Diaphorina citri psyllid: psy11263


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80
MALIPTLAQVVCGIEDEPLNSSDDVSEEDPALFDTDNIVVCQYDKITRSRNKWKFYLKDGIMNLNGKDFVFLKANGDADW
cccccccccccccccccccccccccccccccccccccEEEEEEEEEEccccEEEEEEccEEEEEccEEEEEEEcEEEEcc
******************************ALFDTDNIVVCQYDKITRSRNKWKFYLKDGIMNLNGKDFVFLKANGDADW
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALIPTLAQVVCGIEDEPLNSSDDVSEEDPALFDTDNIVVCQYDKITRSRNKWKFYLKDGIMNLNGKDFVFLKANGDADW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transcription initiation factor IIA subunit 1 TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. TFIIA in a complex with TBP mediates transcriptional activity.confidentQ5RCU0
Transcription initiation factor IIA subunit 1 TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. TFIIA in a complex with TBP mediates transcriptional activity.confidentO08949
Transcription initiation factor IIA subunit 1 TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. TFIIA in a complex with tbp mediates transcriptional activity.confidentQ54G80

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005672 [CC]transcription factor TFIIA complexprobableGO:0030880, GO:0000428, GO:0031974, GO:0043229, GO:0016591, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0055029, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0005667, GO:0044424, GO:0044422
GO:0003677 [MF]DNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0046982 [MF]protein heterodimerization activityprobableGO:0046983, GO:0003674, GO:0005488, GO:0005515
GO:0017025 [MF]TBP-class protein bindingprobableGO:0008134, GO:0003674, GO:0005488, GO:0005515
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0001094 [MF]TFIID-class transcription factor bindingprobableGO:0001085, GO:0001091, GO:0008134, GO:0001098, GO:0001099, GO:0003674, GO:0005488, GO:0005515
GO:0006367 [BP]transcription initiation from RNA polymerase II promoterprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0006366, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0006352, GO:0019438
GO:0006368 [BP]transcription elongation from RNA polymerase II promoterprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0006366, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006354, GO:0006351, GO:0019438
GO:0001128 [MF]RNA polymerase II transcription coactivator activity involved in preinitiation complex assemblyprobableGO:0001190, GO:0003713, GO:0003712, GO:0001104, GO:0001105, GO:0001076, GO:0003674, GO:0000989, GO:0000988
GO:0001129 [MF]TBP-class protein binding RNA polymerase II transcription factor activity involved in preinitiation complex assemblyprobableGO:0001083, GO:0001076, GO:0001132, GO:0003674, GO:0000989, GO:0000988
GO:0001103 [MF]RNA polymerase II repressing transcription factor bindingprobableGO:0001085, GO:0008134, GO:0003674, GO:0005488, GO:0005515, GO:0070491
GO:0016032 [BP]viral reproductionprobableGO:0009987, GO:0044764, GO:0008150, GO:0051704

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1NVP, chain C
Confidence level:very confident
Coverage over the Query: 34-80
View the alignment between query and template
View the model in PyMOL