BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy11248
         (227 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3THT|A Chain A, Crystal Structure And Rna Binding Properties Of The
           RrmALKB DOMAINS In Human Abh8, An Enzyme Catalyzing Trna
           Hypermodification, Northeast Structural Genomics
           Consortium Target Hr5601b
 pdb|3THT|B Chain B, Crystal Structure And Rna Binding Properties Of The
           RrmALKB DOMAINS In Human Abh8, An Enzyme Catalyzing Trna
           Hypermodification, Northeast Structural Genomics
           Consortium Target Hr5601b
 pdb|3THT|C Chain C, Crystal Structure And Rna Binding Properties Of The
           RrmALKB DOMAINS In Human Abh8, An Enzyme Catalyzing Trna
           Hypermodification, Northeast Structural Genomics
           Consortium Target Hr5601b
 pdb|3THT|D Chain D, Crystal Structure And Rna Binding Properties Of The
           RrmALKB DOMAINS In Human Abh8, An Enzyme Catalyzing Trna
           Hypermodification, Northeast Structural Genomics
           Consortium Target Hr5601b
          Length = 345

 Score = 35.8 bits (81), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 24/41 (58%)

Query: 51  NSAVINDYQPGGCIVSHIDPPHIFDRPIISLSLFSDSALCF 91
           +   IN Y+PG  I +HID    F+  I+SLSL S+  + F
Sbjct: 198 DQMTINQYEPGQGIPAHIDTHSAFEDEIVSLSLGSEIVMDF 238


>pdb|3THP|A Chain A, Crystal Structure And Rna Binding Properties Of The
           RrmALKB DOMAINS In Human Abh8, An Enzyme Catalyzing Trna
           Hypermodification, Northeast Structural Genomics
           Consortium Target Hr5601b
          Length = 345

 Score = 34.3 bits (77), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 23/41 (56%)

Query: 51  NSAVINDYQPGGCIVSHIDPPHIFDRPIISLSLFSDSALCF 91
           +   IN Y+PG  I +HID    F+  I+SLSL S+    F
Sbjct: 198 DQXTINQYEPGQGIPAHIDTHSAFEDEIVSLSLGSEIVXDF 238


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.321    0.140    0.430 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,677,084
Number of Sequences: 62578
Number of extensions: 248024
Number of successful extensions: 369
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 367
Number of HSP's gapped (non-prelim): 2
length of query: 227
length of database: 14,973,337
effective HSP length: 95
effective length of query: 132
effective length of database: 9,028,427
effective search space: 1191752364
effective search space used: 1191752364
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)