=IEA;ISO;IBA] [GO:0072273 "metanephric nephron
            morphogenesis" evidence=IEA;ISO] [GO:0090002 "establishment of
            protein localization to plasma membrane" evidence=IEA;ISO]
            [GO:0090090 "negative regulation of canonical Wnt receptor
            signaling pathway" evidence=IEA;ISO] [GO:0090263 "positive
            regulation of canonical Wnt receptor signaling pathway"
            evidence=IEA;ISO] [GO:2000019 "negative regulation of male gonad
            development" evidence=IEA;ISO] [GO:2000066 "positive regulation of
            cortisol biosynthetic process" evidence=IEA;ISO] [GO:2000225
            "negative regulation of testosterone biosynthetic process"
            evidence=IEA;ISO] InterPro:IPR005817 InterPro:IPR009142
            Pfam:PF00110 PRINTS:PR01349 PRINTS:PR01844 SMART:SM00097 RGD:621348
            PANTHER:PTHR12027 GO:GO:0005886 GO:GO:0005794 GO:GO:0003714
            GO:GO:0045892 GO:GO:0045893 GO:GO:0043066 GO:GO:0005615
            GO:GO:0009986 GO:GO:0006702 GO:GO:0030325 GO:GO:0071560
            GO:GO:0008585 GO:GO:0009952 GO:GO:0005578 GO:GO:0032967
            GO:GO:0001889 GO:GO:0008584 GO:GO:0030501 GO:GO:0045669
            GO:GO:0051145 GO:GO:0033077 GO:GO:0022407 GO:GO:0090090
            GO:GO:0018345 GO:GO:0001837 GO:GO:0090263 GO:GO:0045836
            GO:GO:0001664 GO:GO:0060748 GO:GO:0007492 GO:GO:0001658
            GO:GO:0009798 GO:GO:0060070 GO:GO:0001656 GO:GO:0048599
            GO:GO:0071392 GO:GO:0060231 GO:GO:0060129 GO:GO:0032349
            GO:GO:0040037 GO:GO:0071464 GO:GO:0072033 GO:GO:0030237
            GO:GO:0045596 GO:GO:0010894 GO:GO:0061205 InterPro:IPR018161
            PROSITE:PS00246 KO:K00408 GO:GO:0072164 GO:GO:0061184 GO:GO:0060126
            GO:GO:0001838 GO:GO:0072034 HOGENOM:HOG000039529 HOVERGEN:HBG001595
            eggNOG:NOG284879 CTD:54361 OrthoDB:EOG49P9ZP GO:GO:2000019
            GO:GO:0061369 GO:GO:0038030 GO:GO:2000066 PANTHER:PTHR12027:SF19
            GO:GO:0033080 GO:GO:0072273 EMBL:AF188608 IPI:IPI00213470
            RefSeq:NP_445854.1 UniGene:Rn.34782 STRING:Q9QXQ5 GeneID:84426
            KEGG:rno:84426 UCSC:RGD:621348 InParanoid:Q9QXQ5 NextBio:616920
            ArrayExpress:Q9QXQ5 Genevestigator:Q9QXQ5
            GermOnline:ENSRNOG00000013166 Uniprot:Q9QXQ5
        Length = 351

 Score = 97 (39.2 bits), Expect = 0.00025, P = 0.00025
 Identities = 20/49 (40%), Positives = 27/49 (55%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSLFLTP 52
             G  + Q ++CK   E+M  V   A LA   C   F++RRWNCS+L   P
Sbjct:    48 GLIQRQVQMCKRNLEVMDSVRHGAQLAIEECQYQFRNRRWNCSTLDSLP 96


>UNIPROTKB|Q9QXQ5 [details] [associations]
            symbol:Wnt4 "Protein Wnt-4" species:10116 "Rattus
            norvegicus" [GO:0005578 "proteinaceous extracellular matrix"
            evidence=IEA] InterPro:IPR005817 InterPro:IPR009142 Pfam:PF00110
            PRINTS:PR01349 PRINTS:PR01844 SMART:SM00097 RGD:621348
            PANTHER:PTHR12027 GO:GO:0005886 GO:GO:0005794 GO:GO:0003714
            GO:GO:0045892 GO:GO:0045893 GO:GO:0043066 GO:GO:0005615
            GO:GO:0009986 GO:GO:0006702 GO:GO:0030325 GO:GO:0071560
            GO:GO:0008585 GO:GO:0009952 GO:GO:0005578 GO:GO:0032967
            GO:GO:0001889 GO:GO:0008584 GO:GO:0030501 GO:GO:0045669
            GO:GO:0051145 GO:GO:0033077 GO:GO:0022407 GO:GO:0090090
            GO:GO:0018345 GO:GO:0001837 GO:GO:0090263 GO:GO:0045836
            GO:GO:0001664 GO:GO:0060748 GO:GO:0007492 GO:GO:0001658
            GO:GO:0009798 GO:GO:0060070 GO:GO:0001656 GO:GO:0048599
            GO:GO:0071392 GO:GO:0060231 GO:GO:0060129 GO:GO:0032349
            GO:GO:0040037 GO:GO:0071464 GO:GO:0072033 GO:GO:0030237
            GO:GO:0045596 GO:GO:0010894 GO:GO:0061205 InterPro:IPR018161
            PROSITE:PS00246 KO:K00408 GO:GO:0072164 GO:GO:0061184 GO:GO:0060126
            GO:GO:0001838 GO:GO:0072034 HOGENOM:HOG000039529 HOVERGEN:HBG001595
            eggNOG:NOG284879 CTD:54361 OrthoDB:EOG49P9ZP GO:GO:2000019
            GO:GO:0061369 GO:GO:0038030 GO:GO:2000066 PANTHER:PTHR12027:SF19
            GO:GO:0033080 GO:GO:0072273 EMBL:AF188608 IPI:IPI00213470
            RefSeq:NP_445854.1 UniGene:Rn.34782 STRING:Q9QXQ5 GeneID:84426
            KEGG:rno:84426 UCSC:RGD:621348 InParanoid:Q9QXQ5 NextBio:616920
            ArrayExpress:Q9QXQ5 Genevestigator:Q9QXQ5
            GermOnline:ENSRNOG00000013166 Uniprot:Q9QXQ5
        Length = 351

 Score = 97 (39.2 bits), Expect = 0.00025, P = 0.00025
 Identities = 20/49 (40%), Positives = 27/49 (55%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSLFLTP 52
             G  + Q ++CK   E+M  V   A LA   C   F++RRWNCS+L   P
Sbjct:    48 GLIQRQVQMCKRNLEVMDSVRHGAQLAIEECQYQFRNRRWNCSTLDSLP 96


>UNIPROTKB|Q9U6V0 [details] [associations]
            symbol:wnt5 "Protein Wnt" species:7719 "Ciona intestinalis"
            [GO:0005110 "frizzled-2 binding" evidence=ISS] [GO:0005615
            "extracellular space" evidence=ISS] [GO:0005886 "plasma membrane"
            evidence=ISS] [GO:0009950 "dorsal/ventral axis specification"
            evidence=ISS] [GO:0009952 "anterior/posterior pattern
            specification" evidence=ISS] [GO:0060070 "canonical Wnt receptor
            signaling pathway" evidence=ISS] [GO:0060541 "respiratory system
            development" evidence=ISS] InterPro:IPR005817 Pfam:PF00110
            PRINTS:PR01349 SMART:SM00097 PANTHER:PTHR12027 GO:GO:0005886
            GO:GO:0005615 GO:GO:0009952 GO:GO:0005578 GO:GO:0060070
            GO:GO:0009950 InterPro:IPR018161 PROSITE:PS00246 GO:GO:0060541
            HOGENOM:HOG000039529 HOVERGEN:HBG001595 eggNOG:NOG284879
            GO:GO:0005110 GeneTree:ENSGT00700000104304 KO:K00444 CTD:32838
            EMBL:AF176668 EMBL:AB210748 RefSeq:NP_001027951.1 UniGene:Cin.27313
            STRING:Q9U6V0 Ensembl:ENSCINT00000000747 GeneID:445761
            KEGG:cin:445761 InParanoid:Q9U6V0 OMA:HERCHCK Uniprot:Q9U6V0
        Length = 360

 Score = 97 (39.2 bits), Expect = 0.00027, P = 0.00027
 Identities = 16/45 (35%), Positives = 27/45 (60%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSL 48
             G S+ Q  +C+ +   M HV++ A +  N C   F+ +RWNCS++
Sbjct:    55 GLSRNQRALCQRYANHMAHVSEGAGIGINECKWQFRGQRWNCSTV 99


>WB|WBGene00000858 [details] [associations]
            symbol:cwn-2 species:6239 "Caenorhabditis elegans"
            [GO:0016055 "Wnt receptor signaling pathway" evidence=IEA;IGI;ISS]
            [GO:0005102 "receptor binding" evidence=IEA] [GO:0005576
            "extracellular region" evidence=IEA] [GO:0007275 "multicellular
            organismal development" evidence=IEA] [GO:0040025 "vulval
            development" evidence=IGI;IMP] [GO:0060573 "cell fate specification
            involved in pattern specification" evidence=IGI] [GO:0033564
            "anterior/posterior axon guidance" evidence=IMP] [GO:0009948
            "anterior/posterior axis specification" evidence=IMP] [GO:0010084
            "specification of organ axis polarity" evidence=IGI] [GO:0009792
            "embryo development ending in birth or egg hatching" evidence=IGI]
            [GO:0005109 "frizzled binding" evidence=ISS] InterPro:IPR005817
            Pfam:PF00110 PRINTS:PR01349 SMART:SM00097 PANTHER:PTHR12027
            GO:GO:0005886 GO:GO:0009792 GO:GO:0005615 GO:GO:0005578
            GO:GO:0009948 GO:GO:0040025 GO:GO:0060070 GO:GO:0009950 EMBL:Z68301
            GO:GO:0010084 GO:GO:0060573 InterPro:IPR018161 PROSITE:PS00246
            GO:GO:0060541 GO:GO:0033564 HOGENOM:HOG000039529
            GeneTree:ENSGT00700000104317 eggNOG:NOG284879 GO:GO:0005110
            EMBL:X72943 PIR:S32695 PIR:T26037 RefSeq:NP_501822.1
            ProteinModelPortal:P34889 STRING:P34889 EnsemblMetazoa:W01B6.1
            GeneID:177870 KEGG:cel:CELE_W01B6.1 UCSC:W01B6.1 CTD:177870
            WormBase:W01B6.1 InParanoid:P34889 OMA:WWSLALN NextBio:898736
            Uniprot:P34889
        Length = 360

 Score = 97 (39.2 bits), Expect = 0.00027, P = 0.00027
 Identities = 20/53 (37%), Positives = 28/53 (52%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSLFLTPKLTP 56
             G S GQ ++C+ + + MP V+  A  A   C   F   RWNCS+ + T  L P
Sbjct:    50 GLSPGQAQVCELFKDHMPAVSIGAQNAIQECQRQFTGHRWNCSTHYSTGMLGP 102


>UNIPROTKB|P34889 [details] [associations]
            symbol:wnt-2 "Protein Wnt-2" species:6239 "Caenorhabditis
            elegans" [GO:0060541 "respiratory system development" evidence=IBA]
            [GO:0060070 "canonical Wnt receptor signaling pathway"
            evidence=IBA] [GO:0009950 "dorsal/ventral axis specification"
            evidence=IBA] [GO:0005886 "plasma membrane" evidence=IBA]
            [GO:0005615 "extracellular space" evidence=IBA] [GO:0005110
            "frizzled-2 binding" evidence=IBA] InterPro:IPR005817 Pfam:PF00110
            PRINTS:PR01349 SMART:SM00097 PANTHER:PTHR12027 GO:GO:0005886
            GO:GO:0009792 GO:GO:0005615 GO:GO:0005578 GO:GO:0009948
            GO:GO:0040025 GO:GO:0060070 GO:GO:0009950 EMBL:Z68301 GO:GO:0010084
            GO:GO:0060573 InterPro:IPR018161 PROSITE:PS00246 GO:GO:0060541
            GO:GO:0033564 HOGENOM:HOG000039529 GeneTree:ENSGT00700000104317
            eggNOG:NOG284879 GO:GO:0005110 EMBL:X72943 PIR:S32695 PIR:T26037
            RefSeq:NP_501822.1 ProteinModelPortal:P34889 STRING:P34889
            EnsemblMetazoa:W01B6.1 GeneID:177870 KEGG:cel:CELE_W01B6.1
            UCSC:W01B6.1 CTD:177870 WormBase:W01B6.1 InParanoid:P34889
            OMA:WWSLALN NextBio:898736 Uniprot:P34889
        Length = 360

 Score = 97 (39.2 bits), Expect = 0.00027, P = 0.00027
 Identities = 20/53 (37%), Positives = 28/53 (52%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSLFLTPKLTP 56
             G S GQ ++C+ + + MP V+  A  A   C   F   RWNCS+ + T  L P
Sbjct:    50 GLSPGQAQVCELFKDHMPAVSIGAQNAIQECQRQFTGHRWNCSTHYSTGMLGP 102


>UNIPROTKB|F5H7Q6 [details] [associations]
            symbol:WNT5B "Protein Wnt" species:9606 "Homo sapiens"
            [GO:0005102 "receptor binding" evidence=IEA] [GO:0007275
            "multicellular organismal development" evidence=IEA] [GO:0016055
            "Wnt receptor signaling pathway" evidence=IEA] [GO:0009986 "cell
            surface" evidence=IEA] [GO:0045600 "positive regulation of fat cell
            differentiation" evidence=IEA] [GO:0090090 "negative regulation of
            canonical Wnt receptor signaling pathway" evidence=IEA] [GO:0005578
            "proteinaceous extracellular matrix" evidence=IEA]
            InterPro:IPR005817 Pfam:PF00110 PRINTS:PR01349 SMART:SM00097
            PANTHER:PTHR12027 GO:GO:0007275 GO:GO:0009986 GO:GO:0016055
            GO:GO:0005578 GO:GO:0045600 GO:GO:0042060 GO:GO:0090090
            InterPro:IPR018161 PROSITE:PS00246 InterPro:IPR026537
            PANTHER:PTHR12027:SF23 HGNC:HGNC:16265 ChiTaRS:WNT5B EMBL:AC004671
            EMBL:AC005182 IPI:IPI01009461 Ensembl:ENST00000543071
            ArrayExpress:F5H7Q6 Bgee:F5H7Q6 Uniprot:F5H7Q6
        Length = 254

 Score = 94 (38.1 bits), Expect = 0.00030, P = 0.00030
 Identities = 17/44 (38%), Positives = 25/44 (56%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSS 47
             G S GQ K+C+ + E M ++ + A      C   F+ RRWNCS+
Sbjct:    53 GLSPGQRKLCQLYQEHMAYIGEGAKTGIKECQHQFRQRRWNCST 96


>UNIPROTKB|F1Q0S4 [details] [associations]
            symbol:WNT5B "Protein Wnt" species:9615 "Canis lupus
            familiaris" [GO:0005578 "proteinaceous extracellular matrix"
            evidence=IEA] [GO:0090090 "negative regulation of canonical Wnt
            receptor signaling pathway" evidence=IEA] [GO:0045600 "positive
            regulation of fat cell differentiation" evidence=IEA] [GO:0030335
            "positive regulation of cell migration" evidence=IEA] [GO:0009986
            "cell surface" evidence=IEA] [GO:0002062 "chondrocyte
            differentiation" evidence=IEA] [GO:0016055 "Wnt receptor signaling
            pathway" evidence=IEA] [GO:0005102 "receptor binding" evidence=IEA]
            InterPro:IPR005817 Pfam:PF00110 PRINTS:PR01349 SMART:SM00097
            PANTHER:PTHR12027 GO:GO:0009986 GO:GO:0016055 GO:GO:0005578
            GO:GO:0045600 GO:GO:0030335 GO:GO:0090090 GO:GO:0002062
            InterPro:IPR018161 PROSITE:PS00246 GeneTree:ENSGT00700000104304
            OMA:WWSLALN KO:K00444 InterPro:IPR026537 PANTHER:PTHR12027:SF23
            CTD:81029 EMBL:AAEX03015330 RefSeq:XP_543883.3
            Ensembl:ENSCAFT00000025242 GeneID:486756 KEGG:cfa:486756
            Uniprot:F1Q0S4
        Length = 358

 Score = 95 (38.5 bits), Expect = 0.00043, P = 0.00043
 Identities = 17/45 (37%), Positives = 26/45 (57%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSL 48
             G S GQ K+C+ + E M ++ + A      C   F+ RRWNCS++
Sbjct:    52 GLSPGQRKLCQLYQEHMAYIGEGAKTGIKECQYQFRQRRWNCSTV 96


>UNIPROTKB|Q5NVK2 [details] [associations]
            symbol:WNT5B "Protein Wnt-5b" species:9601 "Pongo abelii"
            [GO:0005102 "receptor binding" evidence=ISS] [GO:0016055 "Wnt
            receptor signaling pathway" evidence=ISS] [GO:0030335 "positive
            regulation of cell migration" evidence=ISS] InterPro:IPR005817
            Pfam:PF00110 PRINTS:PR01349 SMART:SM00097 PANTHER:PTHR12027
            GO:GO:0009986 GO:GO:0016055 GO:GO:0005578 GO:GO:0005102
            GO:GO:0045600 GO:GO:0030335 GO:GO:0090090 GO:GO:0002062
            InterPro:IPR018161 PROSITE:PS00246 HOVERGEN:HBG001595
            GeneTree:ENSGT00700000104304 OMA:WWSLALN KO:K00444
            OrthoDB:EOG4H19VP InterPro:IPR026537 PANTHER:PTHR12027:SF23
            CTD:81029 EMBL:CR926024 RefSeq:NP_001127098.1 UniGene:Pab.711
            Ensembl:ENSPPYT00000004905 GeneID:100174132 KEGG:pon:100174132
            InParanoid:Q5NVK2 Uniprot:Q5NVK2
        Length = 359

 Score = 95 (38.5 bits), Expect = 0.00044, P = 0.00044
 Identities = 17/45 (37%), Positives = 26/45 (57%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSL 48
             G S GQ K+C+ + E M ++ + A      C   F+ RRWNCS++
Sbjct:    53 GLSPGQRKLCQLYQEHMAYIGEGAKTGIKECQHQFRQRRWNCSTV 97


>MGI|MGI:98959 [details] [associations]
            symbol:Wnt5b "wingless-related MMTV integration site 5B"
            species:10090 "Mus musculus" [GO:0000122 "negative regulation of
            transcription from RNA polymerase II promoter" evidence=IBA]
            [GO:0001525 "angiogenesis" evidence=IBA] [GO:0002062 "chondrocyte
            differentiation" evidence=IBA] [GO:0005102 "receptor binding"
            evidence=ISO;TAS] [GO:0005110 "frizzled-2 binding" evidence=IBA]
            [GO:0005515 "protein binding" evidence=IPI] [GO:0005576
            "extracellular region" evidence=IEA] [GO:0005578 "proteinaceous
            extracellular matrix" evidence=IEA] [GO:0005615 "extracellular
            space" evidence=IBA] [GO:0005886 "plasma membrane" evidence=IBA]
            [GO:0007165 "signal transduction" evidence=TAS] [GO:0007223 "Wnt
            receptor signaling pathway, calcium modulating pathway"
            evidence=IBA] [GO:0007267 "cell-cell signaling" evidence=TAS]
            [GO:0007275 "multicellular organismal development" evidence=IEA]
            [GO:0009887 "organ morphogenesis" evidence=TAS] [GO:0009950
            "dorsal/ventral axis specification" evidence=IBA] [GO:0009952
            "anterior/posterior pattern specification" evidence=IBA]
            [GO:0009986 "cell surface" evidence=IDA] [GO:0016055 "Wnt receptor
            signaling pathway" evidence=ISO] [GO:0030335 "positive regulation
            of cell migration" evidence=ISO] [GO:0031012 "extracellular matrix"
            evidence=IDA] [GO:0031018 "endocrine pancreas development"
            evidence=IBA] [GO:0042074 "cell migration involved in gastrulation"
            evidence=IBA] [GO:0045600 "positive regulation of fat cell
            differentiation" evidence=IGI] [GO:0060027 "convergent extension
            involved in gastrulation" evidence=IBA] [GO:0060028 "convergent
            extension involved in axis elongation" evidence=IBA] [GO:0060541
            "respiratory system development" evidence=IBA] [GO:0090090
            "negative regulation of canonical Wnt receptor signaling pathway"
            evidence=IGI] InterPro:IPR005817 Pfam:PF00110 PRINTS:PR01349
            SMART:SM00097 MGI:MGI:98959 PANTHER:PTHR12027 GO:GO:0005886
            GO:GO:0005615 GO:GO:0009986 GO:GO:0009952 GO:GO:0005578
            GO:GO:0007267 GO:GO:0045600 GO:GO:0001525 GO:GO:0000122
            GO:GO:0009887 GO:GO:0030335 GO:GO:0042060 GO:GO:0031012
            GO:GO:0090090 GO:GO:0031018 GO:GO:0002062 GO:GO:0042074
            GO:GO:0060027 GO:GO:0009950 GO:GO:0060028 GO:GO:0007223
            InterPro:IPR018161 PROSITE:PS00246 GO:GO:0060541
            HOGENOM:HOG000039529 HOVERGEN:HBG001595 eggNOG:NOG284879
            GO:GO:0005110 GeneTree:ENSGT00700000104304 KO:K00444
            OrthoDB:EOG4H19VP InterPro:IPR026537 PANTHER:PTHR12027:SF23
            CTD:81029 EMBL:M89799 EMBL:BC010775 EMBL:BC051406 IPI:IPI00129100
            PIR:E36470 RefSeq:NP_001258686.1 RefSeq:NP_001258687.1
            RefSeq:NP_033551.2 UniGene:Mm.321818 STRING:P22726
            PhosphoSite:P22726 PRIDE:P22726 DNASU:22419
            Ensembl:ENSMUST00000117171 Ensembl:ENSMUST00000119369
            Ensembl:ENSMUST00000178696 GeneID:22419 KEGG:mmu:22419
            UCSC:uc009dmg.2 InParanoid:P22726 NextBio:302845 Bgee:P22726
            CleanEx:MM_WNT5B Genevestigator:P22726
            GermOnline:ENSMUSG00000030170 Uniprot:P22726
        Length = 359

 Score = 95 (38.5 bits), Expect = 0.00044, P = 0.00044
 Identities = 17/45 (37%), Positives = 26/45 (57%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSL 48
             G S GQ K+C+ + E M ++ + A      C   F+ RRWNCS++
Sbjct:    53 GLSPGQRKLCQLYQEHMSYIGEGAKTGIRECQHQFRQRRWNCSTV 97


>UNIPROTKB|F1MP15 [details] [associations]
            symbol:WNT5B "Protein Wnt" species:9913 "Bos taurus"
            [GO:0005578 "proteinaceous extracellular matrix" evidence=IEA]
            [GO:0090090 "negative regulation of canonical Wnt receptor
            signaling pathway" evidence=IEA] [GO:0045600 "positive regulation
            of fat cell differentiation" evidence=IEA] [GO:0030335 "positive
            regulation of cell migration" evidence=IEA] [GO:0009986 "cell
            surface" evidence=IEA] [GO:0002062 "chondrocyte differentiation"
            evidence=IEA] [GO:0016055 "Wnt receptor signaling pathway"
            evidence=IEA] [GO:0005102 "receptor binding" evidence=IEA]
            InterPro:IPR005817 Pfam:PF00110 PRINTS:PR01349 SMART:SM00097
            PANTHER:PTHR12027 GO:GO:0009986 GO:GO:0016055 GO:GO:0005578
            GO:GO:0045600 GO:GO:0030335 GO:GO:0090090 GO:GO:0002062
            InterPro:IPR018161 PROSITE:PS00246 GeneTree:ENSGT00700000104304
            OMA:WWSLALN InterPro:IPR026537 PANTHER:PTHR12027:SF23
            EMBL:DAAA02014602 IPI:IPI00698143 Ensembl:ENSBTAT00000001766
            Uniprot:F1MP15
        Length = 363

 Score = 95 (38.5 bits), Expect = 0.00044, P = 0.00044
 Identities = 17/45 (37%), Positives = 26/45 (57%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSL 48
             G S GQ K+C+ + E M ++ + A      C   F+ RRWNCS++
Sbjct:    57 GLSAGQRKLCQLYQEHMAYIGEGARTGIRECQHQFRQRRWNCSTV 101


>UNIPROTKB|C9J8I8 [details] [associations]
            symbol:WNT5A "Protein Wnt" species:9606 "Homo sapiens"
            [GO:0005102 "receptor binding" evidence=IEA] [GO:0007275
            "multicellular organismal development" evidence=IEA] [GO:0016055
            "Wnt receptor signaling pathway" evidence=IEA] [GO:0005578
            "proteinaceous extracellular matrix" evidence=IEA]
            InterPro:IPR005817 Pfam:PF00110 PRINTS:PR01349 SMART:SM00097
            PANTHER:PTHR12027 GO:GO:0007275 GO:GO:0016055 GO:GO:0005578
            HOGENOM:HOG000039529 HGNC:HGNC:12784 ChiTaRS:WNT5A
            InterPro:IPR026538 PANTHER:PTHR12027:SF33 EMBL:AC121764
            IPI:IPI00985138 ProteinModelPortal:C9J8I8 STRING:C9J8I8
            Ensembl:ENST00000482079 ArrayExpress:C9J8I8 Bgee:C9J8I8
            Uniprot:C9J8I8
        Length = 214

 Score = 91 (37.1 bits), Expect = 0.00045, P = 0.00045
 Identities = 16/45 (35%), Positives = 26/45 (57%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSL 48
             G S+GQ K+C  + + M ++ + A      C   F+ RRWNCS++
Sbjct:    59 GLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNCSTV 103


>UNIPROTKB|E2RHR6 [details] [associations]
            symbol:WNT3 "Protein Wnt" species:9615 "Canis lupus
            familiaris" [GO:0061180 "mammary gland epithelium development"
            evidence=IEA] [GO:0060323 "head morphogenesis" evidence=IEA]
            [GO:0060174 "limb bud formation" evidence=IEA] [GO:0060064 "Spemann
            organizer formation at the anterior end of the primitive streak"
            evidence=IEA] [GO:0048843 "negative regulation of axon extension
            involved in axon guidance" evidence=IEA] [GO:0048697 "positive
            regulation of collateral sprouting in absence of injury"
            evidence=IEA] [GO:0044339 "canonical Wnt receptor signaling pathway
            involved in osteoblast differentiation" evidence=IEA] [GO:0044338
            "canonical Wnt receptor signaling pathway involved in mesenchymal
            stem cell differentiation" evidence=IEA] [GO:0035116 "embryonic
            hindlimb morphogenesis" evidence=IEA] [GO:0035115 "embryonic
            forelimb morphogenesis" evidence=IEA] [GO:0019904 "protein domain
            specific binding" evidence=IEA] [GO:0010628 "positive regulation of
            gene expression" evidence=IEA] [GO:0009950 "dorsal/ventral axis
            specification" evidence=IEA] [GO:0009948 "anterior/posterior axis
            specification" evidence=IEA] [GO:0007411 "axon guidance"
            evidence=IEA] [GO:0005109 "frizzled binding" evidence=IEA]
            [GO:0001707 "mesoderm formation" evidence=IEA] [GO:0005578
            "proteinaceous extracellular matrix" evidence=IEA]
            InterPro:IPR005817 InterPro:IPR009141 Pfam:PF00110 PRINTS:PR01349
            PRINTS:PR01843 SMART:SM00097 PANTHER:PTHR12027 GO:GO:0007411
            GO:GO:0005578 GO:GO:0001707 GO:GO:0010628 GO:GO:0035116
            GO:GO:0035115 GO:GO:0009948 GO:GO:0009950 GO:GO:0060174
            GO:GO:0060323 GO:GO:0044338 GO:GO:0044339 GO:GO:0061180
            InterPro:IPR018161 PROSITE:PS00246 GO:GO:0048843
            GeneTree:ENSGT00690000101771 PANTHER:PTHR12027:SF18 GO:GO:0048697
            OMA:MCGCDSH GO:GO:0060064 EMBL:AAEX03006344 EMBL:AAEX03006345
            Ensembl:ENSCAFT00000021325 NextBio:20894723 Uniprot:E2RHR6
        Length = 328

 Score = 94 (38.1 bits), Expect = 0.00048, P = 0.00048
 Identities = 16/45 (35%), Positives = 24/45 (53%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSL 48
             G    Q + C+ + EIMP V +   L    C   F+ RRWNC+++
Sbjct:    23 GLVPKQLRFCRNYIEIMPSVAEGVKLGIQECQHQFRGRRWNCTTI 67


>UNIPROTKB|F1N5R1 [details] [associations]
            symbol:WNT3 "Protein Wnt" species:9913 "Bos taurus"
            [GO:0005578 "proteinaceous extracellular matrix" evidence=IEA]
            [GO:0061180 "mammary gland epithelium development" evidence=IEA]
            [GO:0060323 "head morphogenesis" evidence=IEA] [GO:0060174 "limb
            bud formation" evidence=IEA] [GO:0060064 "Spemann organizer
            formation at the anterior end of the primitive streak"
            evidence=IEA] [GO:0048843 "negative regulation of axon extension
            involved in axon guidance" evidence=IEA] [GO:0048697 "positive
            regulation of collateral sprouting in absence of injury"
            evidence=IEA] [GO:0044339 "canonical Wnt receptor signaling pathway
            involved in osteoblast differentiation" evidence=IEA] [GO:0044338
            "canonical Wnt receptor signaling pathway involved in mesenchymal
            stem cell differentiation" evidence=IEA] [GO:0035116 "embryonic
            hindlimb morphogenesis" evidence=IEA] [GO:0035115 "embryonic
            forelimb morphogenesis" evidence=IEA] [GO:0019904 "protein domain
            specific binding" evidence=IEA] [GO:0010628 "positive regulation of
            gene expression" evidence=IEA] [GO:0009950 "dorsal/ventral axis
            specification" evidence=IEA] [GO:0009948 "anterior/posterior axis
            specification" evidence=IEA] [GO:0007411 "axon guidance"
            evidence=IEA] [GO:0005109 "frizzled binding" evidence=IEA]
            [GO:0001707 "mesoderm formation" evidence=IEA] InterPro:IPR005817
            InterPro:IPR009141 Pfam:PF00110 PRINTS:PR01349 PRINTS:PR01843
            SMART:SM00097 PANTHER:PTHR12027 GO:GO:0007411 GO:GO:0005578
            GO:GO:0001707 GO:GO:0010628 GO:GO:0035116 GO:GO:0035115
            GO:GO:0009948 GO:GO:0009950 GO:GO:0060174 GO:GO:0060323
            GO:GO:0044338 GO:GO:0044339 GO:GO:0061180 InterPro:IPR018161
            PROSITE:PS00246 GO:GO:0048843 GeneTree:ENSGT00690000101771
            PANTHER:PTHR12027:SF18 GO:GO:0048697 OMA:MCGCDSH GO:GO:0060064
            EMBL:DAAA02049275 IPI:IPI00702293 Ensembl:ENSBTAT00000021312
            Uniprot:F1N5R1
        Length = 329

 Score = 94 (38.1 bits), Expect = 0.00049, P = 0.00049
 Identities = 16/45 (35%), Positives = 24/45 (53%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSL 48
             G    Q + C+ + EIMP V +   L    C   F+ RRWNC+++
Sbjct:    24 GLVPKQLRFCRNYIEIMPSVAEGVKLGIQECQHQFRGRRWNCTTI 68


>UNIPROTKB|F1NMK4 [details] [associations]
            symbol:WNT5B "Protein Wnt" species:9031 "Gallus gallus"
            [GO:0005102 "receptor binding" evidence=IEA] [GO:0016055 "Wnt
            receptor signaling pathway" evidence=IEA] [GO:0005578
            "proteinaceous extracellular matrix" evidence=IEA] [GO:0002062
            "chondrocyte differentiation" evidence=IEA] [GO:0009986 "cell
            surface" evidence=IEA] [GO:0030335 "positive regulation of cell
            migration" evidence=IEA] [GO:0045600 "positive regulation of fat
            cell differentiation" evidence=IEA] [GO:0090090 "negative
            regulation of canonical Wnt receptor signaling pathway"
            evidence=IEA] InterPro:IPR005817 Pfam:PF00110 PRINTS:PR01349
            SMART:SM00097 PANTHER:PTHR12027 GO:GO:0007275 GO:GO:0009986
            GO:GO:0016055 GO:GO:0005578 GO:GO:0045600 GO:GO:0030335
            GO:GO:0090090 InterPro:IPR018161 PROSITE:PS00246
            GeneTree:ENSGT00700000104304 InterPro:IPR026537
            PANTHER:PTHR12027:SF23 EMBL:AADN02006498 IPI:IPI00681984
            Ensembl:ENSGALT00000030547 ArrayExpress:F1NMK4 Uniprot:F1NMK4
        Length = 332

 Score = 94 (38.1 bits), Expect = 0.00049, P = 0.00049
 Identities = 18/45 (40%), Positives = 26/45 (57%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSL 48
             G S GQ K+C+ + E M  + + A  A   C   F+ RRWNCS++
Sbjct:    26 GLSPGQRKLCQLYQEHMVFIGEGARSAIKECQYQFRQRRWNCSTV 70


>RGD|3972 [details] [associations]
            symbol:Wnt3 "wingless-type MMTV integration site family, member 3"
          species:10116 "Rattus norvegicus" [GO:0000902 "cell morphogenesis"
          evidence=ISO] [GO:0001558 "regulation of cell growth" evidence=TAS]
          [GO:0001707 "mesoderm formation" evidence=ISO;IBA] [GO:0003674
          "molecular_function" evidence=ND] [GO:0005109 "frizzled binding"
          evidence=ISO] [GO:0005110 "frizzled-2 binding" evidence=IBA]
          [GO:0005578 "proteinaceous extracellular matrix" evidence=IEA]
          [GO:0005615 "extracellular space" evidence=IBA] [GO:0005737
          "cytoplasm" evidence=IDA] [GO:0005769 "early endosome" evidence=IBA]
          [GO:0005770 "late endosome" evidence=IBA] [GO:0005886 "plasma
          membrane" evidence=IBA] [GO:0007223 "Wnt receptor signaling pathway,
          calcium modulating pathway" evidence=IBA] [GO:0007411 "axon guidance"
          evidence=ISO] [GO:0008284 "positive regulation of cell proliferation"
          evidence=IBA] [GO:0009880 "embryonic pattern specification"
          evidence=IBA] [GO:0009948 "anterior/posterior axis specification"
          evidence=ISO] [GO:0009950 "dorsal/ventral axis specification"
          evidence=ISO;IBA] [GO:0009952 "anterior/posterior pattern
          specification" evidence=ISO] [GO:0010628 "positive regulation of gene
          expression" evidence=ISO] [GO:0019904 "protein domain specific
          binding" evidence=ISO] [GO:0030917 "midbrain-hindbrain boundary
          development" evidence=IBA] [GO:0031012 "extracellular matrix"
          evidence=ISO] [GO:0035115 "embryonic forelimb morphogenesis"
          evidence=ISO;IBA] [GO:0035116 "embryonic hindlimb morphogenesis"
          evidence=ISO;IBA] [GO:0042472 "inner ear morphogenesis" evidence=IBA]
          [GO:0044338 "canonical Wnt receptor signaling pathway involved in
          mesenchymal stem cell differentiation" evidence=ISO] [GO:0044339
          "canonical Wnt receptor signaling pathway involved in osteoblast
          differentiation" evidence=ISO] [GO:0045121 "membrane raft"
          evidence=IBA] [GO:0045595 "regulation of cell differentiation"
          evidence=TAS] [GO:0045599 "negative regulation of fat cell
          differentiation" evidence=IBA] [GO:0048646 "anatomical structure
          formation involved in morphogenesis" evidence=ISO] [GO:0048697
          "positive regulation of collateral sprouting in absence of injury"
          evidence=ISO] [GO:0048843 "negative regulation of axon extension
          involved in axon guidance" evidence=ISO] [GO:0060064 "Spemann
          organizer formation at the anterior end of the primitive streak"
          evidence=ISO;IBA] [GO:0060070 "canonical Wnt receptor signaling
          pathway" evidence=ISO;IBA] [GO:0060173 "limb development"
          evidence=ISO] [GO:0060174 "limb bud formation" evidence=ISO]
          [GO:0060323 "head morphogenesis" evidence=ISO;IBA] [GO:0061180
          "mammary gland epithelium development" evidence=ISO] [GO:0071425
          "hematopoietic stem cell proliferation" evidence=IBA]
          InterPro:IPR005817 InterPro:IPR009141 Pfam:PF00110 PRINTS:PR01349
          PRINTS:PR01843 SMART:SM00097 RGD:3972 PANTHER:PTHR12027 GO:GO:0005886
          GO:GO:0005615 GO:GO:0001558 GO:GO:0008284 GO:GO:0005578 GO:GO:0045121
          GO:GO:0005770 GO:GO:0042472 GO:GO:0001707 GO:GO:0045599 GO:GO:0035116
          GO:GO:0035115 GO:GO:0005769 GO:GO:0009880 GO:GO:0060070 GO:GO:0071425
          GO:GO:0009950 GO:GO:0030917 GO:GO:0060323 GO:GO:0007223
          InterPro:IPR018161 PROSITE:PS00246 GO:GO:0005110
          PANTHER:PTHR12027:SF18 GO:GO:0060064 IPI:IPI00950537
          Ensembl:ENSRNOT00000064505 UCSC:RGD:3972 Uniprot:F1M077
        Length = 334

 Score = 94 (38.1 bits), Expect = 0.00050, P = 0.00050
 Identities = 16/45 (35%), Positives = 24/45 (53%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSL 48
             G    Q + C+ + EIMP V +   L    C   F+ RRWNC+++
Sbjct:    29 GLVPKQLRFCRNYIEIMPSVAEGVKLGIQECQHQFRGRRWNCTTI 73


>UNIPROTKB|F1NVM5 [details] [associations]
            symbol:Gga.99 "Protein Wnt" species:9031 "Gallus gallus"
            [GO:0005578 "proteinaceous extracellular matrix" evidence=IEA]
            [GO:0001707 "mesoderm formation" evidence=IEA] [GO:0005109
            "frizzled binding" evidence=IEA] [GO:0007411 "axon guidance"
            evidence=IEA] [GO:0009948 "anterior/posterior axis specification"
            evidence=IEA] [GO:0009950 "dorsal/ventral axis specification"
            evidence=IEA] [GO:0010628 "positive regulation of gene expression"
            evidence=IEA] [GO:0019904 "protein domain specific binding"
            evidence=IEA] [GO:0035115 "embryonic forelimb morphogenesis"
            evidence=IEA] [GO:0035116 "embryonic hindlimb morphogenesis"
            evidence=IEA] [GO:0044338 "canonical Wnt receptor signaling pathway
            involved in mesenchymal stem cell differentiation" evidence=IEA]
            [GO:0044339 "canonical Wnt receptor signaling pathway involved in
            osteoblast differentiation" evidence=IEA] [GO:0048697 "positive
            regulation of collateral sprouting in absence of injury"
            evidence=IEA] [GO:0048843 "negative regulation of axon extension
            involved in axon guidance" evidence=IEA] [GO:0060064 "Spemann
            organizer formation at the anterior end of the primitive streak"
            evidence=IEA] [GO:0060174 "limb bud formation" evidence=IEA]
            [GO:0060323 "head morphogenesis" evidence=IEA] [GO:0061180 "mammary
            gland epithelium development" evidence=IEA] InterPro:IPR005817
            InterPro:IPR009141 Pfam:PF00110 PRINTS:PR01349 PRINTS:PR01843
            SMART:SM00097 PANTHER:PTHR12027 GO:GO:0007275 GO:GO:0005578
            GO:GO:0010628 GO:GO:0044338 InterPro:IPR018161 PROSITE:PS00246
            GeneTree:ENSGT00690000101771 PANTHER:PTHR12027:SF18 OMA:MCGCDSH
            EMBL:AADN02053924 EMBL:AADN02053922 EMBL:AADN02053923
            IPI:IPI00837483 Ensembl:ENSGALT00000001615 ArrayExpress:F1NVM5
            Uniprot:F1NVM5
        Length = 303

 Score = 93 (37.8 bits), Expect = 0.00054, P = 0.00054
 Identities = 15/40 (37%), Positives = 23/40 (57%)

Query:     9 QTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSL 48
             Q + C+ + EIMP V +   L    C   F+ RRWNC+++
Sbjct:     4 QLRFCRNYIEIMPSVAEGVKLGIQECQHQFRGRRWNCTTI 43


>UNIPROTKB|P56703 [details] [associations]
            symbol:WNT3 "Proto-oncogene Wnt-3" species:9606 "Homo
            sapiens" [GO:0007411 "axon guidance" evidence=IEA] [GO:0009948
            "anterior/posterior axis specification" evidence=IEA] [GO:0010628
            "positive regulation of gene expression" evidence=IEA] [GO:0019904
            "protein domain specific binding" evidence=IEA] [GO:0048697
            "positive regulation of collateral sprouting in absence of injury"
            evidence=IEA] [GO:0048843 "negative regulation of axon extension
            involved in axon guidance" evidence=IEA] [GO:0005578 "proteinaceous
            extracellular matrix" evidence=IEA] [GO:0001707 "mesoderm
            formation" evidence=IBA] [GO:0005110 "frizzled-2 binding"
            evidence=IBA] [GO:0005615 "extracellular space" evidence=IBA;TAS]
            [GO:0005769 "early endosome" evidence=IBA] [GO:0005770 "late
            endosome" evidence=IBA] [GO:0005886 "plasma membrane" evidence=IBA]
            [GO:0007223 "Wnt receptor signaling pathway, calcium modulating
            pathway" evidence=IBA] [GO:0008284 "positive regulation of cell
            proliferation" evidence=IBA] [GO:0009880 "embryonic pattern
            specification" evidence=IBA] [GO:0009950 "dorsal/ventral axis
            specification" evidence=IBA] [GO:0030917 "midbrain-hindbrain
            boundary development" evidence=IBA] [GO:0035115 "embryonic forelimb
            morphogenesis" evidence=IBA] [GO:0035116 "embryonic hindlimb
            morphogenesis" evidence=IBA] [GO:0042472 "inner ear morphogenesis"
            evidence=IBA] [GO:0045121 "membrane raft" evidence=IBA] [GO:0045599
            "negative regulation of fat cell differentiation" evidence=IBA]
            [GO:0060064 "Spemann organizer formation at the anterior end of the
            primitive streak" evidence=IBA] [GO:0060323 "head morphogenesis"
            evidence=IBA] [GO:0071425 "hematopoietic stem cell proliferation"
            evidence=IBA] [GO:0071300 "cellular response to retinoic acid"
            evidence=ISS] [GO:0030182 "neuron differentiation" evidence=ISS]
            [GO:0061180 "mammary gland epithelium development" evidence=IEP]
            [GO:0005109 "frizzled binding" evidence=IPI] [GO:0060070 "canonical
            Wnt receptor signaling pathway" evidence=IDA] [GO:0060174 "limb bud
            formation" evidence=IMP] [GO:0048018 "receptor agonist activity"
            evidence=IC] [GO:0044338 "canonical Wnt receptor signaling pathway
            involved in mesenchymal stem cell differentiation" evidence=IMP]
            [GO:0044339 "canonical Wnt receptor signaling pathway involved in
            osteoblast differentiation" evidence=IMP] [GO:0000902 "cell
            morphogenesis" evidence=IMP] InterPro:IPR005817 InterPro:IPR009141
            Pfam:PF00110 PRINTS:PR01349 PRINTS:PR01843 SMART:SM00097
            PANTHER:PTHR12027 GO:GO:0005886 Reactome:REACT_111102 GO:GO:0007411
            GO:GO:0005615 GO:GO:0030182 GO:GO:0008284 GO:GO:0071300
            GO:GO:0005578 GO:GO:0045121 GO:GO:0005770 GO:GO:0042472
            GO:GO:0000902 GO:GO:0001707 GO:GO:0045599 GO:GO:0010628
            GO:GO:0035116 GO:GO:0035115 GO:GO:0005769 GO:GO:0009880
            GO:GO:0009948 GO:GO:0071425 GO:GO:0009950 GO:GO:0030917
            GO:GO:0060174 GO:GO:0060323 GO:GO:0048018 GO:GO:0007223
            GO:GO:0044338 GO:GO:0044339 GO:GO:0061180 InterPro:IPR018161
            PROSITE:PS00246 GO:GO:0048843 HOGENOM:HOG000039529
            HOVERGEN:HBG001595 eggNOG:NOG284879 GO:GO:0005110 KO:K00312
            PANTHER:PTHR12027:SF18 OrthoDB:EOG4XD3R9 GO:GO:0048697
            EMBL:AY009397 EMBL:AB067628 EMBL:BC112116 EMBL:BC112118
            EMBL:BC114219 IPI:IPI00011023 PIR:A47536 RefSeq:NP_110380.1
            UniGene:Hs.445884 IntAct:P56703 STRING:P56703 PhosphoSite:P56703
            DMDM:14424477 PRIDE:P56703 DNASU:7473 Ensembl:ENST00000225512
            GeneID:7473 KEGG:hsa:7473 UCSC:uc002ikv.2 CTD:7473
            GeneCards:GC17M044839 HGNC:HGNC:12782 MIM:165330 MIM:273395
            neXtProt:NX_P56703 Orphanet:3301 PharmGKB:PA37383 InParanoid:P56703
            OMA:MCGCDSH PhylomeDB:P56703 BindingDB:P56703 ChEMBL:CHEMBL6079
            GenomeRNAi:7473 NextBio:29272 Bgee:P56703 CleanEx:HS_WNT3
            Genevestigator:P56703 GermOnline:ENSG00000108379 GO:GO:0060064
            Uniprot:P56703
        Length = 355

 Score = 94 (38.1 bits), Expect = 0.00055, P = 0.00055
 Identities = 16/45 (35%), Positives = 24/45 (53%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSL 48
             G    Q + C+ + EIMP V +   L    C   F+ RRWNC+++
Sbjct:    50 GLVPKQLRFCRNYIEIMPSVAEGVKLGIQECQHQFRGRRWNCTTI 94


>MGI|MGI:98955 [details] [associations]
            symbol:Wnt3 "wingless-related MMTV integration site 3"
            species:10090 "Mus musculus" [GO:0000122 "negative regulation of
            transcription from RNA polymerase II promoter" evidence=IBA]
            [GO:0000902 "cell morphogenesis" evidence=ISO] [GO:0001707
            "mesoderm formation" evidence=IMP] [GO:0005102 "receptor binding"
            evidence=TAS] [GO:0005109 "frizzled binding" evidence=ISO]
            [GO:0005110 "frizzled-2 binding" evidence=IBA] [GO:0005515 "protein
            binding" evidence=IPI] [GO:0005576 "extracellular region"
            evidence=IEA] [GO:0005578 "proteinaceous extracellular matrix"
            evidence=IEA] [GO:0005615 "extracellular space" evidence=IBA]
            [GO:0005737 "cytoplasm" evidence=ISO] [GO:0005769 "early endosome"
            evidence=IBA] [GO:0005770 "late endosome" evidence=IBA] [GO:0005886
            "plasma membrane" evidence=IBA] [GO:0007165 "signal transduction"
            evidence=TAS] [GO:0007223 "Wnt receptor signaling pathway, calcium
            modulating pathway" evidence=IBA] [GO:0007267 "cell-cell signaling"
            evidence=TAS] [GO:0007275 "multicellular organismal development"
            evidence=IEA] [GO:0007411 "axon guidance" evidence=IDA] [GO:0008284
            "positive regulation of cell proliferation" evidence=IBA]
            [GO:0009880 "embryonic pattern specification" evidence=IBA]
            [GO:0009887 "organ morphogenesis" evidence=TAS] [GO:0009948
            "anterior/posterior axis specification" evidence=IMP] [GO:0009950
            "dorsal/ventral axis specification" evidence=IMP] [GO:0009952
            "anterior/posterior pattern specification" evidence=IMP]
            [GO:0010628 "positive regulation of gene expression" evidence=IDA]
            [GO:0016055 "Wnt receptor signaling pathway" evidence=IEA]
            [GO:0019904 "protein domain specific binding" evidence=IPI]
            [GO:0030917 "midbrain-hindbrain boundary development" evidence=IBA]
            [GO:0031012 "extracellular matrix" evidence=IDA] [GO:0035115
            "embryonic forelimb morphogenesis" evidence=IMP] [GO:0035116
            "embryonic hindlimb morphogenesis" evidence=IMP] [GO:0042472 "inner
            ear morphogenesis" evidence=IBA] [GO:0044338 "canonical Wnt
            receptor signaling pathway involved in mesenchymal stem cell
            differentiation" evidence=ISO] [GO:0044339 "canonical Wnt receptor
            signaling pathway involved in osteoblast differentiation"
            evidence=ISO] [GO:0045121 "membrane raft" evidence=IBA] [GO:0045599
            "negative regulation of fat cell differentiation" evidence=IBA]
            [GO:0045944 "positive regulation of transcription from RNA
            polymerase II promoter" evidence=IBA] [GO:0048646 "anatomical
            structure formation involved in morphogenesis" evidence=IMP]
            [GO:0048697 "positive regulation of collateral sprouting in absence
            of injury" evidence=IDA] [GO:0048843 "negative regulation of axon
            extension involved in axon guidance" evidence=IDA] [GO:0060064
            "Spemann organizer formation at the anterior end of the primitive
            streak" evidence=IMP] [GO:0060070 "canonical Wnt receptor signaling
            pathway" evidence=ISO;IGI] [GO:0060173 "limb development"
            evidence=IMP] [GO:0060174 "limb bud formation" evidence=ISO]
            [GO:0060323 "head morphogenesis" evidence=IGI] [GO:0071425
            "hematopoietic stem cell proliferation" evidence=IBA]
            InterPro:IPR005817 InterPro:IPR009141 Pfam:PF00110 PRINTS:PR01349
            PRINTS:PR01843 SMART:SM00097 MGI:MGI:98955 PANTHER:PTHR12027
            GO:GO:0005886 GO:GO:0007411 GO:GO:0005615 GO:GO:0008284
            GO:GO:0005578 GO:GO:0045944 GO:GO:0045121 GO:GO:0005770
            GO:GO:0000122 GO:GO:0042472 GO:GO:0001707 GO:GO:0045599
            GO:GO:0031012 GO:GO:0035116 GO:GO:0035115 GO:GO:0005769
            GO:GO:0009880 GO:GO:0009948 GO:GO:0060070 GO:GO:0071425
            GO:GO:0009950 GO:GO:0030917 GO:GO:0060174 GO:GO:0060323
            GO:GO:0007223 GO:GO:0044338 GO:GO:0044339 GO:GO:0061180
            InterPro:IPR018161 PROSITE:PS00246 GO:GO:0048843
            HOGENOM:HOG000039529 HOVERGEN:HBG001595
            GeneTree:ENSGT00690000101771 eggNOG:NOG284879 GO:GO:0005110
            KO:K00312 PANTHER:PTHR12027:SF18 OrthoDB:EOG4XD3R9 GO:GO:0048697
            CTD:7473 OMA:MCGCDSH GO:GO:0060064 EMBL:M32502 IPI:IPI00110016
            PIR:A35503 RefSeq:NP_033547.1 UniGene:Mm.159091 DIP:DIP-39897N
            IntAct:P17553 STRING:P17553 PhosphoSite:P17553 PRIDE:P17553
            Ensembl:ENSMUST00000000127 GeneID:22415 KEGG:mmu:22415
            InParanoid:P17553 NextBio:302829 Bgee:P17553 CleanEx:MM_WNT3
            Genevestigator:P17553 GermOnline:ENSMUSG00000000125 Uniprot:P17553
        Length = 355

 Score = 94 (38.1 bits), Expect = 0.00055, P = 0.00055
 Identities = 16/45 (35%), Positives = 24/45 (53%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSL 48
             G    Q + C+ + EIMP V +   L    C   F+ RRWNC+++
Sbjct:    50 GLVPKQLRFCRNYIEIMPSVAEGVKLGIQECQHQFRGRRWNCTTI 94


>ZFIN|ZDB-GENE-081003-1 [details] [associations]
            symbol:wnt3 "wingless-type MMTV integration site
            family, member 3" species:7955 "Danio rerio" [GO:0016055 "Wnt
            receptor signaling pathway" evidence=IEA] [GO:0005102 "receptor
            binding" evidence=IEA] [GO:0007275 "multicellular organismal
            development" evidence=IEA] [GO:0005576 "extracellular region"
            evidence=IEA] [GO:0005578 "proteinaceous extracellular matrix"
            evidence=IEA] InterPro:IPR005817 InterPro:IPR009141 Pfam:PF00110
            PRINTS:PR01349 PRINTS:PR01843 SMART:SM00097 ZFIN:ZDB-GENE-081003-1
            PANTHER:PTHR12027 GO:GO:0007275 GO:GO:0016055 GO:GO:0005578
            InterPro:IPR018161 PROSITE:PS00246 HOGENOM:HOG000039529
            HOVERGEN:HBG001595 GeneTree:ENSGT00690000101771 eggNOG:NOG284879
            KO:K00312 PANTHER:PTHR12027:SF18 OrthoDB:EOG4XD3R9 CTD:7473
            EMBL:CABZ01028520 EMBL:CR388157 EMBL:CU570973 EMBL:EU203154
            EMBL:FJ915144 IPI:IPI00886605 RefSeq:NP_001108024.1
            UniGene:Dr.143523 STRING:B0LK22 Ensembl:ENSDART00000131175
            GeneID:569420 KEGG:dre:569420 NextBio:20889669 Uniprot:B0LK22
        Length = 355

 Score = 94 (38.1 bits), Expect = 0.00055, P = 0.00055
 Identities = 16/45 (35%), Positives = 24/45 (53%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSL 48
             G    Q + C+ + EIMP V +   L    C   F+ RRWNC+++
Sbjct:    50 GLVPKQLRFCRNYIEIMPSVAEGVKLGIQECQHQFRGRRWNCTTI 94


>UNIPROTKB|F1NMK6 [details] [associations]
            symbol:WNT5B "Protein Wnt" species:9031 "Gallus gallus"
            [GO:0005102 "receptor binding" evidence=IEA] [GO:0016055 "Wnt
            receptor signaling pathway" evidence=IEA] [GO:0005578
            "proteinaceous extracellular matrix" evidence=IEA] [GO:0002062
            "chondrocyte differentiation" evidence=IEA] [GO:0009986 "cell
            surface" evidence=IEA] [GO:0030335 "positive regulation of cell
            migration" evidence=IEA] [GO:0045600 "positive regulation of fat
            cell differentiation" evidence=IEA] [GO:0090090 "negative
            regulation of canonical Wnt receptor signaling pathway"
            evidence=IEA] InterPro:IPR005817 Pfam:PF00110 PRINTS:PR01349
            SMART:SM00097 PANTHER:PTHR12027 GO:GO:0007275 GO:GO:0009986
            GO:GO:0016055 GO:GO:0005578 GO:GO:0045600 GO:GO:0030335
            GO:GO:0090090 InterPro:IPR018161 PROSITE:PS00246
            GeneTree:ENSGT00700000104304 OMA:WWSLALN InterPro:IPR026537
            PANTHER:PTHR12027:SF23 EMBL:AADN02006498 IPI:IPI00601199
            Ensembl:ENSGALT00000021228 ArrayExpress:F1NMK6 Uniprot:F1NMK6
        Length = 358

 Score = 94 (38.1 bits), Expect = 0.00056, P = 0.00056
 Identities = 18/45 (40%), Positives = 26/45 (57%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSL 48
             G S GQ K+C+ + E M  + + A  A   C   F+ RRWNCS++
Sbjct:    52 GLSPGQRKLCQLYQEHMVFIGEGARSAIKECQYQFRQRRWNCSTV 96


>UNIPROTKB|Q9H1J7 [details] [associations]
            symbol:WNT5B "Protein Wnt-5b" species:9606 "Homo sapiens"
            [GO:0009986 "cell surface" evidence=IEA] [GO:0005578 "proteinaceous
            extracellular matrix" evidence=IEA] [GO:0001525 "angiogenesis"
            evidence=IBA] [GO:0005110 "frizzled-2 binding" evidence=IBA]
            [GO:0005615 "extracellular space" evidence=NAS;IBA] [GO:0005886
            "plasma membrane" evidence=IBA] [GO:0007223 "Wnt receptor signaling
            pathway, calcium modulating pathway" evidence=IBA] [GO:0009950
            "dorsal/ventral axis specification" evidence=IBA] [GO:0009952
            "anterior/posterior pattern specification" evidence=IBA]
            [GO:0031018 "endocrine pancreas development" evidence=IBA]
            [GO:0042074 "cell migration involved in gastrulation" evidence=IBA]
            [GO:0045600 "positive regulation of fat cell differentiation"
            evidence=IBA] [GO:0060027 "convergent extension involved in
            gastrulation" evidence=IBA] [GO:0060028 "convergent extension
            involved in axis elongation" evidence=IBA] [GO:0060541 "respiratory
            system development" evidence=IBA] [GO:0090090 "negative regulation
            of canonical Wnt receptor signaling pathway" evidence=IBA]
            [GO:0045444 "fat cell differentiation" evidence=NAS] [GO:0005102
            "receptor binding" evidence=IPI] [GO:0030335 "positive regulation
            of cell migration" evidence=IDA] [GO:0016055 "Wnt receptor
            signaling pathway" evidence=IDA;IMP] [GO:0002062 "chondrocyte
            differentiation" evidence=IEP] [GO:0030182 "neuron differentiation"
            evidence=ISS] [GO:0071300 "cellular response to retinoic acid"
            evidence=ISS] [GO:0070307 "lens fiber cell development"
            evidence=ISS] InterPro:IPR005817 Pfam:PF00110 PRINTS:PR01349
            SMART:SM00097 PANTHER:PTHR12027 GO:GO:0005886 GO:GO:0005615
            GO:GO:0009986 GO:GO:0030182 GO:GO:0009952 GO:GO:0071300
            GO:GO:0005578 GO:GO:0045600 GO:GO:0001525 GO:GO:0030335
            EMBL:CH471116 GO:GO:0042060 GO:GO:0090090 GO:GO:0031018
            GO:GO:0045444 GO:GO:0002062 GO:GO:0042074 GO:GO:0060027
            GO:GO:0009950 GO:GO:0070307 GO:GO:0060028 GO:GO:0007223
            InterPro:IPR018161 PROSITE:PS00246 GO:GO:0060541
            HOGENOM:HOG000039529 HOVERGEN:HBG001595 eggNOG:NOG284879
            GO:GO:0005110 OMA:WWSLALN KO:K00444 OrthoDB:EOG4H19VP
            InterPro:IPR026537 PANTHER:PTHR12027:SF23 EMBL:AY009399
            EMBL:AB060966 EMBL:AK290430 EMBL:BC001749 IPI:IPI00022223
            RefSeq:NP_110402.2 RefSeq:NP_116031.1 UniGene:Hs.306051
            ProteinModelPortal:Q9H1J7 IntAct:Q9H1J7 MINT:MINT-1485183
            STRING:Q9H1J7 PhosphoSite:Q9H1J7 DMDM:20532427 PRIDE:Q9H1J7
            DNASU:81029 Ensembl:ENST00000310594 Ensembl:ENST00000397196
            Ensembl:ENST00000537031 GeneID:81029 KEGG:hsa:81029 UCSC:uc001qjj.3
            CTD:81029 GeneCards:GC12P001639 HGNC:HGNC:16265 MIM:606361
            neXtProt:NX_Q9H1J7 PharmGKB:PA38104 InParanoid:Q9H1J7
            PhylomeDB:Q9H1J7 ChiTaRS:WNT5B GenomeRNAi:81029 NextBio:71352
            ArrayExpress:Q9H1J7 Bgee:Q9H1J7 CleanEx:HS_WNT5B
            Genevestigator:Q9H1J7 GermOnline:ENSG00000111186 Uniprot:Q9H1J7
        Length = 359

 Score = 94 (38.1 bits), Expect = 0.00056, P = 0.00056
 Identities = 17/44 (38%), Positives = 25/44 (56%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSS 47
             G S GQ K+C+ + E M ++ + A      C   F+ RRWNCS+
Sbjct:    53 GLSPGQRKLCQLYQEHMAYIGEGAKTGIKECQHQFRQRRWNCST 96


>FB|FBgn0010194 [details] [associations]
            symbol:Wnt5 "Wnt oncogene analog 5" species:7227 "Drosophila
            melanogaster" [GO:0005576 "extracellular region" evidence=ISS;IDA]
            [GO:0016055 "Wnt receptor signaling pathway" evidence=IGI;ISS]
            [GO:0005102 "receptor binding" evidence=ISS;IPI] [GO:0007411 "axon
            guidance" evidence=IGI;IMP] [GO:0050919 "negative chemotaxis"
            evidence=IMP] [GO:0048675 "axon extension" evidence=IMP]
            [GO:0007435 "salivary gland morphogenesis" evidence=IMP]
            [GO:0016204 "determination of muscle attachment site" evidence=IMP]
            [GO:0005110 "frizzled-2 binding" evidence=IBA] [GO:0009952
            "anterior/posterior pattern specification" evidence=IBA]
            [GO:0009950 "dorsal/ventral axis specification" evidence=IBA]
            [GO:0000122 "negative regulation of transcription from RNA
            polymerase II promoter" evidence=IBA] [GO:0005886 "plasma membrane"
            evidence=IBA] [GO:0033564 "anterior/posterior axon guidance"
            evidence=IBA] [GO:0060541 "respiratory system development"
            evidence=IBA] [GO:0060070 "canonical Wnt receptor signaling
            pathway" evidence=IBA] [GO:0005615 "extracellular space"
            evidence=IBA] InterPro:IPR005817 Pfam:PF00110 PRINTS:PR01349
            SMART:SM00097 PANTHER:PTHR12027 GO:GO:0005886 GO:GO:0005615
            GO:GO:0009952 GO:GO:0007435 EMBL:AE014298 GO:GO:0005578
            GO:GO:0060070 GO:GO:0009950 GO:GO:0048675 GO:GO:0016204
            GeneTree:ENSGT00690000101857 InterPro:IPR018161 PROSITE:PS00246
            GO:GO:0050919 GO:GO:0060541 GO:GO:0033564 eggNOG:NOG284879
            GO:GO:0005110 KO:K00444 EMBL:X64736 EMBL:M97450 EMBL:BT010268
            PIR:A48821 RefSeq:NP_476924.1 UniGene:Dm.5375 DIP:DIP-22455N
            MINT:MINT-1564058 STRING:P28466 EnsemblMetazoa:FBtr0074623
            GeneID:32838 KEGG:dme:Dmel_CG6407 CTD:32838 FlyBase:FBgn0010194
            InParanoid:P28466 OMA:RFEPIIQ OrthoDB:EOG4HQC0X PhylomeDB:P28466
            GenomeRNAi:32838 NextBio:780642 Bgee:P28466 GermOnline:CG6407
            Uniprot:P28466
        Length = 1004

 Score = 99 (39.9 bits), Expect = 0.00062, P = 0.00062
 Identities = 18/44 (40%), Positives = 25/44 (56%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSS 47
             G S  Q K C   T +MP +++ A  A   C   F++RRWNCS+
Sbjct:   553 GLSNSQKKQCVKHTSVMPAISRGARAAIQECQFQFKNRRWNCST 596


>UNIPROTKB|I3LBV3 [details] [associations]
            symbol:WNT3A "Protein Wnt" species:9823 "Sus scrofa"
            [GO:0005578 "proteinaceous extracellular matrix" evidence=IEA]
            [GO:2000727 "positive regulation of cardiac muscle cell
            differentiation" evidence=IEA] [GO:2000081 "positive regulation of
            canonical Wnt receptor signaling pathway involved in controlling
            type B pancreatic cell proliferation" evidence=IEA] [GO:2000049
            "positive regulation of cell-cell adhesion mediated by cadherin"
            evidence=IEA] [GO:0090245 "axis elongation involved in
            somitogenesis" evidence=IEA] [GO:0070527 "platelet aggregation"
            evidence=IEA] [GO:0070507 "regulation of microtubule cytoskeleton
            organization" evidence=IEA] [GO:0061317 "canonical Wnt receptor
            signaling pathway involved in cardiac muscle cell fate commitment"
            evidence=IEA] [GO:0061184 "positive regulation of dermatome
            development" evidence=IEA] [GO:0061098 "positive regulation of
            protein tyrosine kinase activity" evidence=IEA] [GO:0060021 "palate
            development" evidence=IEA] [GO:0051091 "positive regulation of
            sequence-specific DNA binding transcription factor activity"
            evidence=IEA] [GO:0048843 "negative regulation of axon extension
            involved in axon guidance" evidence=IEA] [GO:0048697 "positive
            regulation of collateral sprouting in absence of injury"
            evidence=IEA] [GO:0048343 "paraxial mesodermal cell fate
            commitment" evidence=IEA] [GO:0048337 "positive regulation of
            mesodermal cell fate specification" evidence=IEA] [GO:0048018
            "receptor agonist activity" evidence=IEA] [GO:0045944 "positive
            regulation of transcription from RNA polymerase II promoter"
            evidence=IEA] [GO:0045599 "negative regulation of fat cell
            differentiation" evidence=IEA] [GO:0043280 "positive regulation of
            cysteine-type endopeptidase activity involved in apoptotic process"
            evidence=IEA] [GO:0042472 "inner ear morphogenesis" evidence=IEA]
            [GO:0036342 "post-anal tail morphogenesis" evidence=IEA]
            [GO:0035914 "skeletal muscle cell differentiation" evidence=IEA]
            [GO:0035413 "positive regulation of catenin import into nucleus"
            evidence=IEA] [GO:0034613 "cellular protein localization"
            evidence=IEA] [GO:0033138 "positive regulation of peptidyl-serine
            phosphorylation" evidence=IEA] [GO:0032092 "positive regulation of
            protein binding" evidence=IEA] [GO:0030890 "positive regulation of
            B cell proliferation" evidence=IEA] [GO:0030879 "mammary gland
            development" evidence=IEA] [GO:0030198 "extracellular matrix
            organization" evidence=IEA] [GO:0030097 "hemopoiesis" evidence=IEA]
            [GO:0021904 "dorsal/ventral neural tube patterning" evidence=IEA]
            [GO:0021874 "Wnt receptor signaling pathway involved in forebrain
            neuroblast division" evidence=IEA] [GO:0021846 "cell proliferation
            in forebrain" evidence=IEA] [GO:0021766 "hippocampus development"
            evidence=IEA] [GO:0021527 "spinal cord association neuron
            differentiation" evidence=IEA] [GO:0019904 "protein domain specific
            binding" evidence=IEA] [GO:0010977 "negative regulation of neuron
            projection development" evidence=IEA] [GO:0010387 "signalosome
            assembly" evidence=IEA] [GO:0009986 "cell surface" evidence=IEA]
            [GO:0007411 "axon guidance" evidence=IEA] [GO:0005615
            "extracellular space" evidence=IEA] [GO:0005110 "frizzled-2
            binding" evidence=IEA] [GO:0003713 "transcription coactivator
            activity" evidence=IEA] [GO:0003136 "negative regulation of heart
            induction by canonical Wnt receptor signaling pathway"
            evidence=IEA] [GO:0002092 "positive regulation of receptor
            internalization" evidence=IEA] [GO:0001947 "heart looping"
            evidence=IEA] [GO:0001701 "in utero embryonic development"
            evidence=IEA] [GO:0001649 "osteoblast differentiation"
            evidence=IEA] InterPro:IPR005817 InterPro:IPR009141 Pfam:PF00110
            PRINTS:PR01349 PRINTS:PR01843 SMART:SM00097 PANTHER:PTHR12027
            GO:GO:0007411 GO:GO:0021766 GO:GO:0005615 GO:GO:0009986
            GO:GO:0051091 GO:GO:0034613 GO:GO:0032092 GO:GO:0001701
            GO:GO:0005578 GO:GO:2000049 GO:GO:0045944 GO:GO:0030198
            GO:GO:0003713 GO:GO:0042472 GO:GO:0030890 GO:GO:0043280
            GO:GO:0060923 GO:GO:0030097 GO:GO:0045599 GO:GO:0001947
            GO:GO:0002092 GO:GO:0001649 GO:GO:0033138 GO:GO:0060021
            GO:GO:0061098 GO:GO:0035914 GO:GO:0003136 GO:GO:0021846
            GO:GO:0021527 GO:GO:0070507 GO:GO:0030879 GO:GO:0035413
            GO:GO:0070527 GO:GO:0021904 GO:GO:0010387 GO:GO:0010977
            GO:GO:0048343 InterPro:IPR018161 PROSITE:PS00246 GO:GO:0090245
            GO:GO:0021874 GO:GO:0048843 GO:GO:0061184
            GeneTree:ENSGT00690000101771 PANTHER:PTHR12027:SF18 GO:GO:2000081
            GO:GO:0048697 OMA:QAIASHM EMBL:FP085478 Ensembl:ENSSSCT00000031062
            Uniprot:I3LBV3
        Length = 351

 Score = 93 (37.8 bits), Expect = 0.00069, P = 0.00069
 Identities = 15/45 (33%), Positives = 25/45 (55%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSL 48
             G    Q + C+ + EIMP V +   ++   C   F+ RRWNC+++
Sbjct:    46 GLVPKQLRFCRNYVEIMPSVAEGIKISIQECQHQFRGRRWNCTTI 90


>ZFIN|ZDB-GENE-001106-1 [details] [associations]
            symbol:wnt3a "wingless-type MMTV integration site
            family, member 3A" species:7955 "Danio rerio" [GO:0016055 "Wnt
            receptor signaling pathway" evidence=IEA] [GO:0005102 "receptor
            binding" evidence=IEA] [GO:0007275 "multicellular organismal
            development" evidence=IEA] [GO:0005576 "extracellular region"
            evidence=IEA] [GO:0001756 "somitogenesis" evidence=IGI;IMP]
            [GO:0030879 "mammary gland development" evidence=IBA] [GO:0009798
            "axis specification" evidence=IBA] [GO:0071425 "hematopoietic stem
            cell proliferation" evidence=IBA] [GO:0045121 "membrane raft"
            evidence=IBA] [GO:0021904 "dorsal/ventral neural tube patterning"
            evidence=IBA] [GO:0007409 "axonogenesis" evidence=IBA] [GO:0007368
            "determination of left/right symmetry" evidence=IBA] [GO:0005886
            "plasma membrane" evidence=IBA] [GO:0060070 "canonical Wnt receptor
            signaling pathway" evidence=IBA] [GO:0045599 "negative regulation
            of fat cell differentiation" evidence=IBA] [GO:0008284 "positive
            regulation of cell proliferation" evidence=IBA] [GO:0021874 "Wnt
            receptor signaling pathway involved in forebrain neuroblast
            division" evidence=IBA] [GO:0005110 "frizzled-2 binding"
            evidence=IBA] [GO:0005615 "extracellular space" evidence=IBA]
            [GO:0005770 "late endosome" evidence=IBA] [GO:0007223 "Wnt receptor
            signaling pathway, calcium modulating pathway" evidence=IBA]
            [GO:0030198 "extracellular matrix organization" evidence=IBA]
            [GO:0042472 "inner ear morphogenesis" evidence=IBA] [GO:0021766
            "hippocampus development" evidence=IBA] [GO:0048343 "paraxial
            mesodermal cell fate commitment" evidence=IBA] [GO:0005769 "early
            endosome" evidence=IBA] [GO:0005578 "proteinaceous extracellular
            matrix" evidence=IEA] [GO:0030917 "midbrain-hindbrain boundary
            development" evidence=IGI] [GO:0009880 "embryonic pattern
            specification" evidence=IGI] [GO:0036342 "post-anal tail
            morphogenesis" evidence=IGI;IMP] [GO:0009952 "anterior/posterior
            pattern specification" evidence=IGI] [GO:0007498 "mesoderm
            development" evidence=IGI] [GO:0009953 "dorsal/ventral pattern
            formation" evidence=IGI] [GO:0030903 "notochord development"
            evidence=IMP] [GO:0060026 "convergent extension" evidence=IDA]
            InterPro:IPR005817 InterPro:IPR009141 Pfam:PF00110 PRINTS:PR01349
            PRINTS:PR01843 SMART:SM00097 ZFIN:ZDB-GENE-001106-1
            PANTHER:PTHR12027 GO:GO:0005886 GO:GO:0021766 GO:GO:0005615
            GO:GO:0008284 GO:GO:0005578 GO:GO:0030198 GO:GO:0045121
            GO:GO:0005770 GO:GO:0001756 GO:GO:0042472 GO:GO:0007409
            GO:GO:0007368 GO:GO:0045599 GO:GO:0005769 GO:GO:0060026
            GO:GO:0009880 GO:GO:0009798 GO:GO:0060070 GO:GO:0071425
            GO:GO:0036342 GO:GO:0030879 GO:GO:0021904 GO:GO:0030917
            GO:GO:0030903 GO:GO:0048343 GO:GO:0007223 InterPro:IPR018161
            PROSITE:PS00246 GO:GO:0021874 HOGENOM:HOG000039529
            HOVERGEN:HBG001595 eggNOG:NOG284879 GO:GO:0005110 CTD:89780
            KO:K00312 PANTHER:PTHR12027:SF18 EMBL:AY613787 IPI:IPI00510037
            RefSeq:NP_001007186.1 UniGene:Dr.92208 STRING:Q6IYD9 GeneID:60632
            KEGG:dre:60632 InParanoid:Q6IYD9 ChEMBL:CHEMBL1255148
            NextBio:20892418 Uniprot:Q6IYD9
        Length = 365

 Score = 93 (37.8 bits), Expect = 0.00074, P = 0.00073
 Identities = 15/45 (33%), Positives = 24/45 (53%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSL 48
             G    Q + C+ + EIMP V +   +    C   F+ RRWNC+++
Sbjct:    48 GLVPKQLRFCRNYVEIMPSVAEGVKIGIQECQHQFRGRRWNCTTI 92


>ZFIN|ZDB-GENE-980526-87 [details] [associations]
            symbol:wnt5b "wingless-type MMTV integration site
            family, member 5b" species:7955 "Danio rerio" [GO:0016055 "Wnt
            receptor signaling pathway" evidence=IEA] [GO:0007275
            "multicellular organismal development" evidence=IEA] [GO:0005102
            "receptor binding" evidence=IEA;IPI] [GO:0005576 "extracellular
            region" evidence=IEA] [GO:0009826 "unidimensional cell growth"
            evidence=IMP] [GO:0060027 "convergent extension involved in
            gastrulation" evidence=IGI;IMP] [GO:0042074 "cell migration
            involved in gastrulation" evidence=IGI;IMP] [GO:0031101 "fin
            regeneration" evidence=IMP] [GO:0009950 "dorsal/ventral axis
            specification" evidence=IBA] [GO:0005615 "extracellular space"
            evidence=IBA] [GO:0045600 "positive regulation of fat cell
            differentiation" evidence=IBA] [GO:0005886 "plasma membrane"
            evidence=IBA] [GO:0090090 "negative regulation of canonical Wnt
            receptor signaling pathway" evidence=IBA] [GO:0009952
            "anterior/posterior pattern specification" evidence=IBA]
            [GO:0005110 "frizzled-2 binding" evidence=IBA] [GO:0060541
            "respiratory system development" evidence=IBA] [GO:0010172
            "embryonic body morphogenesis" evidence=IMP] [GO:0001501 "skeletal
            system development" evidence=IMP] [GO:0005578 "proteinaceous
            extracellular matrix" evidence=IEA] [GO:0060028 "convergent
            extension involved in axis elongation" evidence=IGI;IMP]
            [GO:0007223 "Wnt receptor signaling pathway, calcium modulating
            pathway" evidence=IGI;IDA] [GO:0051209 "release of sequestered
            calcium ion into cytosol" evidence=IDA] [GO:0060030 "dorsal
            convergence" evidence=IMP] [GO:0008591 "regulation of Wnt receptor
            signaling pathway, calcium modulating pathway" evidence=IGI;IMP]
            [GO:0061053 "somite development" evidence=IGI] [GO:0048884
            "neuromast development" evidence=IMP] [GO:0048840 "otolith
            development" evidence=IMP] [GO:0002574 "thrombocyte
            differentiation" evidence=IMP] [GO:0001525 "angiogenesis"
            evidence=IMP] [GO:0002062 "chondrocyte differentiation"
            evidence=IMP] [GO:0031018 "endocrine pancreas development"
            evidence=IMP] [GO:0001667 "ameboidal cell migration" evidence=IMP]
            [GO:0060026 "convergent extension" evidence=IGI] InterPro:IPR005817
            Pfam:PF00110 PRINTS:PR01349 SMART:SM00097 ZFIN:ZDB-GENE-980526-87
            PANTHER:PTHR12027 GO:GO:0005886 GO:GO:0005615 GO:GO:0009952
            GO:GO:0051209 GO:GO:0005578 GO:GO:0045600 GO:GO:0001525
            GO:GO:0009826 GO:GO:0090090 GO:GO:0031018 GO:GO:0002062
            GO:GO:0010172 GO:GO:0048840 GO:GO:0009950 GO:GO:0031101
            GO:GO:0060028 GO:GO:0060030 GO:GO:0007223 GO:GO:0002574
            GO:GO:0061053 InterPro:IPR018161 PROSITE:PS00246 GO:GO:0048884
            GO:GO:0060541 GO:GO:0005110 GeneTree:ENSGT00700000104304
            InterPro:IPR026537 PANTHER:PTHR12027:SF23 EMBL:BX649324
            EMBL:CT025936 IPI:IPI00995488 Ensembl:ENSDART00000122986
            ArrayExpress:F1QBD2 Bgee:F1QBD2 GO:GO:0008591 Uniprot:F1QBD2
        Length = 380

 Score = 93 (37.8 bits), Expect = 0.00078, P = 0.00078
 Identities = 16/45 (35%), Positives = 27/45 (60%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSL 48
             G S+GQ K+C+ + + M ++ + A      C   F+ RRWNCS++
Sbjct:    74 GLSQGQRKLCQLYQDHMVYIGEGAKTGIKECQYQFRQRRWNCSTV 118


>UNIPROTKB|B4DJF9 [details] [associations]
            symbol:WNT4 "Protein Wnt" species:9606 "Homo sapiens"
            [GO:0001658 "branching involved in ureteric bud morphogenesis"
            evidence=IEA] [GO:0001838 "embryonic epithelial tube formation"
            evidence=IEA] [GO:0003714 "transcription corepressor activity"
            evidence=IEA] [GO:0005109 "frizzled binding" evidence=IEA]
            [GO:0008585 "female gonad development" evidence=IEA] [GO:0009986
            "cell surface" evidence=IEA] [GO:0022407 "regulation of cell-cell
            adhesion" evidence=IEA] [GO:0033080 "immature T cell proliferation
            in thymus" evidence=IEA] [GO:0035567 "non-canonical Wnt receptor
            signaling pathway" evidence=IEA] [GO:0040037 "negative regulation
            of fibroblast growth factor receptor signaling pathway"
            evidence=IEA] [GO:0042445 "hormone metabolic process" evidence=IEA]
            [GO:0043066 "negative regulation of apoptotic process"
            evidence=IEA] [GO:0045596 "negative regulation of cell
            differentiation" evidence=IEA] [GO:0045836 "positive regulation of
            meiosis" evidence=IEA] [GO:0045892 "negative regulation of
            transcription, DNA-dependent" evidence=IEA] [GO:0048599 "oocyte
            development" evidence=IEA] [GO:0051145 "smooth muscle cell
            differentiation" evidence=IEA] [GO:0060126 "somatotropin secreting
            cell differentiation" evidence=IEA] [GO:0060129
            "thyroid-stimulating hormone-secreting cell differentiation"
            evidence=IEA] [GO:0060231 "mesenchymal to epithelial transition"
            evidence=IEA] [GO:0060748 "tertiary branching involved in mammary
            gland duct morphogenesis" evidence=IEA] [GO:0072033 "renal vesicle
            formation" evidence=IEA] [GO:0072034 "renal vesicle induction"
            evidence=IEA] [GO:0072164 "mesonephric tubule development"
            evidence=IEA] [GO:0072273 "metanephric nephron morphogenesis"
            evidence=IEA] [GO:2000225 "negative regulation of testosterone
            biosynthetic process" evidence=IEA] [GO:0005578 "proteinaceous
            extracellular matrix" evidence=IEA] InterPro:IPR005817
            InterPro:IPR009142 Pfam:PF00110 PRINTS:PR01349 PRINTS:PR01844
            SMART:SM00097 PANTHER:PTHR12027 GO:GO:0005794 GO:GO:0003714
            GO:GO:0045892 GO:GO:0045893 GO:GO:0043066 GO:GO:0009986
            GO:GO:0008585 GO:GO:0005578 GO:GO:0008584 GO:GO:0051145
            GO:GO:0022407 GO:GO:0042445 GO:GO:0045836 GO:GO:0060748
            GO:GO:0001658 GO:GO:0060070 GO:GO:0048599 GO:GO:0071392
            GO:GO:0060231 GO:GO:0060129 EMBL:AL031281 GO:GO:0040037
            GO:GO:0071464 GO:GO:0072033 GO:GO:0045596 GO:GO:0035567
            GO:GO:0061205 InterPro:IPR018161 PROSITE:PS00246 GO:GO:0072164
            GO:GO:0060126 GO:GO:0001838 GO:GO:0072034 HOVERGEN:HBG001595
            PANTHER:PTHR12027:SF19 EMBL:AL445253 UniGene:Hs.25766
            HGNC:HGNC:12783 GO:GO:0033080 GO:GO:0072273 EMBL:AK296058
            IPI:IPI01014462 STRING:B4DJF9 Ensembl:ENST00000542383
            Uniprot:B4DJF9
        Length = 296

 Score = 91 (37.1 bits), Expect = 0.00087, P = 0.00087
 Identities = 18/41 (43%), Positives = 24/41 (58%)

Query:    12 ICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSLFLTP 52
             +CK   E+M  V + A LA   C   F++RRWNCS+L   P
Sbjct:     1 MCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLP 41


>UNIPROTKB|Q2LMP1 [details] [associations]
            symbol:WNT3A "Protein Wnt-3a" species:9031 "Gallus gallus"
            [GO:0005102 "receptor binding" evidence=IEA] [GO:0005578
            "proteinaceous extracellular matrix" evidence=IEA] [GO:0061303
            "cornea development in camera-type eye" evidence=IEP] [GO:0030509
            "BMP signaling pathway" evidence=IDA] [GO:0045743 "positive
            regulation of fibroblast growth factor receptor signaling pathway"
            evidence=TAS] [GO:0060173 "limb development" evidence=TAS]
            [GO:0009953 "dorsal/ventral pattern formation" evidence=TAS]
            [GO:0048263 "determination of dorsal identity" evidence=TAS]
            [GO:0060070 "canonical Wnt receptor signaling pathway"
            evidence=NAS] [GO:0035108 "limb morphogenesis" evidence=NAS]
            InterPro:IPR005817 InterPro:IPR009141 Pfam:PF00110 PRINTS:PR01349
            PRINTS:PR01843 SMART:SM00097 PANTHER:PTHR12027 GO:GO:0016055
            GO:GO:0005578 GO:GO:0030509 GO:GO:0060173 GO:GO:0061303
            GO:GO:0045743 InterPro:IPR018161 PROSITE:PS00246
            HOGENOM:HOG000039529 HOVERGEN:HBG001595
            GeneTree:ENSGT00690000101771 eggNOG:NOG284879 EMBL:AB024080
            EMBL:DQ022307 EMBL:EF068232 IPI:IPI00572494 IPI:IPI00682266
            RefSeq:NP_001165072.1 RefSeq:NP_990006.2 UniGene:Gga.209
            STRING:Q2LMP1 Ensembl:ENSGALT00000031304 GeneID:395396
            KEGG:gga:395396 CTD:89780 InParanoid:Q9PWH1 KO:K00312
            NextBio:20815480 ArrayExpress:Q2LMP1 PANTHER:PTHR12027:SF18
            Uniprot:Q2LMP1
        Length = 352

 Score = 92 (37.4 bits), Expect = 0.00090, P = 0.00089
 Identities = 15/45 (33%), Positives = 24/45 (53%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSL 48
             G    Q + C+ + EIMP V +   +    C   F+ RRWNC+++
Sbjct:    47 GLVPKQLRFCRNYVEIMPSVAEGVKIGIQECQHQFRGRRWNCTTV 91


>ZFIN|ZDB-GENE-060328-3 [details] [associations]
            symbol:wnt5a "wingless-type MMTV integration site
            family, member 5a" species:7955 "Danio rerio" [GO:0005102 "receptor
            binding" evidence=IEA] [GO:0005576 "extracellular region"
            evidence=IEA] [GO:0016055 "Wnt receptor signaling pathway"
            evidence=IEA] [GO:0007275 "multicellular organismal development"
            evidence=IEA] [GO:0090009 "primitive streak formation"
            evidence=IBA] [GO:0001756 "somitogenesis" evidence=IBA] [GO:0060599
            "lateral sprouting involved in mammary gland duct morphogenesis"
            evidence=IBA] [GO:0060029 "convergent extension involved in
            organogenesis" evidence=IBA] [GO:0003323 "type B pancreatic cell
            development" evidence=IBA] [GO:0090103 "cochlea morphogenesis"
            evidence=IBA] [GO:0060157 "urinary bladder development"
            evidence=IBA] [GO:0050679 "positive regulation of epithelial cell
            proliferation" evidence=IBA] [GO:0003344 "pericardium
            morphogenesis" evidence=IBA] [GO:0005886 "plasma membrane"
            evidence=IBA] [GO:0043507 "positive regulation of JUN kinase
            activity" evidence=IBA] [GO:0090090 "negative regulation of
            canonical Wnt receptor signaling pathway" evidence=IBA] [GO:0060744
            "mammary gland branching involved in thelarche" evidence=IBA]
            [GO:0042733 "embryonic digit morphogenesis" evidence=IBA]
            [GO:0060762 "regulation of branching involved in mammary gland duct
            morphogenesis" evidence=IBA] [GO:0007223 "Wnt receptor signaling
            pathway, calcium modulating pathway" evidence=IBA] [GO:0046330
            "positive regulation of JNK cascade" evidence=IBA] [GO:0001947
            "heart looping" evidence=IBA] [GO:0002053 "positive regulation of
            mesenchymal cell proliferation" evidence=IBA] [GO:0071425
            "hematopoietic stem cell proliferation" evidence=IBA] [GO:0040037
            "negative regulation of fibroblast growth factor receptor signaling
            pathway" evidence=IBA] [GO:0005110 "frizzled-2 binding"
            evidence=IBA] [GO:0030514 "negative regulation of BMP signaling
            pathway" evidence=IBA] [GO:0005615 "extracellular space"
            evidence=IBA] [GO:0061036 "positive regulation of cartilage
            development" evidence=IBA] [GO:0060071 "Wnt receptor signaling
            pathway, planar cell polarity pathway" evidence=IBA] [GO:0060750
            "epithelial cell proliferation involved in mammary gland duct
            elongation" evidence=IBA] [GO:0009950 "dorsal/ventral axis
            specification" evidence=IBA] [GO:0071542 "dopaminergic neuron
            differentiation" evidence=IBA] [GO:0048546 "digestive tract
            morphogenesis" evidence=IBA] [GO:0060541 "respiratory system
            development" evidence=IBA] [GO:0001843 "neural tube closure"
            evidence=IBA] [GO:0005578 "proteinaceous extracellular matrix"
            evidence=IEA] InterPro:IPR005817 Pfam:PF00110 PRINTS:PR01349
            SMART:SM00097 ZFIN:ZDB-GENE-060328-3 PANTHER:PTHR12027
            GO:GO:0005886 GO:GO:0005615 GO:GO:0071542 GO:GO:0005578
            GO:GO:0046330 GO:GO:0001756 GO:GO:0001843 GO:GO:0090090
            GO:GO:0001947 GO:GO:0042733 GO:GO:0060599 GO:GO:0060750
            GO:GO:0060744 GO:GO:0071425 GO:GO:0009950 GO:GO:0050679
            GO:GO:0002053 GO:GO:0048546 GO:GO:0061036 GO:GO:0003323
            GO:GO:0030514 GO:GO:0090009 GO:GO:0060762 GO:GO:0040037
            GO:GO:0090103 GO:GO:0060071 GO:GO:0043507 GO:GO:0003344
            GO:GO:0007223 InterPro:IPR018161 PROSITE:PS00246 GO:GO:0060157
            GO:GO:0060541 GO:GO:0060029 GO:GO:0005110
            GeneTree:ENSGT00700000104304 InterPro:IPR026538
            PANTHER:PTHR12027:SF33 EMBL:CABZ01074186 EMBL:CABZ01074187
            EMBL:CABZ01074188 EMBL:CABZ01074189 EMBL:CABZ01074190
            EMBL:CABZ01074191 EMBL:CABZ01074192 EMBL:CABZ01074193
            EMBL:CABZ01074194 EMBL:CABZ01074195 EMBL:CABZ01074196
            EMBL:CABZ01074197 EMBL:CABZ01074198 EMBL:CABZ01074199
            EMBL:CABZ01074200 EMBL:CABZ01074202 EMBL:CABZ01112331
            EMBL:CABZ01112332 EMBL:CABZ01112333 EMBL:CABZ01112334
            EMBL:CABZ01112335 EMBL:CABZ01112336 EMBL:CABZ01112337
            IPI:IPI00773563 Ensembl:ENSDART00000023675
            Ensembl:ENSDART00000123877 Uniprot:F1Q8M2
        Length = 374

 Score = 92 (37.4 bits), Expect = 0.00098, P = 0.00098
 Identities = 16/45 (35%), Positives = 26/45 (57%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSL 48
             G SKGQ K+C+ + + M ++ + A      C   F+  RWNCS++
Sbjct:    68 GLSKGQKKLCQLYQDHMQYIGEGAKTGIRECQHQFRHHRWNCSTV 112


>UNIPROTKB|F1N8G8 [details] [associations]
            symbol:WNT3A "Protein Wnt" species:9031 "Gallus gallus"
            [GO:0005578 "proteinaceous extracellular matrix" evidence=IEA]
            [GO:0001649 "osteoblast differentiation" evidence=IEA] [GO:0001701
            "in utero embryonic development" evidence=IEA] [GO:0001947 "heart
            looping" evidence=IEA] [GO:0002092 "positive regulation of receptor
            internalization" evidence=IEA] [GO:0003136 "negative regulation of
            heart induction by canonical Wnt receptor signaling pathway"
            evidence=IEA] [GO:0003713 "transcription coactivator activity"
            evidence=IEA] [GO:0005110 "frizzled-2 binding" evidence=IEA]
            [GO:0005615 "extracellular space" evidence=IEA] [GO:0007411 "axon
            guidance" evidence=IEA] [GO:0009986 "cell surface" evidence=IEA]
            [GO:0010387 "signalosome assembly" evidence=IEA] [GO:0010977
            "negative regulation of neuron projection development"
            evidence=IEA] [GO:0019904 "protein domain specific binding"
            evidence=IEA] [GO:0021527 "spinal cord association neuron
            differentiation" evidence=IEA] [GO:0021766 "hippocampus
            development" evidence=IEA] [GO:0021846 "cell proliferation in
            forebrain" evidence=IEA] [GO:0021874 "Wnt receptor signaling
            pathway involved in forebrain neuroblast division" evidence=IEA]
            [GO:0021904 "dorsal/ventral neural tube patterning" evidence=IEA]
            [GO:0030097 "hemopoiesis" evidence=IEA] [GO:0030198 "extracellular
            matrix organization" evidence=IEA] [GO:0030879 "mammary gland
            development" evidence=IEA] [GO:0030890 "positive regulation of B
            cell proliferation" evidence=IEA] [GO:0032092 "positive regulation
            of protein binding" evidence=IEA] [GO:0033138 "positive regulation
            of peptidyl-serine phosphorylation" evidence=IEA] [GO:0034613
            "cellular protein localization" evidence=IEA] [GO:0035413 "positive
            regulation of catenin import into nucleus" evidence=IEA]
            [GO:0035914 "skeletal muscle cell differentiation" evidence=IEA]
            [GO:0036342 "post-anal tail morphogenesis" evidence=IEA]
            [GO:0042472 "inner ear morphogenesis" evidence=IEA] [GO:0043280
            "positive regulation of cysteine-type endopeptidase activity
            involved in apoptotic process" evidence=IEA] [GO:0045599 "negative
            regulation of fat cell differentiation" evidence=IEA] [GO:0045944
            "positive regulation of transcription from RNA polymerase II
            promoter" evidence=IEA] [GO:0048018 "receptor agonist activity"
            evidence=IEA] [GO:0048337 "positive regulation of mesodermal cell
            fate specification" evidence=IEA] [GO:0048343 "paraxial mesodermal
            cell fate commitment" evidence=IEA] [GO:0048697 "positive
            regulation of collateral sprouting in absence of injury"
            evidence=IEA] [GO:0048843 "negative regulation of axon extension
            involved in axon guidance" evidence=IEA] [GO:0051091 "positive
            regulation of sequence-specific DNA binding transcription factor
            activity" evidence=IEA] [GO:0060021 "palate development"
            evidence=IEA] [GO:0061098 "positive regulation of protein tyrosine
            kinase activity" evidence=IEA] [GO:0061184 "positive regulation of
            dermatome development" evidence=IEA] [GO:0061317 "canonical Wnt
            receptor signaling pathway involved in cardiac muscle cell fate
            commitment" evidence=IEA] [GO:0070507 "regulation of microtubule
            cytoskeleton organization" evidence=IEA] [GO:0070527 "platelet
            aggregation" evidence=IEA] [GO:0090245 "axis elongation involved in
            somitogenesis" evidence=IEA] [GO:2000049 "positive regulation of
            cell-cell adhesion mediated by cadherin" evidence=IEA] [GO:2000081
            "positive regulation of canonical Wnt receptor signaling pathway
            involved in controlling type B pancreatic cell proliferation"
            evidence=IEA] [GO:2000727 "positive regulation of cardiac muscle
            cell differentiation" evidence=IEA] InterPro:IPR005817
            InterPro:IPR009141 Pfam:PF00110 PRINTS:PR01349 PRINTS:PR01843
            SMART:SM00097 PANTHER:PTHR12027 GO:GO:0007275 GO:GO:0005615
            GO:GO:0009986 GO:GO:0051091 GO:GO:0034613 GO:GO:0032092
            GO:GO:0005578 GO:GO:2000049 GO:GO:0045944 GO:GO:0030198
            GO:GO:0003713 GO:GO:0030890 GO:GO:0043280 GO:GO:0045599
            GO:GO:0002092 GO:GO:0033138 GO:GO:0061098 GO:GO:0060070
            GO:GO:0070507 GO:GO:0035413 GO:GO:0048103 GO:GO:0010387
            InterPro:IPR018161 PROSITE:PS00246 GO:GO:0061184
            GeneTree:ENSGT00690000101771 RefSeq:NP_990006.2 UniGene:Gga.209
            GeneID:395396 KEGG:gga:395396 CTD:89780 KO:K00312 NextBio:20815480
            PANTHER:PTHR12027:SF18 GO:GO:2000081 OMA:QAIASHM EMBL:AADN02000137
            EMBL:AADN02000138 EMBL:AADN02000139 EMBL:AADN02000140
            EMBL:AADN02000141 EMBL:AADN02000142 EMBL:AADN02000143
            IPI:IPI01017353 Ensembl:ENSGALT00000031303 ArrayExpress:F1N8G8
            Uniprot:F1N8G8
        Length = 376

 Score = 92 (37.4 bits), Expect = 0.00099, P = 0.00099
 Identities = 15/45 (33%), Positives = 24/45 (53%)

Query:     4 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSL 48
             G    Q + C+ + EIMP V +   +    C   F+ RRWNC+++
Sbjct:    71 GLVPKQLRFCRNYVEIMPSVAEGVKIGIQECQHQFRGRRWNCTTV 115


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.325   0.135   0.452    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0       66        66   0.00091  102 3  11 22  0.39    28
                                                     29  0.48    28


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  64
  No. of states in DFA:  574 (61 KB)
  Total size of DFA:  111 KB (2073 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  6.94u 0.10s 7.04t   Elapsed:  00:00:04
  Total cpu time:  6.95u 0.10s 7.05t   Elapsed:  00:00:04
  Start:  Thu Aug 15 11:30:34 2013   End:  Thu Aug 15 11:30:38 2013

Back to top