Diaphorina citri psyllid: psy11187


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-----
MTSLREAAEAFREFQRNRDRIKTEETNERASRPSKYVKIKTNKPVGTVRLETDKSSTPVCECDESSPCGVGSSCINSSIGQSAESCIAISSIIINNSPSVSSTSNNSSDEITIKR
ccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccHHcEEcccccccccccccccccEEECc
*TSLREAAEAFRE***********************VKIKTNKPVGTVRLETDKSSTPVCECDESSPCGVGSSCINSSIGQSAESCIAISSIII*********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSxxxxxxxxxxxxxxxxxxxxxETNERASRPSKYVKIKTNKPVGTVRLETDKSSTPVCECDESSPCGVGSSCINSSIGQSAESCIAISSIIINNSPSVSSTSNNSSDEITIKR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0018024 [MF]histone-lysine N-methyltransferase activityprobableGO:0042054, GO:0003824, GO:0008757, GO:0016740, GO:0016278, GO:0016279, GO:0016741, GO:0008170, GO:0008276, GO:0003674, GO:0008168
GO:0005488 [MF]bindingprobableGO:0003674
GO:0016571 [BP]histone methylationprobableGO:0006479, GO:0008213, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0016043, GO:0071704, GO:0016570, GO:0032259, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0043414, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0019538, GO:0044763, GO:0044237, GO:0043170, GO:0008150, GO:0016568, GO:0016569

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3OOI, chain A
Confidence level:very confident
Coverage over the Query: 18-90
View the alignment between query and template
View the model in PyMOL