Diaphorina citri psyllid: psy11211


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310------
MQSLTTSSQTGRGMGEVFRGMVAQEGVLRPLRGVNAVILGAAPAHALYFSCYEYLKDTFTNRTLINNNVGYGLAGGMATMLHDGIMTPADVVKQRLQMYNSPYRSMLETIRTVYRTEGLVAFYRSYTTQLAMNVPFQSIHFITYEVIYYTIRTVYRTEGLVAFYRSYTTQLAMNVPFQSIHFITYEVIYYTIRTVYRTEGLVAFYRSYTTQLAMNVPFQSIHFITYEVIYYTIRTVYRTEGLVAFYRSYTTQLAMNVPFQSIHFITYEVMQTITNPSRSYNPIAHMMSGAISGGVAAAITTPLDVCKTFLNTQQSK
cccccccccccccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccccccHHHHHHHHHHHcccccccccHHHHHHccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHcccc
****************VFRGMVAQEGVLRPLRGVNAVILGAAPAHALYFSCYEYLKDTFTNRTLINNNVGYGLAGGMATMLHDGIMTPADVVKQRLQMYNSPYRSMLETIRTVYRTEGLVAFYRSYTTQLAMNVPFQSIHFITYEVIYYTIRTVYRTEGLVAFYRSYTTQLAMNVPFQSIHFITYEVIYYTIRTVYRTEGLVAFYRSYTTQLAMNVPFQSIHFITYEVIYYTIRTVYRTEGLVAFYRSYTTQLAMNVPFQSIHFITYEVMQTITNPSRSYNPIAHMMSGAISGGVAAAITTPLDVCKTFLNT****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQSLTTSSQTGRGMGEVFRGMVAQEGVLRPLRGVNAVILGAAPAHALYFSCYEYLKDTFTNRTLINNNVGYGLAGGMATMLHDGIMTPADVVKQRLQMYNSPYRSMLETIRTVYRTEGLVAFYRSYTTQLAMNVPFQSIHFITYEVIYYTIRTVYRTEGLVAFYRSYTTQLAMNVPFQSIHFITYEVIYYTIRTVYRTEGLVAFYRSYTTQLAMNVPFQSIHFITYEVIYYTIRTVYRTEGLVAFYRSYTTQLAMNVPFQSIHFITYEVMQTITNPSRSYNPIAHMMSGAISGGVAAAITTPLDVCKTFLNTQQSK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mitoferrin Mitochondrial iron transporter that mediates iron uptake. Probably required for heme synthesis of hemoproteins and Fe-S cluster assembly.confidentQ23125
Mitoferrin-1 Mitochondrial iron transporter that specifically mediates iron uptake in developing erythroid cells, thereby playing an essential role in heme biosynthesis. The iron delivered into the mitochondria, presumably as Fe(2+), is then probably delivered to ferrochelatase to catalyze Fe(2+) incorporation into protoprophyrin IX to make heme.confidentQ287T7
Mitoferrin-1 Mitochondrial iron transporter that specifically mediates iron uptake in developing erythroid cells, thereby playing an essential role in heme biosynthesis. The iron delivered into the mitochondria, presumably as Fe(2+), is then probably delivered to ferrochelatase to catalyze Fe(2+) incorporation into protoprophyrin IX to make heme.confidentQ66H23

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0015075 [MF]ion transmembrane transporter activityprobableGO:0022891, GO:0005215, GO:0022857, GO:0022892, GO:0003674
GO:0071702 [BP]organic substance transportprobableGO:0006810, GO:0008150, GO:0051179, GO:0051234
GO:0010035 [BP]response to inorganic substanceprobableGO:0042221, GO:0050896, GO:0008150
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0071705 [BP]nitrogen compound transportprobableGO:0006810, GO:0008150, GO:0051179, GO:0051234
GO:0048250 [BP]mitochondrial iron ion transportprobableGO:0006810, GO:0046907, GO:0006812, GO:0006811, GO:0000041, GO:0044763, GO:0008150, GO:0044765, GO:0030001, GO:0051649, GO:0006839, GO:0006826, GO:0009987, GO:0051234, GO:0051179, GO:0044699, GO:0051641

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LCK, chain A
Confidence level:very confident
Coverage over the Query: 9-184,197-200,223-276
View the alignment between query and template
View the model in PyMOL
Template: 2LCK, chain A
Confidence level:very confident
Coverage over the Query: 70-184,197-202,221-315
View the alignment between query and template
View the model in PyMOL