BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy11246
(101 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1S35|A Chain A, Crystal Structure Of Repeats 8 And 9 Of Human Erythroid
Spectrin
Length = 214
Score = 26.9 bits (58), Expect = 3.2, Method: Compositional matrix adjust.
Identities = 13/49 (26%), Positives = 29/49 (59%), Gaps = 1/49 (2%)
Query: 6 LQAEIESHKDVYSSLNTSGKRLLGSLTSQDDAVMLQRRLDEMNQRWHHL 54
++ EI+ H+D Y + SG++++ T + ++L +RL+ ++ W L
Sbjct: 45 IKDEIDGHQDSYQRVKESGEKVIQGQTDP-EYLLLGQRLEGLDTGWDAL 92
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.318 0.131 0.370
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,588,126
Number of Sequences: 62578
Number of extensions: 74931
Number of successful extensions: 169
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 166
Number of HSP's gapped (non-prelim): 9
length of query: 101
length of database: 14,973,337
effective HSP length: 67
effective length of query: 34
effective length of database: 10,780,611
effective search space: 366540774
effective search space used: 366540774
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 45 (21.9 bits)