Query         psy11187
Match_columns 115
No_of_seqs    71 out of 73
Neff          3.5 
Searched_HMMs 46136
Date          Fri Aug 16 20:19:42 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy11187.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/11187hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 smart00570 AWS associated with  99.2 1.7E-11 3.6E-16   79.0   2.9   35   55-91      1-40  (51)
  2 KOG4442|consensus               97.2 0.00019   4E-09   66.0   2.2   57   31-87     38-103 (729)
  3 KOG1081|consensus               96.1  0.0024 5.1E-08   55.6   1.3   84    2-89    208-300 (463)
  4 PF07645 EGF_CA:  Calcium-bindi  78.2    0.39 8.6E-06   28.4  -1.0   30   61-91      4-34  (42)
  5 smart00468 PreSET N-terminal t  75.8     3.7 7.9E-05   27.9   3.1   41   30-72     22-62  (98)
  6 PF05033 Pre-SET:  Pre-SET moti  44.9      15 0.00031   24.8   1.5   33   30-63     20-52  (103)
  7 smart00179 EGF_CA Calcium-bind  35.2      12 0.00026   20.2  -0.1   24   66-90      9-32  (39)
  8 cd08002 WGR_PARP3_like WGR dom  31.0      79  0.0017   22.2   3.5   38    4-41     61-98  (100)
  9 cd00053 EGF Epidermal growth f  29.8      16 0.00035   18.8  -0.2   24   65-89      5-28  (36)
 10 PF10393 Matrilin_ccoil:  Trime  29.0      23  0.0005   22.5   0.5   11   62-72      3-13  (47)
 11 PF01535 PPR:  PPR repeat;  Int  22.1      92   0.002   15.5   2.0   15    3-17     15-29  (31)
 12 TIGR00756 PPR pentatricopeptid  21.7 1.1E+02  0.0023   15.3   2.1   14    4-17     16-29  (35)
 13 PRK00736 hypothetical protein;  21.2 1.3E+02  0.0028   19.8   2.9    8   29-36     61-68  (68)
 14 TIGR02573 LcrG_PcrG type III s  21.2      66  0.0014   23.2   1.6   29    9-37     57-86  (90)
 15 PF14044 NETI:  NETI protein     20.5      43 0.00094   22.3   0.5    9   72-80     11-19  (57)
 16 PF04102 SlyX:  SlyX;  InterPro  20.2      66  0.0014   21.0   1.4    9   28-36     61-69  (69)

No 1  
>smart00570 AWS associated with SET domains. subdomain of PRESET
Probab=99.17  E-value=1.7e-11  Score=78.98  Aligned_cols=35  Identities=29%  Similarity=0.658  Sum_probs=30.5

Q ss_pred             CCCCceecC----CCCCCCCCchhHHHhhhhhcC-CcCccce
Q psy11187         55 SSTPVCECD----ESSPCGVGSSCINSSIGQSAE-SCIAISS   91 (115)
Q Consensus        55 sE~~~C~C~----d~~PCG~~S~CLNRmL~~EC~-~C~a~~~   91 (115)
                      .|.++|+|.    |+++||  ++||||||++||. .|++|+.
T Consensus         1 ~e~~~C~C~~~~~~~~~Cg--sdClNR~l~~EC~~~C~~G~~   40 (51)
T smart00570        1 DDIMTCECKPTDDDEGACG--SDCLNRMLLIECSSDCPCGSY   40 (51)
T ss_pred             CCCceeeCccCCCCCCCcc--hHHHHHHHhhhcCCCCCCCcC
Confidence            378999992    478999  9999999999999 9999864


No 2  
>KOG4442|consensus
Probab=97.19  E-value=0.00019  Score=65.96  Aligned_cols=57  Identities=18%  Similarity=0.446  Sum_probs=38.8

Q ss_pred             CCCCCceeeeccccccccccc-CCCCCCCceec----CCC--CCCCCCchhHHHhhhhhcC--CcC
Q psy11187         31 SRPSKYVKIKTNKPVGTVRLE-TDKSSTPVCEC----DES--SPCGVGSSCINSSIGQSAE--SCI   87 (115)
Q Consensus        31 ~KPP~YkkIKsNkpVg~vr~~-~D~sE~~~C~C----~d~--~PCG~~S~CLNRmL~~EC~--~C~   87 (115)
                      .+-|.|.++=-++.....+.. ...-+.++|+|    .|+  .-|+++++|||||+++||.  .|+
T Consensus        38 ~e~~~~f~~~~e~~y~~krk~~~ee~~~m~Cdc~~~~~d~~n~~~~cg~~CiNr~t~iECs~~~C~  103 (729)
T KOG4442|consen   38 EEALTKFENLDEKFYANKRKKKKEENDEMICDCKPKTGDGANGACACGEDCINRMTSIECSDRECP  103 (729)
T ss_pred             cccchhhhhhhhhhhHHhhccCcccCcceeeecccccccccccccccCccccchhhhcccCCccCC
Confidence            344555554444444444544 33338899999    221  4688889999999999999  788


No 3  
>KOG1081|consensus
Probab=96.12  E-value=0.0024  Score=55.64  Aligned_cols=84  Identities=17%  Similarity=0.311  Sum_probs=72.6

Q ss_pred             chHHHHHHHHHHHHHhhhhHHhHhhhcccCCCCCceeeeccccccccccc-CCCCCCCceec--CCCCC--CCCCchhHH
Q psy11187          2 TSLREAAEAFREFQRNRDRIKTEETNERASRPSKYVKIKTNKPVGTVRLE-TDKSSTPVCEC--DESSP--CGVGSSCIN   76 (115)
Q Consensus         2 ~ALeEA~~~f~elK~~Re~~~~~e~~~~~~KPP~YkkIKsNkpVg~vr~~-~D~sE~~~C~C--~d~~P--CG~~S~CLN   76 (115)
                      +++.++..+|.+++.+.+....+    ..++++.|..|+++.|++..+.. .....+..++|  +++.|  +|..+.+++
T Consensus       208 ~~~~~~~~r~~~~~~q~~~~~~~----~e~k~~~~~~~~~~~~~~~~~~~~~~~~~~~k~~~~~~~~~~~~~~~~~~~~~  283 (463)
T KOG1081|consen  208 EKIKEAKARFGKLKAQWEAGIKQ----KELKPEEYKRIKVVCPIGDQQIYSAAVSCIKKLLAKPTDEKPNSRGASEEATK  283 (463)
T ss_pred             hhhhcccchhhhcccchhhccch----hhcccccccccccccCcCcccccchhhhhhhhccccccccccccCCcHHHhhh
Confidence            46778889999999998877766    68999999999999999999977 88899999999  67776  899999999


Q ss_pred             --HhhhhhcC--CcCcc
Q psy11187         77 --SSIGQSAE--SCIAI   89 (115)
Q Consensus        77 --RmL~~EC~--~C~a~   89 (115)
                        ++++++|+  .|++.
T Consensus       284 ~~~~~~~~~~p~~~~~~  300 (463)
T KOG1081|consen  284 SEKMLAYEVHPKVCSAE  300 (463)
T ss_pred             hHHhhhhhhcccccccc
Confidence              99999996  44443


No 4  
>PF07645 EGF_CA:  Calcium-binding EGF domain;  InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins. Many of these proteins require calcium for their biological function and a calcium-binding site has been found at the N terminus of some EGF-like domains []. Calcium-binding may be crucial for numerous protein-protein interactions. For human coagulation factor IX it has been shown [] that the calcium-ligands form a pentagonal bipyramid. The first, third and fourth conserved negatively charged or polar residues are side chain ligands. The latter is possibly hydroxylated (see aspartic acid and asparagine hydroxylation site) []. A conserved aromatic residue, as well as the second conserved negative residue, are thought to be involved in stabilising the calcium-binding site. As in non-calcium binding EGF-like domains, there are six conserved cysteines and the structure of both types is very similar as calcium-binding induces only strictly local structural changes [].  +------------------+ +---------+ | | | | nxnnC-x(3,14)-C-x(3,7)-CxxbxxxxaxC-x(1,6)-C-x(8,13)-Cx | | +------------------+ 'n': negatively charged or polar residue [DEQN] 'b': possibly beta-hydroxylated residue [DN] 'a': aromatic amino acid 'C': cysteine, involved in disulphide bond 'x': any amino acid. ; GO: 0005509 calcium ion binding; PDB: 2VJ3_A 1TOZ_A 1LMJ_A 1UZQ_A 1UZK_A 1UZJ_B 1UZP_A 1EMO_A 1EMN_A 2RR0_A ....
Probab=78.24  E-value=0.39  Score=28.39  Aligned_cols=30  Identities=23%  Similarity=0.521  Sum_probs=25.3

Q ss_pred             ec-CCCCCCCCCchhHHHhhhhhcCCcCccce
Q psy11187         61 EC-DESSPCGVGSSCINSSIGQSAESCIAISS   91 (115)
Q Consensus        61 ~C-~d~~PCG~~S~CLNRmL~~EC~~C~a~~~   91 (115)
                      +| ...++|+..+.|+|..--|.|. |+.|-.
T Consensus         4 EC~~~~~~C~~~~~C~N~~Gsy~C~-C~~Gy~   34 (42)
T PF07645_consen    4 ECAEGPHNCPENGTCVNTEGSYSCS-CPPGYE   34 (42)
T ss_dssp             TTTTTSSSSSTTSEEEEETTEEEEE-ESTTEE
T ss_pred             ccCCCCCcCCCCCEEEcCCCCEEee-CCCCcE
Confidence            46 4557999999999999999998 887765


No 5  
>smart00468 PreSET N-terminal to some SET domains. A Cys-rich putative Zn2+-binding domain that occurs N-terminal to some SET domains. Function is unknown. Unpublished.
Probab=75.82  E-value=3.7  Score=27.85  Aligned_cols=41  Identities=17%  Similarity=0.319  Sum_probs=29.6

Q ss_pred             cCCCCCceeeecccccccccccCCCCCCCceecCCCCCCCCCc
Q psy11187         30 ASRPSKYVKIKTNKPVGTVRLETDKSSTPVCECDESSPCGVGS   72 (115)
Q Consensus        30 ~~KPP~YkkIKsNkpVg~vr~~~D~sE~~~C~C~d~~PCG~~S   72 (115)
                      ...||.|+-|+.+.+-..+-+..+.+-..-|+|++  .|...+
T Consensus        22 ~~~p~~F~Yi~~~~~~~gv~~~~~~~~~~gC~C~~--~C~~~~   62 (98)
T smart00468       22 DPPPPDFEYISEYIYGQGVPIDRSPSPLVGCSCSG--DCSSSN   62 (98)
T ss_pred             CCCCCCcEECcceEcCCCcccccCCCCCCCCcCCC--CCCCCC
Confidence            44568999999999877664345677778899954  565553


No 6  
>PF05033 Pre-SET:  Pre-SET motif;  InterPro: IPR007728 This region is found in a number of histone lysine methyltransferases (HMTase), N-terminal to the SET domain; it is generally described as the pre-SET domain. Histone lysine methylation is part of the histone code that regulated chromatin function and epigenetic control of gene function. Histone lysine methyltransferases (HMTase) differ both in their substrate specificity for the various acceptor lysines as well as in their product specificity for the number of methyl groups (one, two, or three) they transfer. With just one exception [], the HMTases belong to SET family that can be classified according to the sequences surrounding the SET domain [, ]. Structural studies on the human SET7/9, a mono-methylase, have revealed the molecular basis for the specificity of the enzyme for the histone-target and the roles of the invariant residues in the SET domain in determining the methylation specificities [].  The pre-SET domain, as found in the SUV39 SET family, contains nine invariant cysteine residues that are grouped into two segments separated by a region of variable length. These 9 cysteines coordinate 3 zinc ions to form a triangular cluster, where each of the zinc ions is coordinated by 4 four cysteines to give a tetrahedral configuration. The function of this domain is structural, holding together 2 long segments of random coils and stabilising the SET domain. The C-terminal region including the post-SET domain is disordered when not interacting with a histone tail and in the absence of zinc. The three conserved cysteines in the post-SET domain form a zinc-binding site [] when coupled to a fourth conserved cysteine in the knot-like structure close to the SET domain active site []. The structured post-SET region brings in the C-terminal residues that participate in S-adenosylmethine-binding and histone tail interactions. The three conserved cysteine residues are essential for HMTase activity, as replacement with serine abolishes HMTase activity []. ; GO: 0008270 zinc ion binding, 0018024 histone-lysine N-methyltransferase activity, 0034968 histone lysine methylation, 0005634 nucleus; PDB: 3K5K_A 2O8J_D 3RJW_B 1ML9_A 1PEG_B 1MVH_A 1MVX_A 3BO5_A 2RFI_B 3MO5_B ....
Probab=44.87  E-value=15  Score=24.76  Aligned_cols=33  Identities=21%  Similarity=0.341  Sum_probs=18.4

Q ss_pred             cCCCCCceeeecccccccccccCCCCCCCceecC
Q psy11187         30 ASRPSKYVKIKTNKPVGTVRLETDKSSTPVCECD   63 (115)
Q Consensus        30 ~~KPP~YkkIKsNkpVg~vr~~~D~sE~~~C~C~   63 (115)
                      ...||.|+-|..|++-..+. ..+......|.|.
T Consensus        20 ~~~p~~F~Yi~~~~~~~~~~-~~~~~~~~~C~C~   52 (103)
T PF05033_consen   20 EPPPPNFEYIPENIYGEGVP-DIDPEFLQGCDCS   52 (103)
T ss_dssp             --SSTSSEE-SS-EESTTSS--TBGGGTS----S
T ss_pred             CCCCCCeEEeeeEEcCCCcc-ccccccCccCccC
Confidence            34478999999999988765 4566677789993


No 7  
>smart00179 EGF_CA Calcium-binding EGF-like domain.
Probab=35.24  E-value=12  Score=20.17  Aligned_cols=24  Identities=29%  Similarity=0.627  Sum_probs=18.2

Q ss_pred             CCCCCCchhHHHhhhhhcCCcCccc
Q psy11187         66 SPCGVGSSCINSSIGQSAESCIAIS   90 (115)
Q Consensus        66 ~PCG~~S~CLNRmL~~EC~~C~a~~   90 (115)
                      +||..+..|+|..-.|.|. |+.+-
T Consensus         9 ~~C~~~~~C~~~~g~~~C~-C~~g~   32 (39)
T smart00179        9 NPCQNGGTCVNTVGSYRCE-CPPGY   32 (39)
T ss_pred             CCcCCCCEeECCCCCeEeE-CCCCC
Confidence            6888777899988888885 66553


No 8  
>cd08002 WGR_PARP3_like WGR domain of poly(ADP-ribose) polymerase 3 and similar proteins. The WGR domain is found in a variety of eukaryotic poly(ADP-ribose) polymerases (PARPs). It has been called WGR after the most conserved central motif of the domain. The domain typically occurs together with a catalytic PARP domain, and is between 70 and 80 residues in length. It has been proposed to function as a nucleic acid binding domain. PARPs catalyze the NAD(+)-dependent synthesis of ADP-ribose polymers and their addition to various nuclear proteins. Higher eukaryotes contain several PARPs and and there may be up to 17 human PARP-like proteins, with three of them (PARP-1, PARP-2, and PARP-3) containing a WGR domain. The synthesis of poly-ADP-ribose requires multiple enzymatic activities for initiation, trans-ADP-ribosylation, elongation, branching, and release of the polymer from the enzyme. This subfamily is composed of human PARP-3 and similar proteins, including Arabidopsis thaliana PARP-
Probab=31.03  E-value=79  Score=22.21  Aligned_cols=38  Identities=21%  Similarity=0.360  Sum_probs=26.2

Q ss_pred             HHHHHHHHHHHHHhhhhHHhHhhhcccCCCCCceeeec
Q psy11187          4 LREAAEAFREFQRNRDRIKTEETNERASRPSKYVKIKT   41 (115)
Q Consensus         4 LeEA~~~f~elK~~Re~~~~~e~~~~~~KPP~YkkIKs   41 (115)
                      |++|...|+.+-.++-..+=.+.......|+.|..|..
T Consensus        61 l~~A~~~F~k~F~~KTgn~W~~R~~f~k~~gky~~ie~   98 (100)
T cd08002          61 LEGAIKDFEKKFKDKTKNNWEDRENFVPHPGKYTLIEM   98 (100)
T ss_pred             HHHHHHHHHHHHHHHhCCchhhccCCCcCCCcceEEEe
Confidence            78999999888776644333333345678888988754


No 9  
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at  least  one  is  present  in  most EGF-like domains; a subset of these bind calcium.
Probab=29.79  E-value=16  Score=18.76  Aligned_cols=24  Identities=29%  Similarity=0.646  Sum_probs=17.1

Q ss_pred             CCCCCCCchhHHHhhhhhcCCcCcc
Q psy11187         65 SSPCGVGSSCINSSIGQSAESCIAI   89 (115)
Q Consensus        65 ~~PCG~~S~CLNRmL~~EC~~C~a~   89 (115)
                      .++|..+..|.|.--.+.|. |+.+
T Consensus         5 ~~~C~~~~~C~~~~~~~~C~-C~~g   28 (36)
T cd00053           5 SNPCSNGGTCVNTPGSYRCV-CPPG   28 (36)
T ss_pred             CCCCCCCCEEecCCCCeEeE-CCCC
Confidence            56888888888887677774 5544


No 10 
>PF10393 Matrilin_ccoil:  Trimeric coiled-coil oligomerisation domain of matrilin;  InterPro: IPR019466  This entry represents a short domain found the matrilin (cartilage matrix) proteins. It forms a coiled coil structure and contains a single cysteine residue at its start which is likely to form a di-sulphide bridge with a corresponding cysteine in an upstream EGF domain (IPR006209 from INTERPRO), thereby spanning the VWA domain of the protein (IPR002035 from INTERPRO).This domain is likely to be responsible for protein trimerisation []. ; PDB: 1AQ5_C.
Probab=29.02  E-value=23  Score=22.46  Aligned_cols=11  Identities=36%  Similarity=1.054  Sum_probs=4.9

Q ss_pred             cCCCCCCCCCc
Q psy11187         62 CDESSPCGVGS   72 (115)
Q Consensus        62 C~d~~PCG~~S   72 (115)
                      |.++|||++++
T Consensus         3 ~~~edpC~CEs   13 (47)
T PF10393_consen    3 CSDEDPCKCES   13 (47)
T ss_dssp             --SS-SS-TTH
T ss_pred             cCcCCCcccHH
Confidence            46789997543


No 11 
>PF01535 PPR:  PPR repeat;  InterPro: IPR002885 This entry represents the PPR repeat. Pentatricopeptide repeat (PPR) proteins are characterised by tandem repeats of a degenerate 35 amino acid motif []. Most of PPR proteins have roles in mitochondria or plastid []. PPR repeats were discovered while screening Arabidopsis proteins for those predicted to be targeted to mitochondria or chloroplast [, ]. Some of these proteins have been shown to play a role in post-transcriptional processes within organelles and they are thought to be sequence-specific RNA-binding proteins [, , ]. Plant genomes have between one hundred to five hundred PPR genes per genome whereas non-plant genomes encode two to six PPR proteins. Although no PPR structures are yet known, the motif is predicted to fold into a helix-turn-helix structure similar to those found in the tetratricopeptide repeat (TPR) family (see PDOC50005 from PROSITEDOC) [].  The plant PPR protein family has been divided in two subfamilies on the basis of their motif content and organisation [, ]. Examples of PPR repeat-containing proteins include PET309 P32522 from SWISSPROT, which may be involved in RNA stabilisation [], and crp1, which is involved in RNA processing []. The repeat is associated with a predicted plant protein O49549 from SWISSPROT that has a domain organisation similar to the human BRCA1 protein.
Probab=22.12  E-value=92  Score=15.47  Aligned_cols=15  Identities=33%  Similarity=0.561  Sum_probs=11.4

Q ss_pred             hHHHHHHHHHHHHHh
Q psy11187          3 SLREAAEAFREFQRN   17 (115)
Q Consensus         3 ALeEA~~~f~elK~~   17 (115)
                      -+++|.+.|++++..
T Consensus        15 ~~~~a~~~~~~M~~~   29 (31)
T PF01535_consen   15 QFEEALEVFDEMRER   29 (31)
T ss_pred             hHHHHHHHHHHHhHC
Confidence            367888999888753


No 12 
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif). This family has a similar consensus to the TPR domain (tetratricopeptide), pfam pfam00515, a 33-residue repeat. It is predicted to form a pair of antiparallel helices similar to that of TPR.
Probab=21.69  E-value=1.1e+02  Score=15.29  Aligned_cols=14  Identities=36%  Similarity=0.558  Sum_probs=10.9

Q ss_pred             HHHHHHHHHHHHHh
Q psy11187          4 LREAAEAFREFQRN   17 (115)
Q Consensus         4 LeEA~~~f~elK~~   17 (115)
                      +++|.+.|.+++.+
T Consensus        16 ~~~a~~~~~~M~~~   29 (35)
T TIGR00756        16 VEEALELFKEMLER   29 (35)
T ss_pred             HHHHHHHHHHHHHc
Confidence            57888889888654


No 13 
>PRK00736 hypothetical protein; Provisional
Probab=21.22  E-value=1.3e+02  Score=19.83  Aligned_cols=8  Identities=13%  Similarity=0.671  Sum_probs=5.9

Q ss_pred             ccCCCCCc
Q psy11187         29 RASRPSKY   36 (115)
Q Consensus        29 ~~~KPP~Y   36 (115)
                      -..+||+|
T Consensus        61 ~~~~PPHY   68 (68)
T PRK00736         61 PVTKPPHW   68 (68)
T ss_pred             CCCCcCCC
Confidence            46678888


No 14 
>TIGR02573 LcrG_PcrG type III secretion protein LcrG. This protein is found in type III secretion operons, along with LcrR, H and V. Also known as PcrG in Pseudomonas, the protein is believed to make a 1:1 complex with PcrV (LcrV). Mutants of LcrG cause premature secretion of effector proteins into the medium.
Probab=21.21  E-value=66  Score=23.21  Aligned_cols=29  Identities=31%  Similarity=0.487  Sum_probs=20.4

Q ss_pred             HHHHHHHHhhhhHHhH-hhhcccCCCCCce
Q psy11187          9 EAFREFQRNRDRIKTE-ETNERASRPSKYV   37 (115)
Q Consensus         9 ~~f~elK~~Re~~~~~-e~~~~~~KPP~Yk   37 (115)
                      +.+.|++.+|+.+-.+ .+.+..++|++-.
T Consensus        57 ELL~EiqRrr~~qp~~~~~GkR~RRPtmMR   86 (90)
T TIGR02573        57 ELLEEVQRRRSQQPQQGEQGKRPRRPTMMR   86 (90)
T ss_pred             HHHHHHHHHHHcCCCCCcCCCCCCCCcccc
Confidence            5677788888776665 5567777887753


No 15 
>PF14044 NETI:  NETI protein
Probab=20.49  E-value=43  Score=22.29  Aligned_cols=9  Identities=22%  Similarity=0.442  Sum_probs=7.1

Q ss_pred             chhHHHhhh
Q psy11187         72 SSCINSSIG   80 (115)
Q Consensus        72 S~CLNRmL~   80 (115)
                      ++||.||-.
T Consensus        11 ~~CL~RM~~   19 (57)
T PF14044_consen   11 SDCLARMKK   19 (57)
T ss_pred             HHHHHHHHH
Confidence            689999853


No 16 
>PF04102 SlyX:  SlyX;  InterPro: IPR007236 The SlyX protein has no known function. It is short, less than 80 amino acids, and its gene is found close to the slyD gene. The SlyX protein has a conserved PPH(Y/W) motif at its C terminus. The protein may be a coiled-coil structure.; PDB: 3EFG_A.
Probab=20.20  E-value=66  Score=21.02  Aligned_cols=9  Identities=22%  Similarity=0.578  Sum_probs=0.0

Q ss_pred             cccCCCCCc
Q psy11187         28 ERASRPSKY   36 (115)
Q Consensus        28 ~~~~KPP~Y   36 (115)
                      ....+||+|
T Consensus        61 ~~~~~PPHY   69 (69)
T PF04102_consen   61 PEEEPPPHY   69 (69)
T ss_dssp             ---------
T ss_pred             CCCCCcCCC
Confidence            456788888


Done!