Query         psy11234
Match_columns 98
No_of_seqs    101 out of 179
Neff          4.0 
Searched_HMMs 46136
Date          Fri Aug 16 21:36:11 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy11234.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/11234hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF08409 DUF1736:  Domain of un 100.0 1.1E-30 2.4E-35  175.0   6.1   60    2-61     20-79  (80)
  2 PF05545 FixQ:  Cbb3-type cytoc  34.3      74  0.0016   18.7   3.3   25   45-69      9-33  (49)
  3 PF08172 CASP_C:  CASP C termin  30.8      47   0.001   26.2   2.5   24    1-24    213-236 (248)
  4 PF05915 DUF872:  Eukaryotic pr  26.8 1.2E+02  0.0025   21.4   3.7   16   75-90     77-92  (115)
  5 PF13493 DUF4118:  Domain of un  24.0 1.2E+02  0.0026   19.3   3.2   22   41-62     74-95  (105)
  6 PF08219 TOM13:  Outer membrane  22.3      29 0.00063   23.5   0.0   12   79-90     38-49  (77)
  7 PLN02755 complex I subunit      18.7      69  0.0015   21.4   1.2   24   44-67     29-53  (71)
  8 PF02632 BioY:  BioY family;  I  16.6   1E+02  0.0022   22.3   1.8   18   74-91    116-133 (148)
  9 PRK03427 cell division protein  13.4 2.4E+02  0.0052   23.6   3.4   27   44-70      3-29  (333)
 10 KOG4753|consensus               13.1 3.1E+02  0.0067   20.1   3.5   41   48-88     52-98  (124)

No 1  
>PF08409 DUF1736:  Domain of unknown function (DUF1736);  InterPro: IPR013618 This domain of unknown function is found in various hypothetical metazoan proteins. 
Probab=99.96  E-value=1.1e-30  Score=174.99  Aligned_cols=60  Identities=45%  Similarity=0.781  Sum_probs=57.4

Q ss_pred             CCchhhHHhhhhHHHHHHHHHHhCcccccccCCCCccccCcchhHHHHHHHHHHHHHHHH
Q psy11234          2 GLGTCRLLTFCYLAVFNVWLLLCPAHLSHDWQFGSIPLVTSLGDVRNFATCLLFVSCFCV   61 (98)
Q Consensus         2 ~s~~tR~LT~~YL~~~n~wLLl~P~~Lc~DWSMg~IPlI~S~~D~Rnl~t~~fy~~l~~l   61 (98)
                      .++++|.+||+||+++|+|||++|.+|||||||||||+|||++|+||++|+++|++++++
T Consensus        20 ~~~~tR~LT~~yl~~~n~~LLl~P~~L~~DWSm~~IPli~s~~D~Rn~~tl~~~~~l~~l   79 (80)
T PF08409_consen   20 PSLLTRWLTYNYLPAFNLWLLLFPSWLCFDWSMGCIPLIESLWDPRNLATLLFYSALAAL   79 (80)
T ss_pred             CcHHHHHHHHHHHHHHHHHHHHCccccCCcCCCCcccccCccccHHHHHHHHHHHHHHHH
Confidence            468999999999999999999999999999999999999999999999999999988764


No 2  
>PF05545 FixQ:  Cbb3-type cytochrome oxidase component FixQ;  InterPro: IPR008621 This family consists of several Cbb3-type cytochrome oxidase components (FixQ/CcoQ). FixQ is found in nitrogen fixing bacteria. Since nitrogen fixation is an energy-consuming process, effective symbioses depend on operation of a respiratory chain with a high affinity for O2, closely coupled to ATP production. This requirement is fulfilled by a special three-subunit terminal oxidase (cytochrome terminal oxidase cbb3), which was first identified in Bradyrhizobium japonicum as the product of the fixNOQP operon [].
Probab=34.31  E-value=74  Score=18.65  Aligned_cols=25  Identities=24%  Similarity=0.165  Sum_probs=17.8

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHhcc
Q psy11234         45 DVRNFATCLLFVSCFCVAYKAVCDL   69 (98)
Q Consensus        45 D~Rnl~t~~fy~~l~~l~~~~~~~~   69 (98)
                      ..|-+.++++.++.+++++.+.+..
T Consensus         9 ~~~~~~~v~~~~~F~gi~~w~~~~~   33 (49)
T PF05545_consen    9 FARSIGTVLFFVFFIGIVIWAYRPR   33 (49)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHccc
Confidence            4566778888888777777777544


No 3  
>PF08172 CASP_C:  CASP C terminal;  InterPro: IPR012955 This domain is the C-terminal region of the CASP family of proteins. These are Golgi membrane proteins which are thought to have a role in vesicle transport [].; GO: 0006891 intra-Golgi vesicle-mediated transport, 0030173 integral to Golgi membrane
Probab=30.82  E-value=47  Score=26.21  Aligned_cols=24  Identities=21%  Similarity=0.398  Sum_probs=21.0

Q ss_pred             CCCchhhHHhhhhHHHHHHHHHHh
Q psy11234          1 MGLGTCRLLTFCYLAVFNVWLLLC   24 (98)
Q Consensus         1 ~~s~~tR~LT~~YL~~~n~wLLl~   24 (98)
                      ++++.+|.+-+.|...+|++.++.
T Consensus       213 L~nr~~R~~f~~Y~l~LH~lvf~~  236 (248)
T PF08172_consen  213 LSNRTTRMLFFFYCLGLHLLVFFV  236 (248)
T ss_pred             hcChhhHHHHHHHHHHHHHHHHHH
Confidence            478899999999999999988664


No 4  
>PF05915 DUF872:  Eukaryotic protein of unknown function (DUF872);  InterPro: IPR008590 This entry represents several uncharacterised eukaryotic transmembrane proteins. The function of this currently unknown.
Probab=26.77  E-value=1.2e+02  Score=21.43  Aligned_cols=16  Identities=25%  Similarity=0.306  Sum_probs=10.6

Q ss_pred             hhhhhhhhccccccch
Q psy11234         75 LTSLHALAFCSIRGIL   90 (98)
Q Consensus        75 ~~~l~~lv~PFip~~~   90 (98)
                      .-=+.+.++.||||.-
T Consensus        77 ~~llilG~L~fIPG~Y   92 (115)
T PF05915_consen   77 WALLILGILCFIPGFY   92 (115)
T ss_pred             chHHHHHHHHHhccHH
Confidence            3345556788999963


No 5  
>PF13493 DUF4118:  Domain of unknown function (DUF4118); PDB: 2KSF_A.
Probab=23.95  E-value=1.2e+02  Score=19.35  Aligned_cols=22  Identities=18%  Similarity=0.202  Sum_probs=15.9

Q ss_pred             CcchhHHHHHHHHHHHHHHHHH
Q psy11234         41 TSLGDVRNFATCLLFVSCFCVA   62 (98)
Q Consensus        41 ~S~~D~Rnl~t~~fy~~l~~l~   62 (98)
                      -.+.|++++.+.+.|.+.+.++
T Consensus        74 ~~~~~~~~~~~~~~~l~va~v~   95 (105)
T PF13493_consen   74 FLVYDPQDWITFAVFLVVALVT   95 (105)
T ss_dssp             T-SS-HHHHHHHHHHHHHHHHH
T ss_pred             hhhcChhHHHHHHHHHHHHHHH
Confidence            4678999999999998776543


No 6  
>PF08219 TOM13:  Outer membrane protein TOM13;  InterPro: IPR013262 The TOM13 family of proteins are mitochondrial outer membrane proteins that mediate the assembly of beta-barrel proteins [].; GO: 0005741 mitochondrial outer membrane
Probab=22.33  E-value=29  Score=23.53  Aligned_cols=12  Identities=25%  Similarity=0.387  Sum_probs=9.8

Q ss_pred             hhhhccccccch
Q psy11234         79 HALAFCSIRGIL   90 (98)
Q Consensus        79 ~~lv~PFip~~~   90 (98)
                      ..|++|||+|..
T Consensus        38 INL~LPFiNG~M   49 (77)
T PF08219_consen   38 INLVLPFINGMM   49 (77)
T ss_pred             hhhhhhhhhhhh
Confidence            468999999964


No 7  
>PLN02755 complex I subunit
Probab=18.68  E-value=69  Score=21.42  Aligned_cols=24  Identities=25%  Similarity=0.324  Sum_probs=18.1

Q ss_pred             hhHHHHHHHHHHHHHH-HHHHHHHh
Q psy11234         44 GDVRNFATCLLFVSCF-CVAYKAVC   67 (98)
Q Consensus        44 ~D~Rnl~t~~fy~~l~-~l~~~~~~   67 (98)
                      |-+||+.....|.+++ +++++++.
T Consensus        29 WT~Rt~~i~~ifgv~VP~liy~giv   53 (71)
T PLN02755         29 WTRRNLAVVGIFGIAVPILVYKGIV   53 (71)
T ss_pred             cccchhhhhhhhhhhhhHHhhhhhh
Confidence            3489999999998777 56666654


No 8  
>PF02632 BioY:  BioY family;  InterPro: IPR003784 BioMNY proteins are considered to constitute tripartite biotin transporters in prokaryotes. One-third of the widespread bioY genes are linked to bioMN. Many bioY genes are located at loci encoding biotin biosynthesis, while others are unlinked to biotin metabolic or transport genes. BioY is a high-capacity transporter that is converted to a high-affinity system in the presence of BioMN. BioMNY-mediated biotin uptake is severely impaired by the replacement of the Walker A lysine residue in BioM, demonstrating the dependency of high-affinity transport on a functional ATPase [].
Probab=16.61  E-value=1e+02  Score=22.27  Aligned_cols=18  Identities=22%  Similarity=0.076  Sum_probs=13.7

Q ss_pred             ehhhhhhhhccccccchh
Q psy11234         74 VLTSLHALAFCSIRGILN   91 (98)
Q Consensus        74 v~~~l~~lv~PFip~~~~   91 (98)
                      ...++..-++||+|||.-
T Consensus       116 ~~~al~~g~~pFip~Di~  133 (148)
T PF02632_consen  116 LSKALAAGVLPFIPGDIL  133 (148)
T ss_pred             HHHHHHHHhHHHHHHHHH
Confidence            334777788899999973


No 9  
>PRK03427 cell division protein ZipA; Provisional
Probab=13.43  E-value=2.4e+02  Score=23.65  Aligned_cols=27  Identities=7%  Similarity=0.039  Sum_probs=20.2

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHHhccC
Q psy11234         44 GDVRNFATCLLFVSCFCVAYKAVCDLE   70 (98)
Q Consensus        44 ~D~Rnl~t~~fy~~l~~l~~~~~~~~~   70 (98)
                      -|-|.++.++=-+++++++.+++...+
T Consensus         3 qdLrLiLivvGAIAIiAlL~HGlWtsR   29 (333)
T PRK03427          3 QDLRLILIIVGAIAIIALLVHGFWTSR   29 (333)
T ss_pred             hhhhhHHHHHHHHHHHHHHHHhhhhcc
Confidence            488988888777777788777776433


No 10 
>KOG4753|consensus
Probab=13.06  E-value=3.1e+02  Score=20.12  Aligned_cols=41  Identities=12%  Similarity=0.004  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHh------ccCcceehhhhhhhhcccccc
Q psy11234         48 NFATCLLFVSCFCVAYKAVC------DLETFSVLTSLHALAFCSIRG   88 (98)
Q Consensus        48 nl~t~~fy~~l~~l~~~~~~------~~~~~~v~~~l~~lv~PFip~   88 (98)
                      |++++++...+..+..-.+-      ..+..+-+.=+...++.||||
T Consensus        52 ~lavvL~~fg~Lli~lg~fl~~~~~~ag~~~~gv~f~V~G~L~FiPG   98 (124)
T KOG4753|consen   52 ALAVVLLVFGLLLIGLGFFLAGGRVEAGDRSQGVFFFVLGILLFIPG   98 (124)
T ss_pred             HHHHHHHHHHHHHHHHHHHheecceeeCCCcceEEEehhhhHhcccc


Done!