BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy1121
         (122 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3EB0|A Chain A, Crystal Structure Of Cgd4_240 From Cryptosporidium Parvum
           In Complex With Indirubin E804
 pdb|3EB0|C Chain C, Crystal Structure Of Cgd4_240 From Cryptosporidium Parvum
           In Complex With Indirubin E804
          Length = 383

 Score = 25.4 bits (54), Expect = 7.5,   Method: Composition-based stats.
 Identities = 17/45 (37%), Positives = 19/45 (42%), Gaps = 3/45 (6%)

Query: 3   TGDEYEVGDSGQPDDGNCHAGRRPRCRRKKVHHSTVVNPDSNLYF 47
           TGDE E      PDD N   G+         H S +VNP  N Y 
Sbjct: 72  TGDE-EPKPPQPPDDHNKLGGKNNGVNNH--HKSVIVNPSQNKYL 113


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.324    0.142    0.474 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,468,068
Number of Sequences: 62578
Number of extensions: 178606
Number of successful extensions: 280
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 280
Number of HSP's gapped (non-prelim): 3
length of query: 122
length of database: 14,973,337
effective HSP length: 84
effective length of query: 38
effective length of database: 9,716,785
effective search space: 369237830
effective search space used: 369237830
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 45 (21.9 bits)