Diaphorina citri psyllid: psy11205

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-----

MLKDDQSLLAQFFYADEALTFVAAELDSFDGREDPERCTALVNHLRQCQDNVLNICNKIMDVWIPDDRANRDFRVKFPDDVMQDNLAGQLWFGAECLAAGSSIMNREAESAAMRPLAKALTKSLENVRNLLREYSLRSTHPSDIFFTDDLYIDRIFESLKVFDRLLAEFELGYVTAMVPVKTAKEYEMQQLVMVLFSETLQRALRVGLLSQEMIEAYEPSLMFTIPRLAIVTGLLVYPSGPLSLDKEPSEMSEMFRPFRTLLGKIREVLWRLNEDEIARLERLLCSVDEPTPPPVPAVNTTPDEETSTPLRLPRK

cccccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHcccccHHHHHHHHHccccHHcHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHccEEEccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHcccccHHHccHHHHHHcccccccccccccccccHHHHHcHHHHHHHHHHHHHHHHccHHHHHHHHHHHccccccccccccccccccccccccccccccc

*****QSLLAQFFYADEALTFVAAELDSFDGREDPERCTALVNHLRQCQDNVLNICNKIMDVWIPDDRANRDFRVKFPDDVMQDNLAGQLWFGAECLAAGSSIMNREAE*AAMRPLAKALTKSLENVRNLLREYSLRSTHPSDIFFTDDLYIDRIFESLKVFDRLLAEFELGYVTAMVPVKTAKEYEMQQLVMVLFSETLQRALRVGLLSQEMIEAYEPSLMFTIPRLAIVTGLLVYPSGPLSLDKEPSEMSEMFRPFRTLLGKIREVLWRLNEDEIARLERLLCSV****************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MLKDDQSLLAQFFYADEALTFVAAELDSFDGREDPERCTALVNHLRQCQDNVLNICNKIMDVWIPDDRANRDFRVKFPDDVMQDNLAGQLWFGAECLAAGSSIMNREAESAAMRPLxxxxxxxxxxxxxxxxxxxxxSTHPSDIFFTDDLYIDRIFESLKVFDRLLAEFELGYVTAMVPVKTAKEYEMQQLVMVLFSETLQRALRVGLLSQEMIEAYEPSLMFTIPRLAIVTGLLVYPSGPLSLDKEPSEMSEMFRPFRTLLGKIREVLWRLNEDEIARLERLLCSVDEPTPPPVPAVNTTPDEETSTPLRLPRK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Lateral signaling target protein 2 homolog	Negative regulator of epidermal growth factor receptor (EGFR) signaling. Acts by promoting EGFR degradation in endosomes when not monoubiquitinated.	confident	Q6ZPK7
Lateral signaling target protein 2 homolog	Negative regulator of epidermal growth factor receptor (EGFR) signaling. Acts by promoting EGFR degradation in endosomes when not monoubiquitinated.	confident	Q0P4S0
Lateral signaling target protein 2	Negative regulator of epidermal growth factor receptor (EGFR) signaling.	confident	Q9TZD0

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0031901 [CC]	early endosome membrane	probable	GO:0005737, GO:0005575, GO:0043226, GO:0031090, GO:0043227, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0044444, GO:0044440, GO:0044424, GO:0005622, GO:0005768, GO:0005769, GO:0044422, GO:0010008
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0032266 [MF]	phosphatidylinositol-3-phosphate binding	probable	GO:0043168, GO:0035091, GO:0005543, GO:0008289, GO:0043167, GO:0003674, GO:0005488, GO:1901981
GO:0042059 [BP]	negative regulation of epidermal growth factor receptor signaling pathway	probable	GO:0010646, GO:0009968, GO:0050794, GO:0009966, GO:0048585, GO:0048583, GO:0042058, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0023051, GO:0048519, GO:1901184, GO:1901185, GO:0050789, GO:0048523

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!