Query         psy11263
Match_columns 80
No_of_seqs    100 out of 149
Neff          3.7 
Searched_HMMs 46136
Date          Fri Aug 16 22:24:45 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy11263.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/11263hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF03153 TFIIA:  Transcription  100.0 8.7E-39 1.9E-43  242.9   7.2   62   19-80    308-375 (375)
  2 KOG2652|consensus              100.0 3.4E-35 7.4E-40  230.7   6.5   67   14-80    276-348 (348)
  3 COG5149 TOA1 Transcription ini  99.9 3.3E-28 7.1E-33  186.8   6.8   67   14-80    220-292 (293)
  4 PF09211 DUF1958:  Domain of un  86.0    0.82 1.8E-05   29.1   2.5   29   42-70     23-52  (65)
  5 COG5013 NarG Nitrate reductase  85.9    0.52 1.1E-05   43.0   2.1   27   41-67     41-75  (1227)
  6 PF03153 TFIIA:  Transcription   72.6     1.2 2.5E-05   34.4   0.0   14    3-16    269-282 (375)
  7 PF04584 Pox_A28:  Poxvirus A28  68.8     2.4 5.3E-05   30.6   0.9   18   44-61     63-80  (140)
  8 PRK09719 hypothetical protein;  63.4     1.9 4.2E-05   28.7  -0.4   12   39-50     57-68  (89)
  9 smart00456 WW Domain with 2 co  57.9     8.2 0.00018   19.6   1.5   16   65-80     12-27  (32)
 10 cd06477 ACD_HspB3_Like Alpha c  49.9      10 0.00022   24.2   1.3   32   37-68     46-83  (83)
 11 PF01473 CW_binding_1:  Putativ  49.8      24 0.00051   16.5   2.3   17   60-77      2-18  (19)
 12 PF12139 APS-reductase_C:  Aden  49.0      17 0.00036   24.3   2.2   17   52-72     24-40  (83)
 13 COG4847 Uncharacterized protei  48.9      15 0.00033   25.4   2.1   27   51-79      5-31  (103)
 14 PF00397 WW:  WW domain;  Inter  48.5      14  0.0003   19.3   1.5   16   65-80     13-28  (31)
 15 PF14480 DNA_pol3_a_NI:  DNA po  48.0      16 0.00035   21.8   1.9   13   46-58     31-43  (76)
 16 cd00201 WW Two conserved trypt  47.0      16 0.00035   18.1   1.5   16   65-80     11-26  (31)
 17 KOG2345|consensus               43.7      22 0.00047   28.6   2.5   19   59-77     13-31  (302)
 18 PF09038 53-BP1_Tudor:  Tumour   42.0      26 0.00057   24.7   2.5   25   47-71     27-52  (122)
 19 COG4079 Uncharacterized protei  40.1      18 0.00039   28.9   1.5   20   50-69    263-282 (293)
 20 PTZ00486 apyrase Superfamily;   39.1      37 0.00081   27.7   3.2   31   38-68     59-91  (352)
 21 PF13691 Lactamase_B_4:  tRNase  38.3      27 0.00058   21.6   1.8   13   61-73     16-28  (63)
 22 PF01491 Frataxin_Cyay:  Fratax  35.8      39 0.00084   22.4   2.4   22   53-74     32-56  (109)
 23 PF10382 DUF2439:  Protein of u  35.8      62  0.0014   20.5   3.3   30   40-73      5-38  (83)
 24 KOG0284|consensus               35.4      32  0.0007   29.1   2.4   44   36-79     77-121 (464)
 25 TIGR03421 FeS_CyaY iron donor   34.3      43 0.00094   22.2   2.5   20   55-74     29-51  (102)
 26 PF14267 DUF4357:  Domain of un  33.9      25 0.00054   21.2   1.2   17   57-73      5-21  (55)
 27 cd06497 ACD_alphaA-crystallin_  33.6      33 0.00072   21.6   1.8   16   50-65     67-83  (86)
 28 cd06471 ACD_LpsHSP_like Group   33.2      34 0.00073   21.1   1.7   13   52-64     77-89  (93)
 29 PRK01379 cyaY frataxin-like pr  32.9      46 0.00099   22.4   2.4   15   58-73     35-52  (103)
 30 KOG3259|consensus               32.8      17 0.00037   26.9   0.3   16   65-80     19-34  (163)
 31 CHL00114 psbX photosystem II p  32.8      27 0.00058   20.4   1.1   12   38-49     28-39  (39)
 32 PF10974 DUF2804:  Protein of u  32.1      81  0.0018   24.3   4.0   43   34-80    147-197 (333)
 33 PF14249 Tocopherol_cycl:  Toco  31.4      46 0.00099   26.7   2.6   21   59-79    169-189 (336)
 34 PF06079 Apyrase:  Apyrase;  In  30.6      36 0.00078   27.0   1.9   21   49-69     10-30  (291)
 35 PRK00446 cyaY frataxin-like pr  30.4      55  0.0012   21.9   2.5   21   55-75     31-54  (105)
 36 PF09943 DUF2175:  Uncharacteri  29.6      54  0.0012   22.4   2.4   25   52-78      2-26  (101)
 37 TIGR03422 mito_frataxin fratax  28.5      42 0.00092   22.2   1.7   21   54-74     30-53  (97)
 38 PHA02095 hypothetical protein   28.1      59  0.0013   21.6   2.3   19   49-67     31-49  (84)
 39 PF14864 Alkyl_sulf_C:  Alkyl s  28.0      48  0.0011   21.8   1.9   19   46-64     40-58  (125)
 40 PF11008 DUF2846:  Protein of u  27.4      78  0.0017   20.6   2.8   39   36-80     24-62  (117)
 41 cd06479 ACD_HspB7_like Alpha c  27.0      50  0.0011   20.8   1.8   14   52-65     64-78  (81)
 42 PF07873 YabP:  YabP family;  I  26.6      77  0.0017   19.1   2.5   28   49-76     24-51  (66)
 43 PF06097 DUF945:  Bacterial pro  26.5      55  0.0012   25.2   2.2   17   54-70    440-456 (460)
 44 PF13738 Pyr_redox_3:  Pyridine  26.3 1.1E+02  0.0024   20.3   3.4   20   41-60    103-122 (203)
 45 PF00011 HSP20:  Hsp20/alpha cr  25.7      57  0.0012   20.0   1.8   24   42-65     56-84  (102)
 46 smart00400 ZnF_CHCC zinc finge  25.6      53  0.0012   18.8   1.6   13   45-57     16-28  (55)
 47 COG3250 LacZ Beta-galactosidas  24.6 1.2E+02  0.0026   27.0   4.2   31   45-75    276-306 (808)
 48 PF04076 BOF:  Bacterial OB fol  24.3      56  0.0012   21.8   1.7   26   54-79     36-62  (103)
 49 COG1965 CyaY Protein implicate  24.2      79  0.0017   21.8   2.4   20   55-74     32-54  (106)
 50 cd06472 ACD_ScHsp26_like Alpha  24.2      60  0.0013   20.0   1.7   13   52-64     76-88  (92)
 51 PF14527 LAGLIDADG_WhiA:  WhiA   23.9      65  0.0014   20.8   1.9   16   45-60     49-64  (93)
 52 PF12276 DUF3617:  Protein of u  23.4      66  0.0014   21.6   1.9   21   37-57     89-109 (162)
 53 cd06478 ACD_HspB4-5-6 Alpha-cr  22.9      68  0.0015   19.9   1.8   15   51-65     65-80  (83)
 54 PF00070 Pyr_redox:  Pyridine n  22.9 1.2E+02  0.0025   17.9   2.8   21   40-60     60-80  (80)
 55 cd06464 ACD_sHsps-like Alpha-c  22.7      70  0.0015   18.5   1.7   13   52-64     72-84  (88)
 56 COG0071 IbpA Molecular chapero  22.3      61  0.0013   21.9   1.6   13   52-64    116-128 (146)
 57 PF03941 INCENP_ARK-bind:  Inne  22.0      30 0.00065   20.5   0.0   12   18-29      1-12  (57)
 58 cd00503 Frataxin Frataxin is a  22.0      82  0.0018   20.9   2.1   21   54-74     31-54  (105)
 59 PF15603 Imm45:  Immunity prote  21.9 1.5E+02  0.0033   19.2   3.3   23   45-67      2-25  (82)
 60 cd06498 ACD_alphaB-crystallin_  21.6      74  0.0016   19.9   1.8   16   50-65     64-80  (84)
 61 cd06476 ACD_HspB2_like Alpha c  20.9      77  0.0017   19.9   1.7   15   51-65     65-80  (83)
 62 PF04985 Phage_tube:  Phage tai  20.9 2.5E+02  0.0054   19.3   4.4   38   33-70    120-158 (167)
 63 smart00564 PQQ beta-propeller   20.9      93   0.002   15.2   1.8   17   64-80     14-30  (33)

No 1  
>PF03153 TFIIA:  Transcription factor IIA, alpha/beta subunit;  InterPro: IPR004855 Transcription factor IIA (TFIIA) is one of several factors that form part of a transcription pre-initiation complex along with RNA polymerase II, the TATA-box-binding protein (TBP) and TBP-associated factors, on the TATA-box sequence upstream of the initiation start site. After initiation, some components of the pre-initiation complex (including TFIIA) remain attached and re-initiate a subsequent round of transcription. TFIIA binds to TBP to stabilise TBP binding to the TATA element. TFIIA also inhibits the cytokine HMGB1 (high mobility group 1 protein) binding to TBP [], and can dissociate HMGB1 already bound to TBP/TATA-box. Human and Drosophila TFIIA have three subunits: two large subunits, LN/alpha and LC/beta, derived from the same gene, and a small subunit, S/gamma. Yeast TFIIA has two subunits: a large TOA1 subunit that shows sequence similarity to the N-terminal of LN/alpha and the C-terminal of LC/beta, and a small subunit, TOA2 that is highly homologous with S/gamma. The conserved regions of the large and small subunits of TFIIA combine to form two domains: a four-helix bundle (helical domain) composed of two helices from each of the N-terminal regions of TOA1 and TOA2 in yeast; and a beta-barrel (beta-barrel domain) composed of beta-sheets from the C-terminal regions of TOA1 and TOA2 []. This entry represents the precursor that yields both the alpha and beta subunits of TFIIA. The TFIIA heterotrimer is an essential general transcription initiation factor for the expression of genes transcribed by RNA polymerase II []. ; GO: 0006367 transcription initiation from RNA polymerase II promoter, 0005672 transcription factor TFIIA complex; PDB: 1NVP_B 1YTF_B 1RM1_C 1NH2_B.
Probab=100.00  E-value=8.7e-39  Score=242.92  Aligned_cols=62  Identities=61%  Similarity=1.085  Sum_probs=45.7

Q ss_pred             CCCCCCCCCCC-----c-CCCCCCCEEEEEEeeeeecCCeeEEEecceeEEECCeeeEeeeceeeeeC
Q psy11263         19 LNSSDDVSEED-----P-ALFDTDNIVVCQYDKITRSRNKWKFYLKDGIMNLNGKDFVFLKANGDADW   80 (80)
Q Consensus        19 lnSddD~sd~d-----~-e~~~~~nvilC~ydKV~R~KnKWKc~LKdGim~ingkDyvF~ka~GE~eW   80 (80)
                      +|||+|+|++|     . ++++++|+||||||||+|+||||||+|||||||||||||||+||+|||||
T Consensus       308 ~~~~~~~~~dd~~~~~~~~~~~~~~~~~c~~~kv~r~k~~wk~~lk~g~~~~~~~d~~f~~~~ge~~w  375 (375)
T PF03153_consen  308 INSDLDDSDDDVSDEDDEDDFDTDNVVLCQYDKVTRVKNKWKCTLKDGIMHINGKDYVFQKATGEFEW  375 (375)
T ss_dssp             ------------B-------STTS-EEEEEEEEEEEETTEEEEEEEEEEEEETTEEEEEEEEEEEEE-
T ss_pred             ccCCcCCccccccccccccccCcCCEEEEEeeccccccceeEEEeeeeEEEECCeEEEEeeeeeeecC
Confidence            78877776543     2 66899999999999999999999999999999999999999999999999


No 2  
>KOG2652|consensus
Probab=100.00  E-value=3.4e-35  Score=230.69  Aligned_cols=67  Identities=61%  Similarity=1.106  Sum_probs=56.3

Q ss_pred             CCCCCCCCCCCCC-CCCc-----CCCCCCCEEEEEEeeeeecCCeeEEEecceeEEECCeeeEeeeceeeeeC
Q psy11263         14 IEDEPLNSSDDVS-EEDP-----ALFDTDNIVVCQYDKITRSRNKWKFYLKDGIMNLNGKDFVFLKANGDADW   80 (80)
Q Consensus        14 ~~ed~lnSddD~s-d~d~-----e~~~~~nvilC~ydKV~R~KnKWKc~LKdGim~ingkDyvF~ka~GE~eW   80 (80)
                      ++++.+|||++|. ++++     +..+|+|+||||||||+|+||||||+|||||||||||||||+||+|||||
T Consensus       276 ~dee~~n~Dd~D~~EeeplnsedDvsdt~nvVvCqyDKV~RsKnKWKc~LKDGIM~ingkDY~F~KA~GeaEW  348 (348)
T KOG2652|consen  276 EDEELGNSDDDDGVEEEPLNSEDDVSDTQNVVVCQYDKVNRSKNKWKCYLKDGVMHINGKDYVFQKAQGEAEW  348 (348)
T ss_pred             hhhhcccccccCccccccccCcccccccceeEEEeeeeeccccceeeEEeecceEEeCCceeEeeecccccCC
Confidence            3566677777664 3332     12347899999999999999999999999999999999999999999999


No 3  
>COG5149 TOA1 Transcription initiation factor IIA, large chain [Transcription]
Probab=99.95  E-value=3.3e-28  Score=186.80  Aligned_cols=67  Identities=39%  Similarity=0.740  Sum_probs=59.7

Q ss_pred             CCCCCCCCCCCCCCCCc---CC---CCCCCEEEEEEeeeeecCCeeEEEecceeEEECCeeeEeeeceeeeeC
Q psy11263         14 IEDEPLNSSDDVSEEDP---AL---FDTDNIVVCQYDKITRSRNKWKFYLKDGIMNLNGKDFVFLKANGDADW   80 (80)
Q Consensus        14 ~~ed~lnSddD~sd~d~---e~---~~~~nvilC~ydKV~R~KnKWKc~LKdGim~ingkDyvF~ka~GE~eW   80 (80)
                      .-++.++||+|+||+|.   +.   ....|+|||+||||+|+|+||||+|||||+.|||+||+|+||+|||||
T Consensus       220 ~~De~~~sdlddsD~d~~~se~egt~~~~n~mlCLYdKVn~~K~kWKCtfkdGvV~In~~Dy~F~kAqgE~EW  292 (293)
T COG5149         220 AKDEGMFSDLDDSDVDSGDSEIEGTKGSTNCMLCLYDKVNMSKGKWKCTFKDGVVSINNIDYVFNKAQGELEW  292 (293)
T ss_pred             ccCcccccccCCccccccccccccCCCCceEEEEEeeecccccceeeEEeecceEEecCceeEEeeccceEee
Confidence            35678899999998866   22   234599999999999999999999999999999999999999999999


No 4  
>PF09211 DUF1958:  Domain of unknown function (DUF1958);  InterPro: IPR015294 Penicillin-binding proteins are beta-lactam antibiotic-sensitive bacterial enzymes required for the growth and maintenance of the peptidoglycan layer of the bacterial cell wall that protects the cell from osmotic stress. Penicillin-binding protein 4 (PBP4) functions as a transpeptidase, and belongs to MEROPS peptidase family S11 (clan SE). PBP4 acts co-operatively with PBP2 in staphylococcal cell wall biosynthesis and susceptibility to antimicrobial agents []. This entry represents the C-terminal domain PBP4.; PDB: 1TVF_A 3HUN_A 3HUM_B.
Probab=85.99  E-value=0.82  Score=29.05  Aligned_cols=29  Identities=28%  Similarity=0.713  Sum_probs=20.6

Q ss_pred             EEeeeeecCCeeEEEecceeEEE-CCeeeE
Q psy11263         42 QYDKITRSRNKWKFYLKDGIMNL-NGKDFV   70 (80)
Q Consensus        42 ~ydKV~R~KnKWKc~LKdGim~i-ngkDyv   70 (80)
                      +|+=|-+-+++|++.++||.+++ +++.|+
T Consensus        23 lYd~VpK~~~~~~~~v~dg~v~vd~~r~fl   52 (65)
T PF09211_consen   23 LYDVVPKGKKPYKLKVKDGKVHVDYGRQFL   52 (65)
T ss_dssp             EEEEEETT--GSEEEEETTEEEEE-S--BS
T ss_pred             hhhhccCCCccceEEEeCCEEEEeCCcccC
Confidence            57778888888999999999999 666654


No 5  
>COG5013 NarG Nitrate reductase alpha subunit [Energy production and conversion]
Probab=85.85  E-value=0.52  Score=43.02  Aligned_cols=27  Identities=37%  Similarity=0.764  Sum_probs=23.1

Q ss_pred             EEEeeeeec--------CCeeEEEecceeEEECCe
Q psy11263         41 CQYDKITRS--------RNKWKFYLKDGIMNLNGK   67 (80)
Q Consensus        41 C~ydKV~R~--------KnKWKc~LKdGim~ingk   67 (80)
                      =|||||-||        ...||+..||||++-..+
T Consensus        41 WqhDKvVRSTHGVNCTGSCSWkIYVKdGiITWEtQ   75 (1227)
T COG5013          41 WQHDKVVRSTHGVNCTGSCSWKIYVKNGLITWETQ   75 (1227)
T ss_pred             hcccceeeccCCccccceeeEEEEEeCCEEEEeec
Confidence            379999998        458999999999997665


No 6  
>PF03153 TFIIA:  Transcription factor IIA, alpha/beta subunit;  InterPro: IPR004855 Transcription factor IIA (TFIIA) is one of several factors that form part of a transcription pre-initiation complex along with RNA polymerase II, the TATA-box-binding protein (TBP) and TBP-associated factors, on the TATA-box sequence upstream of the initiation start site. After initiation, some components of the pre-initiation complex (including TFIIA) remain attached and re-initiate a subsequent round of transcription. TFIIA binds to TBP to stabilise TBP binding to the TATA element. TFIIA also inhibits the cytokine HMGB1 (high mobility group 1 protein) binding to TBP [], and can dissociate HMGB1 already bound to TBP/TATA-box. Human and Drosophila TFIIA have three subunits: two large subunits, LN/alpha and LC/beta, derived from the same gene, and a small subunit, S/gamma. Yeast TFIIA has two subunits: a large TOA1 subunit that shows sequence similarity to the N-terminal of LN/alpha and the C-terminal of LC/beta, and a small subunit, TOA2 that is highly homologous with S/gamma. The conserved regions of the large and small subunits of TFIIA combine to form two domains: a four-helix bundle (helical domain) composed of two helices from each of the N-terminal regions of TOA1 and TOA2 in yeast; and a beta-barrel (beta-barrel domain) composed of beta-sheets from the C-terminal regions of TOA1 and TOA2 []. This entry represents the precursor that yields both the alpha and beta subunits of TFIIA. The TFIIA heterotrimer is an essential general transcription initiation factor for the expression of genes transcribed by RNA polymerase II []. ; GO: 0006367 transcription initiation from RNA polymerase II promoter, 0005672 transcription factor TFIIA complex; PDB: 1NVP_B 1YTF_B 1RM1_C 1NH2_B.
Probab=72.60  E-value=1.2  Score=34.39  Aligned_cols=14  Identities=29%  Similarity=0.273  Sum_probs=0.0

Q ss_pred             ccccccccccCCCC
Q psy11263          3 LIPTLAQVVCGIED   16 (80)
Q Consensus         3 ~~~~l~~~~~~~~e   16 (80)
                      .|||++++....++
T Consensus       269 ~~~Q~DG~~d~~~~  282 (375)
T PF03153_consen  269 RIPQLDGAGDDSDD  282 (375)
T ss_dssp             --------------
T ss_pred             ccccccCCCCCccc
Confidence            47888888555544


No 7  
>PF04584 Pox_A28:  Poxvirus A28 family;  InterPro: IPR007664 The poxvirus A28 protein is expressed at late times during the virus replication cycle and is a membrane component of the intracellular mature virion. Repression of A28 inhibits cell-to-cell spread, suggesting that all poxviruses use a common A28-dependent mechanism of cell penetration []. An N-terminal hydrophobic sequence, present in all poxvirus A28 orthologues, anchors the protein in the virion surface membrane so that most of it is exposed to the cytoplasm [].; GO: 0016032 viral reproduction, 0019031 viral envelope
Probab=68.85  E-value=2.4  Score=30.61  Aligned_cols=18  Identities=17%  Similarity=0.536  Sum_probs=14.0

Q ss_pred             eeeeecCCeeEEEeccee
Q psy11263         44 DKITRSRNKWKFYLKDGI   61 (80)
Q Consensus        44 dKV~R~KnKWKc~LKdGi   61 (80)
                      |-|.-+|.||||.+.+++
T Consensus        63 D~~~DvkqKWRCv~~~~~   80 (140)
T PF04584_consen   63 DEVYDVKQKWRCVKYNNV   80 (140)
T ss_pred             CcccChhhceEEEeeCCe
Confidence            345668999999998865


No 8  
>PRK09719 hypothetical protein; Provisional
Probab=63.44  E-value=1.9  Score=28.65  Aligned_cols=12  Identities=50%  Similarity=0.850  Sum_probs=10.1

Q ss_pred             EEEEEeeeeecC
Q psy11263         39 VVCQYDKITRSR   50 (80)
Q Consensus        39 ilC~ydKV~R~K   50 (80)
                      --|||||.+|+-
T Consensus        57 wrcqydklhrvp   68 (89)
T PRK09719         57 WRCQYDKLHRVP   68 (89)
T ss_pred             hhcchhhhhccc
Confidence            469999999974


No 9  
>smart00456 WW Domain with 2 conserved Trp (W) residues. Also known as the WWP or rsp5 domain. Binds proline-rich polypeptides.
Probab=57.95  E-value=8.2  Score=19.61  Aligned_cols=16  Identities=13%  Similarity=0.736  Sum_probs=14.3

Q ss_pred             CCeeeEeeeceeeeeC
Q psy11263         65 NGKDFVFLKANGDADW   80 (80)
Q Consensus        65 ngkDyvF~ka~GE~eW   80 (80)
                      +|+-|.|+..|++..|
T Consensus        12 ~g~~yy~n~~t~~s~W   27 (32)
T smart00456       12 DGRPYYYNHETKETQW   27 (32)
T ss_pred             CCCEEEEECCCCCEEc
Confidence            4899999999999887


No 10 
>cd06477 ACD_HspB3_Like Alpha crystallin domain (ACD) found in mammalian HspB3, also known as heat-shock protein 27-like protein (HSPL27, 17-kDa) and similar proteins. sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. HspB3 is expressed in adult skeletal muscle, smooth muscle, and heart, and in several other fetal tissues.  In muscle cells HspB3 forms an oligomeric 150 kDa complex with myotonic dystrophy protein kinase-binding protein (MKBP/ HspB2), this complex may comprise one of two independent muscle-cell specific chaperone systems. The expression of HspB3 is induced during muscle differentiation controlled by the myogenic factor MyoD. HspB3 may also interact with Hsp22 (HspB8).
Probab=49.89  E-value=10  Score=24.15  Aligned_cols=32  Identities=19%  Similarity=0.352  Sum_probs=20.8

Q ss_pred             CEEEEEEeeeeec-----CCeeEEEe-cceeEEECCee
Q psy11263         37 NIVVCQYDKITRS-----RNKWKFYL-KDGIMNLNGKD   68 (80)
Q Consensus        37 nvilC~ydKV~R~-----KnKWKc~L-KdGim~ingkD   68 (80)
                      +++-..|-+.-+-     -++=+..| ++||++|.++|
T Consensus        46 ~~~~r~F~R~~~LP~~Vd~~~v~A~~~~dGvL~I~~~~   83 (83)
T cd06477          46 GFISRSFTRQYQLPDGVEHKDLSAMLCHDGILVVETKD   83 (83)
T ss_pred             CEEEEEEEEEEECCCCcchheEEEEEcCCCEEEEEecC
Confidence            4444444443332     45677887 89999998875


No 11 
>PF01473 CW_binding_1:  Putative cell wall binding repeat;  InterPro: IPR018337 The cell wall-binding repeat (CW) is an about 20 amino acid residue module, essentially found in two bacterial Gram-positive protein families; the choline binding proteins and glucosyltransferases (2.4.1.5 from EC). In choline-binding proteins cell wall binding repeats bind to choline moieties of both teichoic and lipoteichoic acids, two components peculiar to the cell surface of Gram-positive bacteria [, ]. In glucosyltransferases the region spanning the CW repeats is a glucan binding domain []. Several crystal structures of CW have been solved [, ]. In the choline binding protein LytA, the repeats adopt a solenoid fold consisting exclusively of beta-hairpins that stack to form a left-handed superhelix with a boomerang-like shape. The choline groups bind between beta-hairpin 'steps' of the superhelix []. In Cpl-1 CW repeats assemble in two sub-domains: an N-terminal superhelical moiety similar to the LytA one and a C-terminal beta-sheet involved in interactions with the lysozyme domain. Choline is bound between repeats 1 and 2, and, 2 and 3 of the superhelical sub-domain []. Some proteins known to contain cell-wall binding repeats include:  Pneumococcal N-acetylmuramoyl-L-alanine amidase (autolysin, lytA) (3.5.1.28 from EC). It is a surface-exposed enzyme that rules the self-destruction of pneumococcal cells through degradation of their peptidoglycan backbone. It mediates the release of toxic substances that damage the host tissues. Pneumococcal endo-beta-N-acetylglucosaminidase (lytB) (3.2.1.96 from EC). It plays an important role in cell wall degradation and cell separation. Pneumococcal teichoic acid phosphorylcholine esterase (pce or cbpE), a cell wall hydrolase important for cellular adhesion and colonisation. Lactobacillales glucosyltransferase. It catalyses the transfer of glucosyl units from the cleavage of sucrose to a growing chain of glucan.  Clostridium difficile toxin A (tcdA) and toxin B (tcdb). They are the causative agents of the antibiotic-associated pseudomembranous colitis. They are intracellular acting toxins that reach their targets after receptor-mediated endocytosis.  Clostridium acetobutylicum cspA protein. Siphoviridae bacteriophages N-acetylmuramoyl-L-alanine amidase. It lyses the bacterial host cell wall. Podoviridae lysozyme protein (cpl-1). It is capable of digesting the pneumococcal cell wall.  The cell wall binding repeats are also known as the choline-binding repeats (ChBr) or the choline-binding domain (ChBD). ; PDB: 1GVM_C 2BML_B 1HCX_A 1OBA_A 1H09_A 2J8F_A 2IXU_A 2J8G_A 2IXV_A 2X8O_A ....
Probab=49.77  E-value=24  Score=16.52  Aligned_cols=17  Identities=29%  Similarity=0.544  Sum_probs=11.7

Q ss_pred             eeEEECCeeeEeeeceee
Q psy11263         60 GIMNLNGKDFVFLKANGD   77 (80)
Q Consensus        60 Gim~ingkDyvF~ka~GE   77 (80)
                      |-++++|+=|.| +.+|.
T Consensus         2 ~W~~~~~~wYy~-~~~G~   18 (19)
T PF01473_consen    2 GWVQDNGNWYYF-DSDGY   18 (19)
T ss_dssp             EEEEETTEEEEE-TTTSB
T ss_pred             cCEEECCEEEEe-CCCcc
Confidence            567778888877 55554


No 12 
>PF12139 APS-reductase_C:  Adenosine-5'-phosphosulfate reductase beta subunit;  InterPro: IPR022738  This domain is found in bacteria and archaea and is typically between 112 to 142 amino acids in length. It is found in association with PF00037 from PFAM, and has a conserved FPIRTT sequence motif. The whole beta subunit has the enzymic properties of 1.8.99.2 from EC. ; PDB: 1JNZ_B 2FJE_D 2FJD_B 1JNR_D 2FJB_B 2FJA_B 3GYX_J.
Probab=49.02  E-value=17  Score=24.31  Aligned_cols=17  Identities=29%  Similarity=0.768  Sum_probs=12.2

Q ss_pred             eeEEEecceeEEECCeeeEee
Q psy11263         52 KWKFYLKDGIMNLNGKDFVFL   72 (80)
Q Consensus        52 KWKc~LKdGim~ingkDyvF~   72 (80)
                      -|+|+|+||.+    |+|.|.
T Consensus        24 mWtikFRnG~~----KrFkfP   40 (83)
T PF12139_consen   24 MWTIKFRNGTV----KRFKFP   40 (83)
T ss_dssp             EEEEE-TTS-E----EEEEEE
T ss_pred             EEEEEecCCce----eeeecc
Confidence            49999999965    677775


No 13 
>COG4847 Uncharacterized protein conserved in archaea [Function unknown]
Probab=48.87  E-value=15  Score=25.35  Aligned_cols=27  Identities=33%  Similarity=0.871  Sum_probs=21.8

Q ss_pred             CeeEEEecceeEEECCeeeEeeeceeeee
Q psy11263         51 NKWKFYLKDGIMNLNGKDFVFLKANGDAD   79 (80)
Q Consensus        51 nKWKc~LKdGim~ingkDyvF~ka~GE~e   79 (80)
                      -+|||....|-+ +-|.-|.|.| +|-.-
T Consensus         5 kewkC~VCg~~i-ieGqkFTF~~-kGsVH   31 (103)
T COG4847           5 KEWKCYVCGGTI-IEGQKFTFTK-KGSVH   31 (103)
T ss_pred             ceeeEeeeCCEe-eeccEEEEee-CCcch
Confidence            479999999976 6788899988 66543


No 14 
>PF00397 WW:  WW domain;  InterPro: IPR001202 Synonym(s): Rsp5 or WWP domain The WW domain is a short conserved region in a number of unrelated proteins, which folds as a stable, triple stranded beta-sheet. This short domain of approximately 40 amino acids, may be repeated up to four times in some proteins [, , , ]. The name WW or WWP derives from the presence of two signature tryptophan residues that are spaced 20-23 amino acids apart and are present in most WW domains known to date, as well as that of a conserved Pro. The WW domain binds to proteins with particular proline-motifs, [AP]-P-P-[AP]-Y, and/or phosphoserine- phosphothreonine-containing motifs [, ]. It is frequently associated with other domains typical for proteins in signal transduction processes. A large variety of proteins containing the WW domain are known. These include; dystrophin, a multidomain cytoskeletal protein; utrophin, a dystrophin-like protein of unknown function; vertebrate YAP protein, substrate of an unknown serine kinase; Mus musculus (Mouse) NEDD-4, involved in the embryonic development and differentiation of the central nervous system; Saccharomyces cerevisiae (Baker's yeast) RSP5, similar to NEDD-4 in its molecular organisation; Rattus norvegicus (Rat) FE65, a transcription-factor activator expressed preferentially in liver; Nicotiana tabacum (Common tobacco) DB10 protein, amongst others.; GO: 0005515 protein binding; PDB: 2JXW_A 2DK1_A 2JOC_A 2JO9_A 1YIU_A 1O6W_A 2JMF_A 1TK7_A 2KYK_A 2L5F_A ....
Probab=48.50  E-value=14  Score=19.28  Aligned_cols=16  Identities=19%  Similarity=0.879  Sum_probs=14.5

Q ss_pred             CCeeeEeeeceeeeeC
Q psy11263         65 NGKDFVFLKANGDADW   80 (80)
Q Consensus        65 ngkDyvF~ka~GE~eW   80 (80)
                      .|+-|.|+..||+..|
T Consensus        13 ~g~~YY~N~~t~~s~W   28 (31)
T PF00397_consen   13 SGRPYYYNHETGESQW   28 (31)
T ss_dssp             TSEEEEEETTTTEEES
T ss_pred             CCCEEEEeCCCCCEEe
Confidence            4899999999999888


No 15 
>PF14480 DNA_pol3_a_NI:  DNA polymerase III polC-type N-terminus I
Probab=47.95  E-value=16  Score=21.84  Aligned_cols=13  Identities=31%  Similarity=0.889  Sum_probs=10.8

Q ss_pred             eeecCCeeEEEec
Q psy11263         46 ITRSRNKWKFYLK   58 (80)
Q Consensus        46 V~R~KnKWKc~LK   58 (80)
                      |+|.+++|++.|+
T Consensus        31 v~k~~~~w~f~l~   43 (76)
T PF14480_consen   31 VHKKSRKWRFHLS   43 (76)
T ss_pred             EEccCCEEEEEEE
Confidence            5678889999886


No 16 
>cd00201 WW Two conserved tryptophans domain; also known as the WWP or rsp5 domain; around 40 amino acids; functions as an interaction module in a diverse set of signalling proteins; binds specific proline-rich sequences but at low affinities compared to other peptide recognition proteins such as antibodies and receptors; WW domains have a single groove formed by a conserved Trp and Tyr which recognizes a pair of residues of the sequence X-Pro; variable loops and neighboring domains confer specificity in this domain; there are five distinct groups based on binding: 1) PPXY motifs 2) the PPLP motif; 3) PGM motifs; 4) PSP or PTP motifs; 5) PR motifs.
Probab=46.95  E-value=16  Score=18.09  Aligned_cols=16  Identities=13%  Similarity=0.684  Sum_probs=14.0

Q ss_pred             CCeeeEeeeceeeeeC
Q psy11263         65 NGKDFVFLKANGDADW   80 (80)
Q Consensus        65 ngkDyvF~ka~GE~eW   80 (80)
                      +|+-|.++..+++..|
T Consensus        11 ~g~~yy~n~~t~~s~W   26 (31)
T cd00201          11 DGRVYYYNHNTKETQW   26 (31)
T ss_pred             CCCEEEEECCCCCEeC
Confidence            3899999999998877


No 17 
>KOG2345|consensus
Probab=43.70  E-value=22  Score=28.59  Aligned_cols=19  Identities=21%  Similarity=0.434  Sum_probs=17.7

Q ss_pred             ceeEEECCeeeEeeeceee
Q psy11263         59 DGIMNLNGKDFVFLKANGD   77 (80)
Q Consensus        59 dGim~ingkDyvF~ka~GE   77 (80)
                      +|.+.||++.|.|.+.-||
T Consensus        13 ~~tv~In~~Ryri~~~Lge   31 (302)
T KOG2345|consen   13 RGTVIINNKRYRIQRLLGE   31 (302)
T ss_pred             CCcEEEcCceEEEeeeecC
Confidence            8999999999999998876


No 18 
>PF09038 53-BP1_Tudor:  Tumour suppressor p53-binding protein-1 Tudor;  InterPro: IPR015125 This domain consist of ten beta-strands and a carboxy-terminal alpha-helix. The amino-terminal five beta-strands and the C-terminal five beta-strands adopt folds that are identical to each other. The domain is essential for the recruitment of proteins to double stranded breaks in DNA, which is mediated by interaction with methylated Lys 79 of histone H3 []. ; PDB: 3LGL_A 1XNI_B 3LGF_A 2G3R_A 2IG0_A 3LH0_A 1SSF_A.
Probab=42.04  E-value=26  Score=24.72  Aligned_cols=25  Identities=36%  Similarity=0.659  Sum_probs=21.0

Q ss_pred             eecCCeeEEEecceeE-EECCeeeEe
Q psy11263         47 TRSRNKWKFYLKDGIM-NLNGKDFVF   71 (80)
Q Consensus        47 ~R~KnKWKc~LKdGim-~ingkDyvF   71 (80)
                      .+.++|.|+.|-||-. .|.++|++-
T Consensus        27 ~~~~~kykv~FdDG~~~~v~~~div~   52 (122)
T PF09038_consen   27 DKGKNKYKVLFDDGYECRVLGKDIVV   52 (122)
T ss_dssp             EETTTEEEEEETTS-EEEEECCCEEE
T ss_pred             cCCCCeEEEEecCCccceeccCcEEE
Confidence            4679999999999988 599999875


No 19 
>COG4079 Uncharacterized protein conserved in archaea [Function unknown]
Probab=40.06  E-value=18  Score=28.87  Aligned_cols=20  Identities=35%  Similarity=0.682  Sum_probs=16.5

Q ss_pred             CCeeEEEecceeEEECCeee
Q psy11263         50 RNKWKFYLKDGIMNLNGKDF   69 (80)
Q Consensus        50 KnKWKc~LKdGim~ingkDy   69 (80)
                      +--=++..|||+|.|.|+|.
T Consensus       263 ~pGd~vvv~dg~mki~G~d~  282 (293)
T COG4079         263 EPGDRVVVKDGVMKIDGKDL  282 (293)
T ss_pred             CCCCEEEEecCceEeccccc
Confidence            33457889999999999986


No 20 
>PTZ00486 apyrase Superfamily; Provisional
Probab=39.14  E-value=37  Score=27.68  Aligned_cols=31  Identities=23%  Similarity=0.473  Sum_probs=24.7

Q ss_pred             EEEEEEeeeee--cCCeeEEEecceeEEECCee
Q psy11263         38 IVVCQYDKITR--SRNKWKFYLKDGIMNLNGKD   68 (80)
Q Consensus        38 vilC~ydKV~R--~KnKWKc~LKdGim~ingkD   68 (80)
                      .|+.=-||-+|  .+|+|++.|+-|.+...+..
T Consensus        59 aiIaDlD~~S~~~~~~~w~S~~~~G~L~~~~~~   91 (352)
T PTZ00486         59 ALVADLDKASKDKEGKKWRSKVIKGTIFRQGNG   91 (352)
T ss_pred             EEEecCchhccccCCCceEEEEEEEEEEEcCCC
Confidence            35566688888  58999999999999887754


No 21 
>PF13691 Lactamase_B_4:  tRNase Z endonuclease
Probab=38.26  E-value=27  Score=21.60  Aligned_cols=13  Identities=8%  Similarity=0.508  Sum_probs=10.6

Q ss_pred             eEEECCeeeEeee
Q psy11263         61 IMNLNGKDFVFLK   73 (80)
Q Consensus        61 im~ingkDyvF~k   73 (80)
                      +++.+.+.|+|.+
T Consensus        16 ~l~~d~~rYlFGn   28 (63)
T PF13691_consen   16 LLFFDSRRYLFGN   28 (63)
T ss_pred             EEEeCCceEEecc
Confidence            5788999999943


No 22 
>PF01491 Frataxin_Cyay:  Frataxin-like domain;  InterPro: IPR002908 The eukaryotic proteins in this entry include frataxin, the protein that is mutated in Friedreich's ataxia [], and related sequences. Friedreich's ataxia is a progressive neurodegenerative disorder caused by loss of function mutations in the gene encoding frataxin (FRDA). Frataxin mRNA is predominantly expressed in tissues with a high metabolic rate (including liver, kidney, brown fat and heart). Mouse and yeast frataxin homologues contain a potential N-terminal mitochondrial targeting sequence, and human frataxin has been observed to co-localise with a mitochondrial protein. Furthermore, disruption of the yeast gene has been shown to result in mitochondrial dysfunction. Friedreich's ataxia is thus believed to be a mitochondrial disease caused by a mutation in the nuclear genome (specifically, expansion of an intronic GAA triplet repeat) [, , ]. The bacterial proteins in this entry are iron-sulphur cluster (FeS) metabolism CyaY proteins hmologous to eukaryotic frataxin. Partial Phylogenetic Profiling [] suggests that CyaY most likely functions as part of the ISC system for FeS cluster biosynthesis, and is supported by expermimental data in some species [, ]. ; PDB: 1EW4_A 2P1X_A 1SOY_A 2EFF_A 3T3T_B 3S4M_A 3T3K_A 3S5D_A 1LY7_A 3T3X_B ....
Probab=35.83  E-value=39  Score=22.43  Aligned_cols=22  Identities=18%  Similarity=0.406  Sum_probs=17.4

Q ss_pred             eEEEecceeEEEC---CeeeEeeec
Q psy11263         53 WKFYLKDGIMNLN---GKDFVFLKA   74 (80)
Q Consensus        53 WKc~LKdGim~in---gkDyvF~ka   74 (80)
                      .-|.+.+|||+|.   |.-||++|-
T Consensus        32 ~d~e~~~gVLti~~~~~~~~VINkQ   56 (109)
T PF01491_consen   32 IDVERSGGVLTIEFPDGGQYVINKQ   56 (109)
T ss_dssp             EEEEEETTEEEEEETTSEEEEEEEE
T ss_pred             eEEEccCCEEEEEECCCCEEEEeCC
Confidence            4577888999884   889999874


No 23 
>PF10382 DUF2439:  Protein of unknown function (DUF2439);  InterPro: IPR018838 This domain is found at the N-terminal of proteins implicated in telomere maintenance in Saccharomyces cerevisiae (Baker's yeast) [] and in meiotic chromosome segregation in Schizosaccharomyces pombe (Fission yeast) [].
Probab=35.80  E-value=62  Score=20.52  Aligned_cols=30  Identities=23%  Similarity=0.639  Sum_probs=20.4

Q ss_pred             EEEEeeeeecCCe-eEEEecceeEEEC---CeeeEeee
Q psy11263         40 VCQYDKITRSRNK-WKFYLKDGIMNLN---GKDFVFLK   73 (80)
Q Consensus        40 lC~ydKV~R~KnK-WKc~LKdGim~in---gkDyvF~k   73 (80)
                      -|||-+=.|.|.| |    .||++.+.   +|=.|+.-
T Consensus         5 ~~lYT~q~~kK~K~W----~DG~l~~~~~~~kv~Lyde   38 (83)
T PF10382_consen    5 ECLYTHQKTKKRKKW----HDGFLKYHSFNKKVMLYDE   38 (83)
T ss_pred             EEEEEccccccceee----ECCEEEEEeCCCEEEEEcC
Confidence            5899877776664 6    49999875   44555543


No 24 
>KOG0284|consensus
Probab=35.44  E-value=32  Score=29.10  Aligned_cols=44  Identities=16%  Similarity=0.110  Sum_probs=37.0

Q ss_pred             CCEEEEEEeeeeecC-CeeEEEecceeEEECCeeeEeeeceeeee
Q psy11263         36 DNIVVCQYDKITRSR-NKWKFYLKDGIMNLNGKDFVFLKANGDAD   79 (80)
Q Consensus        36 ~nvilC~ydKV~R~K-nKWKc~LKdGim~ingkDyvF~ka~GE~e   79 (80)
                      .|.+.|.-.|..|+. ||=||..-.=-=+=.||..+-...+|||+
T Consensus        77 ~dp~~~~~tKf~h~s~NKvkc~V~~v~WtPeGRRLltgs~SGEFt  121 (464)
T KOG0284|consen   77 DDPSSAFTTKFVHTSSNKVKCPVNVVRWTPEGRRLLTGSQSGEFT  121 (464)
T ss_pred             CCcccccccceEeccccccccceeeEEEcCCCceeEeecccccEE
Confidence            578888999999987 99888766555556899999999999997


No 25 
>TIGR03421 FeS_CyaY iron donor protein CyaY. Members of this protein family are the iron-sulfur cluster (FeS) metabolism protein CyaY, a homolog of eukaryotic frataxin. ISC is one of several bacterial systems for FeS assembly; we find by Partial Phylogenetic Profiling vs. the ISC system that CyaY most like work with the ISC system for FeS cluster biosynthesis. A study of of cyaY mutants in Salmonella enterica bears this out. Although the trusted cutoff is set low enough to include eukaryotic frataxin sequences, a narrower, exception-type model (TIGR03421) identifies identifies members of that specific set.
Probab=34.27  E-value=43  Score=22.24  Aligned_cols=20  Identities=25%  Similarity=0.459  Sum_probs=14.2

Q ss_pred             EEecceeEEE---CCeeeEeeec
Q psy11263         55 FYLKDGIMNL---NGKDFVFLKA   74 (80)
Q Consensus        55 c~LKdGim~i---ngkDyvF~ka   74 (80)
                      |.+.+|||+|   ||.-||++|-
T Consensus        29 ~e~~~gVLti~f~~~~~~VINkQ   51 (102)
T TIGR03421        29 CERAGGVLTLTFENGSQIIINKQ   51 (102)
T ss_pred             eecCCCEEEEEECCCCEEEEeCC
Confidence            4556778777   5778888774


No 26 
>PF14267 DUF4357:  Domain of unknown function (DUF4357)
Probab=33.95  E-value=25  Score=21.16  Aligned_cols=17  Identities=29%  Similarity=0.720  Sum_probs=13.3

Q ss_pred             ecceeEEECCeeeEeee
Q psy11263         57 LKDGIMNLNGKDFVFLK   73 (80)
Q Consensus        57 LKdGim~ingkDyvF~k   73 (80)
                      +.+|+|...|..|+|.+
T Consensus         5 i~~G~l~~~~~~~~f~~   21 (55)
T PF14267_consen    5 IEDGVLVPDGGRLVFTQ   21 (55)
T ss_pred             HhCCCEEecCCcEEEec
Confidence            46889988888888765


No 27 
>cd06497 ACD_alphaA-crystallin_HspB4 Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaA-crystallin (HspB4, 20kDa). sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. Alpha crystallin, an abundant protein in the mammalian lens, is a large (700 kDa) heteropolymer composed of HspB4 and HspB5, generally in a molar ratio of HspB4:HspB5 of 3:1.  Only trace amounts of HspB4 are found in tissues other than the lens. HspB5 does not belong to this group. Mutations inHspB4 have been associated with Autosomal Dominant Congenital Cataract (ADCC). The chaperone-like functions of HspB4 are considered important for maintaining lens transparency and preventing cataract.
Probab=33.61  E-value=33  Score=21.56  Aligned_cols=16  Identities=19%  Similarity=0.443  Sum_probs=12.8

Q ss_pred             CCeeEEEe-cceeEEEC
Q psy11263         50 RNKWKFYL-KDGIMNLN   65 (80)
Q Consensus        50 KnKWKc~L-KdGim~in   65 (80)
                      ..+=++.| +|||++|.
T Consensus        67 ~~~i~A~~~~dGvL~I~   83 (86)
T cd06497          67 QSAITCSLSADGMLTFS   83 (86)
T ss_pred             hHHeEEEeCCCCEEEEE
Confidence            44678999 89999984


No 28 
>cd06471 ACD_LpsHSP_like Group of bacterial proteins containing an alpha crystallin domain (ACD) similar to Lactobacillus plantarum (Lp) small heat shock proteins (sHsp) HSP 18.5, HSP 18.55 and HSP 19.3. sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. Transcription of the genes encoding Lp HSP 18.5, 18.55 and 19.3 is regulated by a variety of stresses including heat, cold and ethanol. Early growing L. plantarum cells contain elevated levels of these mRNAs which rapidly fall of as the cells enter stationary phase. Also belonging to this group is Bifidobacterium breve (Bb) HSP20 and Oenococcus oenis (syn. Leuconostoc oenos) (Oo) HSP18.  Transcription of the gene encoding BbHSP20 is strongly induced following heat or osmotic shock, and that of the gene encoding OoHSP18 following heat, ethanol or acid shock. OoHSP18 is peripherally associated with the cytoplasmic me
Probab=33.23  E-value=34  Score=21.06  Aligned_cols=13  Identities=15%  Similarity=0.455  Sum_probs=10.9

Q ss_pred             eeEEEecceeEEE
Q psy11263         52 KWKFYLKDGIMNL   64 (80)
Q Consensus        52 KWKc~LKdGim~i   64 (80)
                      +=+..|+|||++|
T Consensus        77 ~i~A~~~dGvL~I   89 (93)
T cd06471          77 EIKAKYENGVLKI   89 (93)
T ss_pred             HCEEEEECCEEEE
Confidence            4578889999987


No 29 
>PRK01379 cyaY frataxin-like protein; Provisional
Probab=32.92  E-value=46  Score=22.42  Aligned_cols=15  Identities=40%  Similarity=0.696  Sum_probs=8.0

Q ss_pred             cceeEEE---CCeeeEeee
Q psy11263         58 KDGIMNL---NGKDFVFLK   73 (80)
Q Consensus        58 KdGim~i---ngkDyvF~k   73 (80)
                      -+|||+|   +|. ||.+|
T Consensus        35 ~~gVLtl~~~~gt-~VINk   52 (103)
T PRK01379         35 QGDILNLDTDKGI-YVINK   52 (103)
T ss_pred             cCCEEEEEeCCcE-EEEeC
Confidence            3455554   344 66665


No 30 
>KOG3259|consensus
Probab=32.83  E-value=17  Score=26.91  Aligned_cols=16  Identities=19%  Similarity=0.779  Sum_probs=14.9

Q ss_pred             CCeeeEeeeceeeeeC
Q psy11263         65 NGKDFVFLKANGDADW   80 (80)
Q Consensus        65 ngkDyvF~ka~GE~eW   80 (80)
                      .|+.|.|+..|++.+|
T Consensus        19 ~gr~YyfN~~T~~SqW   34 (163)
T KOG3259|consen   19 SGRPYYFNTETNESQW   34 (163)
T ss_pred             CCCcceeccccchhhc
Confidence            6899999999999988


No 31 
>CHL00114 psbX photosystem II protein X; Reviewed
Probab=32.78  E-value=27  Score=20.37  Aligned_cols=12  Identities=42%  Similarity=0.609  Sum_probs=10.1

Q ss_pred             EEEEEEeeeeec
Q psy11263         38 IVVCQYDKITRS   49 (80)
Q Consensus        38 vilC~ydKV~R~   49 (80)
                      +.+.|-|||+|+
T Consensus        28 ifvSq~D~v~R~   39 (39)
T CHL00114         28 LFVSQKDRTTRN   39 (39)
T ss_pred             EEEeccceeccC
Confidence            678899999984


No 32 
>PF10974 DUF2804:  Protein of unknown function (DUF2804);  InterPro: IPR021243  This is a family of proteins with unknown function. 
Probab=32.07  E-value=81  Score=24.29  Aligned_cols=43  Identities=26%  Similarity=0.435  Sum_probs=29.5

Q ss_pred             CCCCEEEEEEeeeeecCCeeEEEec------ceeEEECCeeeEee--eceeeeeC
Q psy11263         34 DTDNIVVCQYDKITRSRNKWKFYLK------DGIMNLNGKDFVFL--KANGDADW   80 (80)
Q Consensus        34 ~~~nvilC~ydKV~R~KnKWKc~LK------dGim~ingkDyvF~--ka~GE~eW   80 (80)
                      ..+.+.+|.==.    .++|-.+-|      .|.|.++|+.|.|+  .+.|=+.|
T Consensus       147 ~~e~L~vv~P~~----~~~f~yt~K~~~~pv~G~v~~g~~~~~~~~~~~~a~lD~  197 (333)
T PF10974_consen  147 GHEPLNVVTPWG----ENRFYYTQKQNGLPVSGSVRLGGKEYSFDPENAFAVLDW  197 (333)
T ss_pred             CCCCEEEEeecC----CCCEEEEEEecCcceEEEEEECCEEEecCCCCcEEEEEc
Confidence            445566654322    344666666      49999999999999  67776665


No 33 
>PF14249 Tocopherol_cycl:  Tocopherol cyclase
Probab=31.36  E-value=46  Score=26.65  Aligned_cols=21  Identities=29%  Similarity=0.531  Sum_probs=18.4

Q ss_pred             ceeEEECCeeeEeeeceeeee
Q psy11263         59 DGIMNLNGKDFVFLKANGDAD   79 (80)
Q Consensus        59 dGim~ingkDyvF~ka~GE~e   79 (80)
                      .|-+.+||+.|-|..+.|-.|
T Consensus       169 sG~i~~nG~~~~F~~g~gY~E  189 (336)
T PF14249_consen  169 SGWIEWNGKRYDFTGGPGYIE  189 (336)
T ss_pred             EEEEEECCEEEEECCCceeec
Confidence            488899999999999988665


No 34 
>PF06079 Apyrase:  Apyrase;  InterPro: IPR009283 This family consists of several eukaryotic apyrase (or adenosine diphosphatase) proteins (3.6.1.5 from EC), and related nucleoside diphosphatases (3.6.1.6 from EC). The salivary apyrases of blood-feeding arthropods are nucleotide hydrolysing enzymes implicated in the inhibition of host platelet aggregation through the hydrolysis of extracellular adenosine diphosphate [].; GO: 0005509 calcium ion binding, 0016462 pyrophosphatase activity; PDB: 2H2N_A 1S18_A 2H2U_A 1S1D_B.
Probab=30.61  E-value=36  Score=27.04  Aligned_cols=21  Identities=33%  Similarity=0.975  Sum_probs=16.4

Q ss_pred             cCCeeEEEecceeEEECCeee
Q psy11263         49 SRNKWKFYLKDGIMNLNGKDF   69 (80)
Q Consensus        49 ~KnKWKc~LKdGim~ingkDy   69 (80)
                      .++.|++.||-|.+++++.-+
T Consensus        10 ~~~~w~S~~~~G~L~~~~~~~   30 (291)
T PF06079_consen   10 DKNTWRSYLKKGYLTFSGDKY   30 (291)
T ss_dssp             -TT-EEEEEEEEEEEEETTSS
T ss_pred             CCCcEEEEEEEeEEEECCCcc
Confidence            358899999999999988654


No 35 
>PRK00446 cyaY frataxin-like protein; Provisional
Probab=30.38  E-value=55  Score=21.91  Aligned_cols=21  Identities=19%  Similarity=0.457  Sum_probs=14.7

Q ss_pred             EEecceeEEE---CCeeeEeeece
Q psy11263         55 FYLKDGIMNL---NGKDFVFLKAN   75 (80)
Q Consensus        55 c~LKdGim~i---ngkDyvF~ka~   75 (80)
                      |.+.+||++|   ||.-||.+|-+
T Consensus        31 ~e~~~gVLti~f~~~~~~VINkQ~   54 (105)
T PRK00446         31 CERNGGVLTLTFENGSKIIINRQE   54 (105)
T ss_pred             eeccCCEEEEEECCCCEEEEeCCC
Confidence            5556788877   47778888743


No 36 
>PF09943 DUF2175:  Uncharacterized protein conserved in archaea (DUF2175);  InterPro: IPR018686  This family of various hypothetical archaeal proteins has no known function. 
Probab=29.57  E-value=54  Score=22.40  Aligned_cols=25  Identities=36%  Similarity=0.707  Sum_probs=19.3

Q ss_pred             eeEEEecceeEEECCeeeEeeeceeee
Q psy11263         52 KWKFYLKDGIMNLNGKDFVFLKANGDA   78 (80)
Q Consensus        52 KWKc~LKdGim~ingkDyvF~ka~GE~   78 (80)
                      ||||.+..+=+ +.|.-|-|.+- |-.
T Consensus         2 kWkC~iCg~~I-~~gqlFTF~~k-G~V   26 (101)
T PF09943_consen    2 KWKCYICGKPI-YEGQLFTFTKK-GPV   26 (101)
T ss_pred             ceEEEecCCee-eecceEEEecC-CcE
Confidence            89999988765 57788888776 543


No 37 
>TIGR03422 mito_frataxin frataxin. Frataxin is a mitochondrial protein, mutation of which leads to the disease Friedreich's ataxia. Its orthologs are widely distributed in the bacteria, associated with the ISC system for iron-sulfur cluster assembly, and designated CyaY. This exception-type model allows those examples of frataxin per se that score above the trusted cutoff to the CyaY equivalog-type model (TIGR03421) to be named appropriately.
Probab=28.52  E-value=42  Score=22.18  Aligned_cols=21  Identities=19%  Similarity=0.343  Sum_probs=14.7

Q ss_pred             EEEecceeEEEC---CeeeEeeec
Q psy11263         54 KFYLKDGIMNLN---GKDFVFLKA   74 (80)
Q Consensus        54 Kc~LKdGim~in---gkDyvF~ka   74 (80)
                      -|.+.+|||+|.   |.-||++|-
T Consensus        30 D~e~~~gVLti~~~~~~~~VINkQ   53 (97)
T TIGR03422        30 DVEYSSGVLTLELPSVGTYVINKQ   53 (97)
T ss_pred             ccccCCCEEEEEECCCCEEEEeCC
Confidence            345567888874   668888874


No 38 
>PHA02095 hypothetical protein
Probab=28.09  E-value=59  Score=21.63  Aligned_cols=19  Identities=32%  Similarity=0.784  Sum_probs=16.8

Q ss_pred             cCCeeEEEecceeEEECCe
Q psy11263         49 SRNKWKFYLKDGIMNLNGK   67 (80)
Q Consensus        49 ~KnKWKc~LKdGim~ingk   67 (80)
                      ..+.|.|.--|||++|.|-
T Consensus        31 ~ng~wefsrvdgilciegd   49 (84)
T PHA02095         31 ENGSWEFSRVDGILCIEGD   49 (84)
T ss_pred             ecCcEEEEeccEEEEecCC
Confidence            3778999999999999884


No 39 
>PF14864 Alkyl_sulf_C:  Alkyl sulfatase C-terminal; PDB: 2CG2_A 2CG3_A 2CFU_A 2CFZ_A 2YHE_C.
Probab=28.03  E-value=48  Score=21.81  Aligned_cols=19  Identities=21%  Similarity=0.611  Sum_probs=15.7

Q ss_pred             eeecCCeeEEEecceeEEE
Q psy11263         46 ITRSRNKWKFYLKDGIMNL   64 (80)
Q Consensus        46 V~R~KnKWKc~LKdGim~i   64 (80)
                      +.-++-+|.+.|++||++.
T Consensus        40 ~~D~~e~~~l~l~NgvL~~   58 (125)
T PF14864_consen   40 FTDTGEQYTLELRNGVLNY   58 (125)
T ss_dssp             ETTTTEEEEEEEETTEEEE
T ss_pred             EcCCCCeEEEEEECCEEEe
Confidence            3445679999999999998


No 40 
>PF11008 DUF2846:  Protein of unknown function (DUF2846);  InterPro: IPR022548  Some members in this group of proteins with unknown function are annotated as lipoproteins. However this cannot be confirmed. 
Probab=27.37  E-value=78  Score=20.56  Aligned_cols=39  Identities=15%  Similarity=0.236  Sum_probs=28.4

Q ss_pred             CCEEEEEEeeeeecCCeeEEEecceeEEECCeeeEeeeceeeeeC
Q psy11263         36 DNIVVCQYDKITRSRNKWKFYLKDGIMNLNGKDFVFLKANGDADW   80 (80)
Q Consensus        36 ~nvilC~ydKV~R~KnKWKc~LKdGim~ingkDyvF~ka~GE~eW   80 (80)
                      ++-.|..|    |.++.|-..++--| .|||+ +++..++|.|.|
T Consensus        24 ~~a~IYvY----R~~~~~g~~~~~~v-~vdg~-~ig~l~~g~y~~   62 (117)
T PF11008_consen   24 GKARIYVY----RPSSFFGSAVKPDV-YVDGE-LIGELKNGGYFY   62 (117)
T ss_pred             CcEEEEEE----EECCccCccccceE-EECCE-EEEEeCCCeEEE
Confidence            56777777    88888876555555 88884 567777777754


No 41 
>cd06479 ACD_HspB7_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB7, also known as cardiovascular small heat shock protein (cvHsp), and similar proteins. sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. HspB7 is a 25-kDa protein, preferentially expressed in heart and skeletal muscle. It binds the cytoskeleton protein alpha-filamin (also known as actin-binding protein 280). The expression of HspB7 is increased during rat muscle aging.  Its expression is also modulated in obesity implicating this protein in this and related metabolic disorders. As the human gene encoding HspB7 is mapped to chromosome 1p36.23-p34.3 it is a positional candidate for several dystrophies and myopathies.
Probab=27.05  E-value=50  Score=20.82  Aligned_cols=14  Identities=21%  Similarity=0.375  Sum_probs=10.6

Q ss_pred             eeEEEe-cceeEEEC
Q psy11263         52 KWKFYL-KDGIMNLN   65 (80)
Q Consensus        52 KWKc~L-KdGim~in   65 (80)
                      +=++.| ++|||+|.
T Consensus        64 ~v~A~l~~~GvL~I~   78 (81)
T cd06479          64 SVSSSLGEDGTLTIK   78 (81)
T ss_pred             HeEEEecCCCEEEEE
Confidence            456676 99999984


No 42 
>PF07873 YabP:  YabP family;  InterPro: IPR022476 Members of this protein family are the YabP and YqfC proteins of the bacterial sporulation program, as found in Bacillus subtilis, Clostridium tetani, and other spore-forming members of the Firmicutes. ; PDB: 2KYI_B 3IPF_B 2KS0_A.
Probab=26.63  E-value=77  Score=19.07  Aligned_cols=28  Identities=18%  Similarity=0.310  Sum_probs=22.8

Q ss_pred             cCCeeEEEecceeEEECCeeeEeeecee
Q psy11263         49 SRNKWKFYLKDGIMNLNGKDFVFLKANG   76 (80)
Q Consensus        49 ~KnKWKc~LKdGim~ingkDyvF~ka~G   76 (80)
                      +-++=++..+.|.+.|.|++..-...+.
T Consensus        24 ~~~~I~l~t~~g~l~I~G~~L~I~~l~~   51 (66)
T PF07873_consen   24 DDEEIRLNTKKGKLTIKGEGLVIKYLNL   51 (66)
T ss_dssp             ETTEEEEEETTEEEEEEEEEEEEEECET
T ss_pred             CCCEEEEEeCCEEEEEECceEEEeEeec
Confidence            3567788999999999999988776554


No 43 
>PF06097 DUF945:  Bacterial protein of unknown function (DUF945);  InterPro: IPR010352 This entry consists of several hypothetical bacterial proteins of unknown function.
Probab=26.49  E-value=55  Score=25.15  Aligned_cols=17  Identities=35%  Similarity=0.653  Sum_probs=14.6

Q ss_pred             EEEecceeEEECCeeeE
Q psy11263         54 KFYLKDGIMNLNGKDFV   70 (80)
Q Consensus        54 Kc~LKdGim~ingkDyv   70 (80)
                      .+.+++|-+.||||.+.
T Consensus       440 ~~~~~~g~l~lNG~~ip  456 (460)
T PF06097_consen  440 ELQLKNGQLTLNGQPIP  456 (460)
T ss_pred             EEEEECCEEEECCeECc
Confidence            46789999999999874


No 44 
>PF13738 Pyr_redox_3:  Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A ....
Probab=26.27  E-value=1.1e+02  Score=20.26  Aligned_cols=20  Identities=20%  Similarity=0.602  Sum_probs=16.9

Q ss_pred             EEEeeeeecCCeeEEEecce
Q psy11263         41 CQYDKITRSRNKWKFYLKDG   60 (80)
Q Consensus        41 C~ydKV~R~KnKWKc~LKdG   60 (80)
                      +...+|.|..++|.+++++|
T Consensus       103 ~~V~~v~~~~~~w~v~~~~~  122 (203)
T PF13738_consen  103 TRVESVRRDGDGWTVTTRDG  122 (203)
T ss_dssp             --EEEEEEETTTEEEEETTS
T ss_pred             CEEEEEEEeccEEEEEEEec
Confidence            66789999999999999999


No 45 
>PF00011 HSP20:  Hsp20/alpha crystallin family This prints entry is a subset of the Pfam entry.;  InterPro: IPR002068 Prokaryotic and eukaryotic organisms respond to heat shock or other environmental stress by inducing the synthesis of proteins collectively known as heat-shock proteins (hsp) []. Amongst them is a family of proteins with an average molecular weight of 20 Kd, known as the hsp20 proteins []. These seem to act as chaperones that can protect other proteins against heat-induced denaturation and aggregation. Hsp20 proteins seem to form large heterooligomeric aggregates. Structurally, this family is characterised by the presence of a conserved C-terminal domain of about 100 residues.; PDB: 2BOL_B 3N3E_B 2H50_P 2H53_F 2BYU_L 1GME_D 3VQM_J 3VQK_E 3VQL_A 3AAC_A ....
Probab=25.65  E-value=57  Score=20.03  Aligned_cols=24  Identities=17%  Similarity=0.450  Sum_probs=14.9

Q ss_pred             EEeeeeec-----CCeeEEEecceeEEEC
Q psy11263         42 QYDKITRS-----RNKWKFYLKDGIMNLN   65 (80)
Q Consensus        42 ~ydKV~R~-----KnKWKc~LKdGim~in   65 (80)
                      .|.+.-+-     -++=++.+++|+|+|.
T Consensus        56 ~f~r~~~lP~~vd~~~i~a~~~~GvL~I~   84 (102)
T PF00011_consen   56 SFERSIRLPEDVDPDKIKASYENGVLTIT   84 (102)
T ss_dssp             EEEEEEE-STTB-GGG-EEEETTSEEEEE
T ss_pred             eEEEEEcCCCcCCcceEEEEecCCEEEEE
Confidence            45554443     3455788899999883


No 46 
>smart00400 ZnF_CHCC zinc finger.
Probab=25.62  E-value=53  Score=18.81  Aligned_cols=13  Identities=0%  Similarity=0.220  Sum_probs=9.7

Q ss_pred             eeeecCCeeEEEe
Q psy11263         45 KITRSRNKWKFYL   57 (80)
Q Consensus        45 KV~R~KnKWKc~L   57 (80)
                      +|...||.|+|-=
T Consensus        16 ~v~~~kn~~~Cf~   28 (55)
T smart00400       16 SVSPDKQFFHCFG   28 (55)
T ss_pred             EEECCCCEEEEeC
Confidence            4566789999974


No 47 
>COG3250 LacZ Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism]
Probab=24.61  E-value=1.2e+02  Score=27.01  Aligned_cols=31  Identities=23%  Similarity=0.250  Sum_probs=24.1

Q ss_pred             eeeecCCeeEEEecceeEEECCeeeEeeece
Q psy11263         45 KITRSRNKWKFYLKDGIMNLNGKDFVFLKAN   75 (80)
Q Consensus        45 KV~R~KnKWKc~LKdGim~ingkDyvF~ka~   75 (80)
                      .+.+.=+=.++.+++|.+.||||..+|.-++
T Consensus       276 ~~~~~iGfR~iei~~~~~~iNGkpvf~kGvn  306 (808)
T COG3250         276 AEALRIGFRTVEIKDGLLLINGKPVFIRGVN  306 (808)
T ss_pred             EEEeeeccEEEEEECCeEEECCeEEEEeeee
Confidence            4444445678999999999999999886543


No 48 
>PF04076 BOF:  Bacterial OB fold (BOF) protein;  InterPro: IPR005220 Proteins in this entry have an OB-fold fold (oligonucleotide/oligosaccharide binding motif). Analysis of the predicted nucleotide-binding site of the OB-fold suggests that they lack nucleic acid-binding properties. They contain an predicted N-terminal signal peptide which indicates that they localise to the periplasm where they may function to bind proteins, small molecules, or other typical OB-fold ligands. As hypothesised for the distantly related OB-fold containing bacterial enterotoxins, the loss of nucleotide-binding function and the rapid evolution of the OB-fold ligand-binding site may be associated with the presence of members in mobile genetic elements and their potential role in bacterial pathogenicity [].; PDB: 1NNX_A.
Probab=24.30  E-value=56  Score=21.82  Aligned_cols=26  Identities=23%  Similarity=0.532  Sum_probs=19.8

Q ss_pred             EEEecceeE-EECCeeeEeeeceeeee
Q psy11263         54 KFYLKDGIM-NLNGKDFVFLKANGDAD   79 (80)
Q Consensus        54 Kc~LKdGim-~ingkDyvF~ka~GE~e   79 (80)
                      .++|..=|+ +|++-.|+|.=+||+..
T Consensus        36 ~V~L~G~Iv~~l~~d~Y~F~D~TG~I~   62 (103)
T PF04076_consen   36 PVTLEGNIVKQLGDDKYLFRDATGEIE   62 (103)
T ss_dssp             EEEEEEEEEEEEETTEEEEEETTEEEE
T ss_pred             eEEEEEEEEEEecCCEEEEECCCCcEE
Confidence            456665544 68889999999999864


No 49 
>COG1965 CyaY Protein implicated in iron transport, frataxin homolog [Inorganic ion transport and metabolism]
Probab=24.23  E-value=79  Score=21.81  Aligned_cols=20  Identities=25%  Similarity=0.574  Sum_probs=12.8

Q ss_pred             EEecceeEEE---CCeeeEeeec
Q psy11263         55 FYLKDGIMNL---NGKDFVFLKA   74 (80)
Q Consensus        55 c~LKdGim~i---ngkDyvF~ka   74 (80)
                      |-+.+|||+|   ||--|+++|-
T Consensus        32 ~d~qg~VlTl~f~ngs~iiINkQ   54 (106)
T COG1965          32 CEIQGGVLTLTFDNGSQIIINKQ   54 (106)
T ss_pred             eecCCCEEEEEECCCcEEEEeCC
Confidence            3445777776   5667777764


No 50 
>cd06472 ACD_ScHsp26_like Alpha crystallin domain (ACD) found in Saccharomyces cerevisiae (Sc) small heat shock protein (Hsp)26 and similar proteins. sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. ScHsp26 is temperature-regulated, it switches from an inactive to a chaperone-active form upon elevation in temperature. It associates into large 24-mers storage forms which upon heat shock disassociate into dimers. These dimers initiate the interaction with non-native substrate proteins and re-assemble into large globular assemblies having one monomer of substrate bound per dimer. This group also contains Arabidopsis thaliana (Ath) Hsp15.7, a peroxisomal matrix protein which can complement the morphological phenotype of S. cerevisiae mutants deficient in Hsps26. AthHsp15.7 is minimally expressed under normal conditions and is strongly induced by heat and oxidative st
Probab=24.16  E-value=60  Score=20.04  Aligned_cols=13  Identities=23%  Similarity=0.687  Sum_probs=10.3

Q ss_pred             eeEEEecceeEEE
Q psy11263         52 KWKFYLKDGIMNL   64 (80)
Q Consensus        52 KWKc~LKdGim~i   64 (80)
                      +=+..|+|||++|
T Consensus        76 ~i~A~~~nGvL~I   88 (92)
T cd06472          76 EVKAFLENGVLTV   88 (92)
T ss_pred             HCEEEEECCEEEE
Confidence            4467889999987


No 51 
>PF14527 LAGLIDADG_WhiA:  WhiA LAGLIDADG-like domain; PDB: 3HYI_A 3HYJ_D.
Probab=23.90  E-value=65  Score=20.76  Aligned_cols=16  Identities=50%  Similarity=0.862  Sum_probs=12.0

Q ss_pred             eeeecCCeeEEEecce
Q psy11263         45 KITRSRNKWKFYLKDG   60 (80)
Q Consensus        45 KV~R~KnKWKc~LKdG   60 (80)
                      |+.+.|+++.+++|++
T Consensus        49 k~~~r~~~~~vYlK~~   64 (93)
T PF14527_consen   49 KIIKRKNKYVVYLKDS   64 (93)
T ss_dssp             EEEEESSEEEEEE--H
T ss_pred             eeeeecCceEEEEcCH
Confidence            6778899999999985


No 52 
>PF12276 DUF3617:  Protein of unknown function (DUF3617);  InterPro: IPR022061  This family of proteins is found in bacteria. Proteins in this family are typically between 155 and 179 amino acids in length. There is a single completely conserved residue C that may be functionally important. 
Probab=23.41  E-value=66  Score=21.57  Aligned_cols=21  Identities=24%  Similarity=0.476  Sum_probs=17.5

Q ss_pred             CEEEEEEeeeeecCCeeEEEe
Q psy11263         37 NIVVCQYDKITRSRNKWKFYL   57 (80)
Q Consensus        37 nvilC~ydKV~R~KnKWKc~L   57 (80)
                      +--=|.|..+.|+.++|++.+
T Consensus        89 ~~~~C~~~~~~~~~~~~~~~~  109 (162)
T PF12276_consen   89 ENQDCTYTDVSRSGGTVTFTM  109 (162)
T ss_pred             CCCCCCEeeEEEeCCEEEEEE
Confidence            333499999999999998887


No 53 
>cd06478 ACD_HspB4-5-6 Alpha-crystallin domain found in alphaA-crystallin (HspB4), alphaB-crystallin (HspB5), and the small heat shock protein (sHsp) HspB6, also known as Hsp20. sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. Alpha crystallin, an abundant protein in the mammalian lens, is a large (700 kDa) heteropolymer composed of HspB4 and HspB5, generally in a molar ratio of HspB4:HspB5 of 3:1.  Only trace amounts of HspB4 are found in tissues other than the lens. HspB5 on the other hand is also expressed constitutively in other tissues including brain, heart, and type I and type IIa skeletal muscle fibers, and in several cancers including gliomas, renal cell carcinomas, basal-like and metaplastic breast carcinomas, and head and neck cancer.  HspB5's functions include effects on the apoptotic pathway and on metastasis.  Phosphorylation of HspB5 reduces its ol
Probab=22.89  E-value=68  Score=19.88  Aligned_cols=15  Identities=20%  Similarity=0.399  Sum_probs=11.4

Q ss_pred             CeeEEEe-cceeEEEC
Q psy11263         51 NKWKFYL-KDGIMNLN   65 (80)
Q Consensus        51 nKWKc~L-KdGim~in   65 (80)
                      .+=++.| +|||++|.
T Consensus        65 ~~i~A~~~~dGvL~I~   80 (83)
T cd06478          65 AAITSSLSADGVLTIS   80 (83)
T ss_pred             HHeEEEECCCCEEEEE
Confidence            3567888 69999874


No 54 
>PF00070 Pyr_redox:  Pyridine nucleotide-disulphide oxidoreductase;  InterPro: IPR001327  FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ]. Comparison of the crystal structures of human glutathione reductase and Escherichia coli thioredoxin reductase reveals different locations of their active sites, suggesting that the enzymes diverged from an ancestral FAD/NAD(P)H reductase and acquired their disulphide reductase activities independently [].   Despite functional similarities, oxidoreductases of this family show no sequence similarity with adrenodoxin reductases [] and flavoprotein pyridine nucleotide cytochrome reductases (FPNCR) []. Assuming that disulphide reductase activity emerged later, during divergent evolution, the family can be referred to as FAD-dependent pyridine nucleotide reductases, FADPNR. To date, 3D structures of glutathione reductase [], thioredoxin reductase [], mercuric reductase [], lipoamide dehydrogenase [], trypanothione reductase [] and NADH peroxidase [] have been solved. The enzymes share similar tertiary structures based on a doubly-wound alpha/beta fold, but the relative orientations of their FAD- and NAD(P)H-binding domains may vary significantly. By contrast with the FPNCR family, the folds of the FAD- and NAD(P)H-binding domains are similar, suggesting that the domains evolved by gene duplication [].  This entry describes a small NADH binding domain within a larger FAD binding domain described by IPR023753 from INTERPRO. It is found in both class I and class II oxidoreductases. ; GO: 0016491 oxidoreductase activity, 0050660 flavin adenine dinucleotide binding, 0055114 oxidation-reduction process; PDB: 1ZKQ_A 3DGZ_A 1ZDL_A 2R9Z_B 2RAB_A 2A87_B 1M6I_A 2YVG_A 2GR1_A 2GQW_A ....
Probab=22.89  E-value=1.2e+02  Score=17.87  Aligned_cols=21  Identities=19%  Similarity=0.317  Sum_probs=16.2

Q ss_pred             EEEEeeeeecCCeeEEEecce
Q psy11263         40 VCQYDKITRSRNKWKFYLKDG   60 (80)
Q Consensus        40 lC~ydKV~R~KnKWKc~LKdG   60 (80)
                      -|+..+|....++.+++|+||
T Consensus        60 ~~~v~~i~~~~~~~~V~~~~g   80 (80)
T PF00070_consen   60 NTKVKEIEKDGDGVEVTLEDG   80 (80)
T ss_dssp             SEEEEEEEEETTSEEEEEETS
T ss_pred             CCEEEEEEEeCCEEEEEEecC
Confidence            366777777777777999987


No 55 
>cd06464 ACD_sHsps-like Alpha-crystallin domain (ACD) of alpha-crystallin-type small(s) heat shock proteins (Hsps). sHsps are small stress induced proteins with monomeric masses between 12 -43 kDa, whose common feature is the Alpha-crystallin domain  (ACD). sHsps are generally active as large oligomers consisting of multiple subunits, and are believed to be ATP-independent chaperones that prevent aggregation and are important in refolding in combination with other Hsps.
Probab=22.71  E-value=70  Score=18.48  Aligned_cols=13  Identities=31%  Similarity=0.606  Sum_probs=9.7

Q ss_pred             eeEEEecceeEEE
Q psy11263         52 KWKFYLKDGIMNL   64 (80)
Q Consensus        52 KWKc~LKdGim~i   64 (80)
                      +=++.+++|++.|
T Consensus        72 ~i~a~~~~G~L~I   84 (88)
T cd06464          72 KIKASLENGVLTI   84 (88)
T ss_pred             HcEEEEeCCEEEE
Confidence            4567788888887


No 56 
>COG0071 IbpA Molecular chaperone (small heat shock protein) [Posttranslational modification, protein turnover, chaperones]
Probab=22.29  E-value=61  Score=21.89  Aligned_cols=13  Identities=23%  Similarity=0.391  Sum_probs=11.3

Q ss_pred             eeEEEecceeEEE
Q psy11263         52 KWKFYLKDGIMNL   64 (80)
Q Consensus        52 KWKc~LKdGim~i   64 (80)
                      +=+..|++||++|
T Consensus       116 ~~~A~~~nGvL~I  128 (146)
T COG0071         116 VIKAKYKNGLLTV  128 (146)
T ss_pred             ceeeEeeCcEEEE
Confidence            4678999999998


No 57 
>PF03941 INCENP_ARK-bind:  Inner centromere protein, ARK binding region;  InterPro: IPR005635 This region of the inner centromere protein has been found to be necessary and sufficient for binding to aurora-related kinase. This interaction has been implicated in the coordination of chromosome segregation with cell division in yeast [].; PDB: 2BFX_C 2BFY_C 3ZTX_D 2VGO_D 2VGP_D 2VRX_D 4AF3_D.
Probab=22.02  E-value=30  Score=20.53  Aligned_cols=12  Identities=42%  Similarity=0.689  Sum_probs=0.0

Q ss_pred             CCCCCCCCCCCC
Q psy11263         18 PLNSSDDVSEED   29 (80)
Q Consensus        18 ~lnSddD~sd~d   29 (80)
                      +|+||+++++++
T Consensus         1 ei~SD~eddd~~   12 (57)
T PF03941_consen    1 EINSDDEDDDED   12 (57)
T ss_dssp             ------------
T ss_pred             CCCCcccccccc
Confidence            367776555443


No 58 
>cd00503 Frataxin Frataxin is a nuclear-encoded mitochondrial protein implicated in Friedreich's ataxia (FRDA), an human autosomal recessive neurodegenerative disease; Frataxin is found in eukaryotes and in purple bacteria; lack of frataxin causes iron to accumulate in the mitochondrial matrix suggesting that frataxin is involved in mitochondrial iron homeostasis and possibly in iron transport; the domain has an alpha-beta fold consisting of two helices flanking an antiparallel beta sheet.
Probab=21.96  E-value=82  Score=20.90  Aligned_cols=21  Identities=19%  Similarity=0.434  Sum_probs=14.4

Q ss_pred             EEEecceeEEEC---CeeeEeeec
Q psy11263         54 KFYLKDGIMNLN---GKDFVFLKA   74 (80)
Q Consensus        54 Kc~LKdGim~in---gkDyvF~ka   74 (80)
                      -|.+.+|||+|.   |.-||++|-
T Consensus        31 D~e~~~gVLti~f~~~~~~VINkQ   54 (105)
T cd00503          31 DVETQGGVLTLTFGNGSTIVINRQ   54 (105)
T ss_pred             eeeccCCEEEEEECCCCEEEEeCC
Confidence            355567777773   777888774


No 59 
>PF15603 Imm45:  Immunity protein 45
Probab=21.90  E-value=1.5e+02  Score=19.23  Aligned_cols=23  Identities=35%  Similarity=0.505  Sum_probs=17.9

Q ss_pred             eeeecCCeeEEEecce-eEEECCe
Q psy11263         45 KITRSRNKWKFYLKDG-IMNLNGK   67 (80)
Q Consensus        45 KV~R~KnKWKc~LKdG-im~ingk   67 (80)
                      |++++.+.=++.|.+| ++.+.|.
T Consensus         2 ki~~t~s~i~~el~~G~~~~~~GE   25 (82)
T PF15603_consen    2 KITGTRSYITFELEEGARRKAQGE   25 (82)
T ss_pred             EEEecCCceEEEecCCEEEEEeee
Confidence            7889999999999988 5555443


No 60 
>cd06498 ACD_alphaB-crystallin_HspB5 Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaB-crystallin (HspB5, 20kDa). sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. Alpha crystallin, an abundant protein in the mammalian lens, is a large (700 kDa) heteropolymer composed of HspB4 and HspB5, generally in a molar ratio of HspB4:HspB5 of 3:1.  HspB4 does not belong to this group. HspB5 shows increased synthesis in response to stress. HspB5 is also expressed constitutively in other tissues including brain, heart, and type I and type IIa skeletal muscle fibers, and in several cancers including gliomas, renal cell carcinomas, basal-like and metaplastic breast carcinomas, and head and neck cancer.  Its functions include effects on the apoptotic pathway and on metastasis.  Phosphorylation of HspB5 reduces its oligomerization and anti-apoptotic activ
Probab=21.62  E-value=74  Score=19.91  Aligned_cols=16  Identities=19%  Similarity=0.243  Sum_probs=12.1

Q ss_pred             CCeeEEEec-ceeEEEC
Q psy11263         50 RNKWKFYLK-DGIMNLN   65 (80)
Q Consensus        50 KnKWKc~LK-dGim~in   65 (80)
                      ..+=++.|+ |||++|.
T Consensus        64 ~~~i~A~~~~dGvL~I~   80 (84)
T cd06498          64 PLTITSSLSPDGVLTVC   80 (84)
T ss_pred             hHHcEEEeCCCCEEEEE
Confidence            346788895 9999874


No 61 
>cd06476 ACD_HspB2_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB2/heat shock 27kDa protein 2 and similar proteins. sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits.  HspB2 is preferentially and constitutively expressed in skeletal muscle and heart. HspB2 shows homooligomeric activity and forms aggregates in muscle cytosol. Although its expression is not induced by heat shock, it redistributes to the insoluble fraction in response to heat shock. In the mouse heart, HspB2 plays a role in maintaining energetic balance, by protecting cardiac energetics during ischemia/reperfusion, and allowing  for increased work during acute inotropic challenge. hHspB2 [previously also known as myotonic dystrophy protein kinase (DMPK) binding protein (MKBP)]  is selectively up-regulated in skeletal muscles from myotonic dystrophy patients.
Probab=20.93  E-value=77  Score=19.90  Aligned_cols=15  Identities=27%  Similarity=0.328  Sum_probs=11.9

Q ss_pred             CeeEEEec-ceeEEEC
Q psy11263         51 NKWKFYLK-DGIMNLN   65 (80)
Q Consensus        51 nKWKc~LK-dGim~in   65 (80)
                      .+=+..|. |||++|.
T Consensus        65 ~~v~A~~~~dGvL~I~   80 (83)
T cd06476          65 LLVRASLSHDGILCIQ   80 (83)
T ss_pred             hhEEEEecCCCEEEEE
Confidence            46788895 9999883


No 62 
>PF04985 Phage_tube:  Phage tail tube protein FII;  InterPro: IPR006498 This entry is represented by Bacteriophage P2, FII, the major tail tube protein. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.  The tails of some phage are contractile. These sequences represent the tail tube, or tail core, protein of the contractile tail of phage P2, and homologous proteins from other phage. 
Probab=20.89  E-value=2.5e+02  Score=19.28  Aligned_cols=38  Identities=18%  Similarity=0.196  Sum_probs=30.1

Q ss_pred             CCCCCEEEEEEeeeeec-CCeeEEEecceeEEECCeeeE
Q psy11263         33 FDTDNIVVCQYDKITRS-RNKWKFYLKDGIMNLNGKDFV   70 (80)
Q Consensus        33 ~~~~nvilC~ydKV~R~-KnKWKc~LKdGim~ingkDyv   70 (80)
                      .+++.-+=|.|=|.... +-.+.+-..+.|..|||.|++
T Consensus       120 ~~~~~~~~v~yyk~~idG~~~~eiD~~n~i~~vnGvD~l  158 (167)
T PF04985_consen  120 TETSIEFSVTYYKLEIDGKEIIEIDKLNNIYRVNGVDQL  158 (167)
T ss_pred             ccceEEEEEEEEEEEECCEEEEEEECccCEEEECCEEhh
Confidence            45666677888777765 557999999999999999984


No 63 
>smart00564 PQQ beta-propeller repeat. Beta-propeller repeat occurring in enzymes with pyrrolo-quinoline quinone (PQQ) as cofactor, in Ire1p-like Ser/Thr kinases, and in prokaryotic dehydrogenases.
Probab=20.88  E-value=93  Score=15.15  Aligned_cols=17  Identities=18%  Similarity=0.495  Sum_probs=13.1

Q ss_pred             ECCeeeEeeeceeeeeC
Q psy11263         64 LNGKDFVFLKANGDADW   80 (80)
Q Consensus        64 ingkDyvF~ka~GE~eW   80 (80)
                      .+|+=|.++..+|+..|
T Consensus        14 ~~g~l~a~d~~~G~~~W   30 (33)
T smart00564       14 TDGTLYALDAKTGEILW   30 (33)
T ss_pred             CCCEEEEEEcccCcEEE
Confidence            35677888888888877


Done!