Query         psy11264
Match_columns 50
No_of_seqs    27 out of 29
Neff          2.4 
Searched_HMMs 46136
Date          Fri Aug 16 22:25:29 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy11264.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/11264hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1877|consensus               99.5 1.2E-14 2.6E-19  114.6   0.7   40    1-40     36-75  (819)
  2 PF06925 MGDG_synth:  Monogalac  65.8     7.6 0.00016   23.9   2.6   30   16-47     71-100 (169)
  3 PF13304 AAA_21:  AAA domain; P  64.4     9.6 0.00021   21.5   2.6   28   11-45    271-298 (303)
  4 cd00419 Ferrochelatase_C Ferro  63.1     5.9 0.00013   24.7   1.8   29   21-49      2-31  (135)
  5 PF15614 WHIM3:  WSTF, HB1, Itc  62.7     6.3 0.00014   22.1   1.7   35    7-41      2-43  (46)
  6 PF02773 S-AdoMet_synt_C:  S-ad  57.2      12 0.00026   25.0   2.6   24   10-33     34-57  (138)
  7 TIGR02957 SigX4 RNA polymerase  55.4     3.2   7E-05   27.8  -0.4   15    5-19    267-281 (281)
  8 PF11016 DUF2854:  Protein of u  50.5     8.7 0.00019   26.0   1.1   16   23-38     61-76  (147)
  9 TIGR02017 hutG_amidohyd N-form  49.6      28  0.0006   24.1   3.4   40    9-48    107-151 (263)
 10 PF13809 Tubulin_2:  Tubulin li  48.9      18 0.00039   25.3   2.5   25    7-33    320-344 (345)
 11 cd07365 MhpB_like Subunit B of  47.9      43 0.00093   23.9   4.3   40    7-47      6-55  (310)
 12 cd07359 PCA_45_Doxase_B_like S  47.2      49  0.0011   22.1   4.2   31   14-45     25-55  (271)
 13 PF15447 NTS:  N-terminal segme  46.1      12 0.00026   19.9   1.0   18   13-30      4-21  (37)
 14 PF07958 DUF1688:  Protein of u  46.1      18 0.00039   27.9   2.2   27    2-29     23-49  (420)
 15 smart00183 NAT_PEP Natriuretic  45.7       5 0.00011   20.6  -0.5    8   13-20     11-18  (26)
 16 PRK13812 orotate phosphoribosy  44.8      20 0.00042   23.3   2.0   33    9-47     39-71  (176)
 17 PF08477 Miro:  Miro-like prote  42.9      57  0.0012   17.8   3.9   40    5-45     79-118 (119)
 18 PF05292 MCD:  Malonyl-CoA deca  40.2      45 0.00097   25.3   3.5   43    4-47    182-228 (354)
 19 PRK05250 S-adenosylmethionine   39.3      28 0.00061   26.6   2.4   24   10-33    265-288 (384)
 20 PRK12459 S-adenosylmethionine   39.1      28 0.00061   26.6   2.3   24   10-33    269-292 (386)
 21 PRK09213 pur operon repressor;  38.9      25 0.00054   24.9   2.0   35    9-47    109-143 (271)
 22 TIGR01034 metK S-adenosylmethi  38.7      28  0.0006   26.6   2.3   24   10-33    262-285 (377)
 23 PF00212 ANP:  Atrial natriuret  38.2     5.7 0.00012   21.1  -1.0    8   13-20     20-27  (33)
 24 PLN02243 S-adenosylmethionine   37.3      30 0.00066   26.5   2.3   24   10-33    273-296 (386)
 25 PRK13370 mhpB 3-(2,3-dihydroxy  36.5      77  0.0017   22.6   4.1   33   13-46     22-54  (313)
 26 PTZ00104 S-adenosylmethionine   36.1      32  0.0007   26.4   2.3   23   10-32    279-301 (398)
 27 TIGR00109 hemH ferrochelatase.  34.3      63  0.0014   22.7   3.3   36   10-49    164-201 (322)
 28 PF00762 Ferrochelatase:  Ferro  34.0      65  0.0014   22.7   3.4   32   18-49    163-196 (316)
 29 TIGR01743 purR_Bsub pur operon  33.8      31 0.00066   24.5   1.8   35    9-47    107-141 (268)
 30 KOG1184|consensus               33.1      29 0.00062   27.9   1.6   11   18-28      6-16  (561)
 31 cd03572 ENTH_epsin_related ENT  32.8      27 0.00059   22.2   1.2   20    9-28     30-49  (122)
 32 PF04364 DNA_pol3_chi:  DNA pol  31.4      69  0.0015   19.9   2.9   14    1-14      1-14  (137)
 33 PF14058 PcfK:  PcfK-like prote  31.1      33 0.00072   22.3   1.5   15   15-29      7-21  (140)
 34 PF14129 DUF4296:  Domain of un  30.8      23  0.0005   20.4   0.6   25    4-29     57-81  (87)
 35 PF08688 ASD1:  Apx/Shroom doma  30.5      18 0.00039   24.9   0.1   12    8-19    138-149 (182)
 36 PRK05728 DNA polymerase III su  30.1      88  0.0019   19.6   3.2   15    1-15      1-15  (142)
 37 PF04501 Baculo_VP39:  Baculovi  29.3      35 0.00076   25.3   1.5   23    1-23    112-135 (300)
 38 PLN02605 monogalactosyldiacylg  28.9      96  0.0021   21.2   3.4   27   19-47     85-111 (382)
 39 PRK10122 GalU regulator GalF;   27.4      40 0.00087   23.1   1.4   22    6-27    275-296 (297)
 40 PRK08558 adenine phosphoribosy  27.1      49  0.0011   22.5   1.8   35    9-47     90-124 (238)
 41 PRK15433 branched-chain amino   26.9      22 0.00047   27.0   0.1   20    5-24    133-153 (439)
 42 PF02900 LigB:  Catalytic LigB   26.5      77  0.0017   20.9   2.6   25   23-47     30-54  (272)
 43 cd03299 ABC_ModC_like Archeal   26.1      99  0.0021   19.8   3.0   33   14-47    159-191 (235)
 44 PRK01470 tatA twin arginine tr  25.9      78  0.0017   17.7   2.2   17   11-27     20-36  (51)
 45 TIGR00754 bfr bacterioferritin  25.6      48   0.001   20.3   1.4   15   13-27    139-155 (157)
 46 COG0276 HemH Protoheme ferro-l  25.5      81  0.0018   23.2   2.8   30   20-49    167-197 (320)
 47 PF08388 GIIM:  Group II intron  25.4      68  0.0015   17.3   1.9   28    6-33     38-66  (80)
 48 COG1131 CcmA ABC-type multidru  25.3   1E+02  0.0022   21.2   3.1   31   15-46    167-197 (293)
 49 TIGR01411 tatAE twin arginine-  25.3      83  0.0018   17.0   2.2   16   11-26     19-34  (47)
 50 TIGR00150 HI0065_YjeE ATPase,   25.1      49  0.0011   21.0   1.4   19    8-26      1-19  (133)
 51 PF05013 FGase:  N-formylglutam  24.9      66  0.0014   21.0   2.0   39   10-48    100-143 (222)
 52 PF08738 Gon7:  Gon7 family;  I  24.8      72  0.0015   20.1   2.1   19   16-34     68-86  (103)
 53 PRK14839 undecaprenyl pyrophos  24.6   1E+02  0.0022   21.8   3.1   38    2-39     55-98  (239)
 54 PF13314 DUF4083:  Domain of un  24.6      46   0.001   19.6   1.1   11   12-22     45-55  (58)
 55 PF08518 GIT_SHD:  Spa2 homolog  24.5      56  0.0012   16.9   1.3   19   13-31      3-21  (31)
 56 PF09604 Potass_KdpF:  F subuni  24.5      17 0.00038   18.0  -0.6    9    6-14     16-24  (25)
 57 PF15296 Codanin-1_C:  Codanin-  24.2   1E+02  0.0022   19.7   2.8   24   10-33     78-101 (121)
 58 cd03411 Ferrochelatase_N Ferro  24.1      65  0.0014   20.1   1.8   20    8-27      7-26  (159)
 59 PRK14838 undecaprenyl pyrophos  24.0 1.7E+02  0.0036   20.5   4.0   40    2-41     56-101 (242)
 60 cd01871 Rac1_like Rac1-like su  23.9 1.8E+02  0.0038   17.6   4.1   37    5-44     78-114 (174)
 61 cd02431 Ferritin_CCC1_C CCC1-r  23.9      65  0.0014   20.8   1.8   16   18-33     49-64  (149)
 62 cd01875 RhoG RhoG subfamily.    23.9 1.8E+02   0.004   17.8   4.0   25    4-28     79-103 (191)
 63 PF08544 GHMP_kinases_C:  GHMP   23.6      70  0.0015   16.9   1.7   21    5-25     61-82  (85)
 64 PF02269 TFIID-18kDa:  Transcri  23.6      27 0.00058   20.9   0.0   26    3-28     59-84  (93)
 65 cd07368 PhnC_Bs_like PhnC is a  23.5 2.4E+02  0.0051   19.5   4.6   42    1-42      1-54  (277)
 66 PRK10646 ADP-binding protein;   23.2      77  0.0017   20.7   2.1   26    1-27      1-26  (153)
 67 PRK14831 undecaprenyl pyrophos  23.2 1.3E+02  0.0028   21.1   3.3   29    2-30     66-100 (249)
 68 PF00438 S-AdoMet_synt_N:  S-ad  23.0      89  0.0019   19.5   2.3   20   10-29     13-34  (100)
 69 PF02416 MttA_Hcf106:  mttA/Hcf  22.8 1.1E+02  0.0024   16.7   2.4   16   11-26     18-33  (53)
 70 KOG3142|consensus               22.8      25 0.00055   24.2  -0.2   33    6-42     46-78  (187)
 71 PRK09636 RNA polymerase sigma   22.4      24 0.00052   23.6  -0.4   15    5-19    276-290 (293)
 72 PF05798 Phage_FRD3:  Bacteriop  22.1      85  0.0018   19.4   2.0   19   29-47     16-34  (75)
 73 PRK14833 undecaprenyl pyrophos  21.8 1.4E+02   0.003   20.8   3.2   31    2-32     50-86  (233)
 74 PRK14841 undecaprenyl pyrophos  21.6 1.2E+02  0.0027   21.0   3.0   31    2-32     49-85  (233)
 75 COG3961 Pyruvate decarboxylase  21.4      63  0.0014   26.0   1.7   12   17-28      5-16  (557)
 76 PRK13364 protocatechuate 4,5-d  21.2      79  0.0017   22.2   2.0   44    1-45      1-60  (278)
 77 PRK13810 orotate phosphoribosy  21.2      81  0.0018   20.8   1.9   35    9-47     52-86  (187)
 78 PF12682 Flavodoxin_4:  Flavodo  21.1      37 0.00081   21.5   0.3   28    5-34      5-32  (156)
 79 PLN02293 adenine phosphoribosy  20.9      88  0.0019   20.6   2.0   20    9-28     41-60  (187)
 80 PF08573 SAE2:  DNA repair prot  20.9   1E+02  0.0022   18.3   2.1   16   23-38     63-78  (93)
 81 PF05525 Branch_AA_trans:  Bran  20.8      34 0.00073   25.8   0.1   20    5-24    129-149 (427)
 82 PHA03065 Hypothetical protein;  20.8      73  0.0016   25.0   1.8   44    2-45    132-197 (438)
 83 cd07949 PCA_45_Doxase_B_like_1  20.8      66  0.0014   22.4   1.5   23   22-44     36-59  (276)
 84 PF13524 Glyco_trans_1_2:  Glyc  20.7      75  0.0016   17.1   1.4   20    7-26     58-77  (92)
 85 TIGR03180 UraD_2 OHCU decarbox  20.5      70  0.0015   20.8   1.5   18   28-45    100-117 (158)
 86 COG0347 GlnK Nitrogen regulato  20.5      67  0.0015   20.7   1.4   17    8-24      6-22  (112)
 87 PF06792 UPF0261:  Uncharacteri  20.4 1.1E+02  0.0023   23.4   2.6   27   10-41    312-338 (403)
 88 PF13454 NAD_binding_9:  FAD-NA  20.4 2.2E+02  0.0047   17.3   3.6   18   17-34     95-112 (156)

No 1  
>KOG1877|consensus
Probab=99.45  E-value=1.2e-14  Score=114.62  Aligned_cols=40  Identities=48%  Similarity=0.754  Sum_probs=39.2

Q ss_pred             CcceeeecccCCchHHHHHHHHHHHHhHHhhhhccCceeE
Q psy11264          1 MDKLTFYALSSPEKLDRIGDYLYETASRDISRKRTQCSST   40 (50)
Q Consensus         1 M~KLtfYals~PeKLDRIG~YL~~rl~RDl~R~R~~~v~i   40 (50)
                      |+||+|||.|+|+||||||+||.+|+.+|++|+|+|+|+|
T Consensus        36 m~kL~~YAasnp~KL~KI~~yL~~R~~kdl~~~r~~~v~I   75 (819)
T KOG1877|consen   36 MEKLTFYAASNPSKLPKIGTYLEERCYKDLRRERFGSVKI   75 (819)
T ss_pred             HHHHHHHHhhChhhhhHHHHHHHHHHHHHHHhccCcchhh
Confidence            7899999999999999999999999999999999999987


No 2  
>PF06925 MGDG_synth:  Monogalactosyldiacylglycerol (MGDG) synthase;  InterPro: IPR009695 This entry represents a conserved region of approximately 180 residues found towirds the N terminus of a number of plant and bacterial diacylglycerol glucosyltransferases, such as monogalactosyldiacylglycerol synthase [].; GO: 0016758 transferase activity, transferring hexosyl groups, 0009247 glycolipid biosynthetic process
Probab=65.79  E-value=7.6  Score=23.94  Aligned_cols=30  Identities=23%  Similarity=0.232  Sum_probs=21.8

Q ss_pred             HHHHHHHHHHHhHHhhhhccCceeEEeeeecc
Q psy11264         16 DRIGDYLYETASRDISRKRTQCSSTISTHQIP   47 (50)
Q Consensus        16 DRIG~YL~~rl~RDl~R~R~~~v~iis~~~i~   47 (50)
                      ..+...+.++|.+-|.+.  ..-.|||||..|
T Consensus        71 ~~~~~~~~~~l~~~l~~~--~PD~IIsThp~~  100 (169)
T PF06925_consen   71 SALSRLFARRLIRLLREF--QPDLIISTHPFP  100 (169)
T ss_pred             HHHHHHHHHHHHHHHhhc--CCCEEEECCcch
Confidence            356677777888777654  445899999875


No 3  
>PF13304 AAA_21:  AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T_B 3QKT_A 1II8_B 3QKR_B 3QKU_A.
Probab=64.45  E-value=9.6  Score=21.52  Aligned_cols=28  Identities=21%  Similarity=0.412  Sum_probs=17.0

Q ss_pred             CCchHHHHHHHHHHHHhHHhhhhccCceeEEeeee
Q psy11264         11 SPEKLDRIGDYLYETASRDISRKRTQCSSTISTHQ   45 (50)
Q Consensus        11 ~PeKLDRIG~YL~~rl~RDl~R~R~~~v~iis~~~   45 (50)
                      ||+-..++.++|     +++.. ...|| ||+||.
T Consensus       271 Hp~~q~~l~~~l-----~~~~~-~~~Qv-iitTHS  298 (303)
T PF13304_consen  271 HPSWQRKLIELL-----KELSK-KNIQV-IITTHS  298 (303)
T ss_dssp             SHHHHHHHHHHH-----HHTGG-GSSEE-EEEES-
T ss_pred             CHHHHHHHHHHH-----HhhCc-cCCEE-EEeCcc
Confidence            666677777666     33333 44444 899996


No 4  
>cd00419 Ferrochelatase_C Ferrochelatase, C-terminal domain: Ferrochelatase (protoheme ferrolyase or HemH) is the terminal enzyme of the heme biosynthetic pathway. It catalyzes the insertion of ferrous iron into the protoporphyrin IX ring yielding protoheme. This enzyme is ubiquitous in nature and widely distributed in bacteria and eukaryotes. Recently, some archaeal members have been identified. The oligomeric state of these enzymes varies depending on the presence of a dimerization motif at the C-terminus.
Probab=63.13  E-value=5.9  Score=24.70  Aligned_cols=29  Identities=17%  Similarity=0.260  Sum_probs=21.4

Q ss_pred             HHHHHHhHHhhhh-ccCceeEEeeeecccC
Q psy11264         21 YLYETASRDISRK-RTQCSSTISTHQIPRK   49 (50)
Q Consensus        21 YL~~rl~RDl~R~-R~~~v~iis~~~i~~~   49 (50)
                      .+++++...+.+. +.....++|.|-||.+
T Consensus         2 a~~~~I~~~~~~~~~~~~~llfsaHgiP~~   31 (135)
T cd00419           2 ALADHIREALAELPREKDRLLFSAHGLPVR   31 (135)
T ss_pred             hHHHHHHHHHHhcCCCCCEEEEEcCCCHHH
Confidence            4566666666654 5667899999999964


No 5  
>PF15614 WHIM3:  WSTF, HB1, Itc1p, MBD9 motif 3
Probab=62.73  E-value=6.3  Score=22.06  Aligned_cols=35  Identities=17%  Similarity=0.210  Sum_probs=28.0

Q ss_pred             ecccCCchHHHHHHHH-------HHHHhHHhhhhccCceeEE
Q psy11264          7 YALSSPEKLDRIGDYL-------YETASRDISRKRTQCSSTI   41 (50)
Q Consensus         7 Yals~PeKLDRIG~YL-------~~rl~RDl~R~R~~~v~ii   41 (50)
                      ..++.||-+|.+.+.|       -..|++++..++.+--++-
T Consensus         2 ~~~~~~e~ld~L~~aL~~prG~RE~~L~~~L~~~~k~~~~~s   43 (46)
T PF15614_consen    2 GYYDDPEELDELLKALENPRGKRESKLKKELDKHRKGPLEIS   43 (46)
T ss_pred             ccccCHHHHHHHHHHHcCcccHhHHHHHHHHHHHhcchhhhh
Confidence            4578999999999999       5678999999887755543


No 6  
>PF02773 S-AdoMet_synt_C:  S-adenosylmethionine synthetase, C-terminal domain;  InterPro: IPR022630  The three domains of S-adenosylmethionine synthetase have the same alpha+beta fold. This entry represents the C-terminal domain of S=adenosylmethionine synthetase and is found in association with PF00438 from PFAM and PF02772 from PFAM. S-adenosylmethionine synthetase (MAT, 2.5.1.6 from EC) is the enzyme that catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP []. AdoMet is an important methyl donor for transmethylation and is also the propylamino donor in polyamine biosynthesis. In bacteria there is a single isoform of AdoMet synthetase (gene metK), there are two in budding yeast (genes SAM1 and SAM2) and in mammals while in plants there is generally a multigene family. The sequence of AdoMet synthetase is highly conserved throughout isozymes and species. The active sites of both the Escherichia coli and rat liver MAT reside between two subunits, with contributions from side chains of residues from both subunits, resulting in a dimer as the minimal catalytic entity. The side chains that contribute to the ligand binding sites are conserved between the two proteins. In the structures of complexes with the E. coli enzyme, the phosphate groups have the same positions in the (PPi plus Pi) complex and the (ADP plus Pi) complex, and are located at the bottom of a deep cavity with the adenosyl group nearer the entrance []; GO: 0004478 methionine adenosyltransferase activity; PDB: 3IML_B 1QM4_B 1O9T_B 1O93_A 1O92_B 1O90_A 1FUG_A 1RG9_D 1XRA_A 1P7L_C ....
Probab=57.20  E-value=12  Score=25.02  Aligned_cols=24  Identities=25%  Similarity=0.487  Sum_probs=20.3

Q ss_pred             cCCchHHHHHHHHHHHHhHHhhhh
Q psy11264         10 SSPEKLDRIGDYLYETASRDISRK   33 (50)
Q Consensus        10 s~PeKLDRIG~YL~~rl~RDl~R~   33 (50)
                      .+|-|.||-|.|++.-+...|...
T Consensus        34 KD~tKvDRsaaY~aR~iAKniVaa   57 (138)
T PF02773_consen   34 KDPTKVDRSAAYMARYIAKNIVAA   57 (138)
T ss_dssp             B-TTSHHHHHHHHHHHHHHHHHHT
T ss_pred             CChhhhhccHHHHHHHHHHHHHHc
Confidence            479999999999999999888754


No 7  
>TIGR02957 SigX4 RNA polymerase sigma-70 factor, TIGR02957 family. This group of sigma factors are members of the sigma-70 family (TIGR02937). They and appear by homology, tree building and bidirectional best hits, to represent a conserved family. This family is found in a limited number of bacterial lineages. This family includes apparent paralogous expansion in Streptomyces coelicolor A3(2), and multiple copies in Mycobacterium smegmatis MC2, Streptomyces avermitilis MA-4680 and Nocardia farcinica IFM10152.
Probab=55.43  E-value=3.2  Score=27.84  Aligned_cols=15  Identities=47%  Similarity=0.895  Sum_probs=13.1

Q ss_pred             eeecccCCchHHHHH
Q psy11264          5 TFYALSSPEKLDRIG   19 (50)
Q Consensus         5 tfYals~PeKLDRIG   19 (50)
                      .+|.+..||||.++|
T Consensus       267 ~i~~~~nP~kl~~~~  281 (281)
T TIGR02957       267 NIYIVRNPEKLAHIG  281 (281)
T ss_pred             EEEEEcCHHHhccCC
Confidence            479999999998876


No 8  
>PF11016 DUF2854:  Protein of unknown function (DUF2854);  InterPro: IPR021275  This family of proteins has no known function. 
Probab=50.50  E-value=8.7  Score=25.98  Aligned_cols=16  Identities=19%  Similarity=0.252  Sum_probs=13.2

Q ss_pred             HHHHhHHhhhhccCce
Q psy11264         23 YETASRDISRKRTQCS   38 (50)
Q Consensus        23 ~~rl~RDl~R~R~~~v   38 (50)
                      -..+..|+.|.|||+-
T Consensus        61 ~~qlr~DVTR~RYGqe   76 (147)
T PF11016_consen   61 QNQLRKDVTRYRYGQE   76 (147)
T ss_pred             HHHHHhhhhhhhccHH
Confidence            3568899999999973


No 9  
>TIGR02017 hutG_amidohyd N-formylglutamate amidohydrolase. In some species, histidine is converted to via urocanate and then formimino-L-glutamate to glutamate in four steps, where the fourth step is conversion of N-formimino-L-glutamate to L-glutamate and formamide. In others, that pathway from formimino-L-glutamate may differ, with the next enzyme being formiminoglutamate hydrolase (HutF) yielding N-formyl-L-glutamate. This model represents the enzyme N-formylglutamate deformylase, also called N-formylglutamate amidohydrolase, which then produces glutamate.
Probab=49.56  E-value=28  Score=24.08  Aligned_cols=40  Identities=20%  Similarity=0.187  Sum_probs=29.0

Q ss_pred             ccCCchHHHHHHHH---HHHHhHHhhh--hccCceeEEeeeeccc
Q psy11264          9 LSSPEKLDRIGDYL---YETASRDISR--KRTQCSSTISTHQIPR   48 (50)
Q Consensus         9 ls~PeKLDRIG~YL---~~rl~RDl~R--~R~~~v~iis~~~i~~   48 (50)
                      ++.-|...||..|=   .+.|.+-|.+  .|+|.+.+|+.|.+|.
T Consensus       107 l~~~e~~~Ri~~yy~PYH~al~~~L~~~~~~~g~~~liD~HSm~s  151 (263)
T TIGR02017       107 PSPAEIDDRRTQIFRPYHAALQAEIERLRAQHGYAVLYDAHSIRS  151 (263)
T ss_pred             cCHHHHHHHHHHHhHHHHHHHHHHHHHHHHhCCCEEEEEeccCCc
Confidence            55567777887762   4566666643  6899999999998874


No 10 
>PF13809 Tubulin_2:  Tubulin like
Probab=48.85  E-value=18  Score=25.34  Aligned_cols=25  Identities=32%  Similarity=0.464  Sum_probs=19.7

Q ss_pred             ecccCCchHHHHHHHHHHHHhHHhhhh
Q psy11264          7 YALSSPEKLDRIGDYLYETASRDISRK   33 (50)
Q Consensus         7 Yals~PeKLDRIG~YL~~rl~RDl~R~   33 (50)
                      .+++-|  .|+|.+|+++|+.+.+..+
T Consensus       320 a~i~~P--~~~i~~~~a~rl~~~~v~~  344 (345)
T PF13809_consen  320 ASISFP--RDRIAEYLAYRLARQAVDQ  344 (345)
T ss_pred             eeeecc--HHHHHHHHHHHHHHHHHHh
Confidence            345556  4899999999999988753


No 11 
>cd07365 MhpB_like Subunit B of the Class III Extradiol ring-cleavage dioxygenase, 2,3-dihydroxyphenylpropionate 1,2-dioxygenase (MhpB), which catalyzes the oxidization and subsequent ring-opening of 2,3-dihydroxyphenylpropionate. 2,3-dihydroxyphenylpropionate 1,2-dioxygenase (MhpB) catalyzes the oxidization and subsequent ring-opening of 2,3-dihydroxyphenylpropionate, yielding the product 2-hydroxy-6-oxo-nona-2,4-diene 1,9-dicarboxylate.  It is an essential enzyme in the beta-phenylpropionic degradation pathway, in which beta-phenylpropionic is first hydrolyzed to produce 2,3-dihydroxyphenylpropionate. The enzyme is a member of the class III extradiol dioxygenase family, a group of enzymes which use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon. LigAB-like class III enzymes are usually composed of two subunits, designated A and B, which form a tetramer composed of two copies of each subunit. This model represents the ca
Probab=47.87  E-value=43  Score=23.87  Aligned_cols=40  Identities=10%  Similarity=0.132  Sum_probs=31.5

Q ss_pred             ecccC-C---------chHHHHHHHHHHHHhHHhhhhccCceeEEeeeecc
Q psy11264          7 YALSS-P---------EKLDRIGDYLYETASRDISRKRTQCSSTISTHQIP   47 (50)
Q Consensus         7 Yals~-P---------eKLDRIG~YL~~rl~RDl~R~R~~~v~iis~~~i~   47 (50)
                      ++.|| |         +..+++.+-+ +++.+.|...+..-+.|||.|..+
T Consensus         6 ~~~sH~p~~~~~~~~~~~~~~~~~a~-~~l~~~l~~~~PD~iVIigphH~~   55 (310)
T cd07365           6 ICMSHSPLLGFNDPAPEVVAEVDAAF-AAARAFVAAFDPELVVLFAPDHYN   55 (310)
T ss_pred             eeeCCCcccCCCCCchHHHHHHHHHH-HHHHHHHHHcCCCEEEEEcCCccc
Confidence            66777 6         5677777776 788999988889999999988543


No 12 
>cd07359 PCA_45_Doxase_B_like Subunit B of the Class III Extradiol dioxygenase, Protocatechuate 4,5-dioxygenase, and simlar enzymes. This subfamily of class III extradiol dioxygenases consists of a number of proteins with known enzymatic activities: Protocatechuate (PCA) 4,5-dioxygenase (LigAB), 2,3-dihydroxyphenylpropionate 1,2-dioxygenase (MhpB), 3-O-Methylgallate Dioxygenase, 2-aminophenol 1,6-dioxygenase, as well as proteins without any known enzymatic activity. These proteins play essential roles in the degradation of aromatic compounds by catalyzing the incorporation of both atoms of molecular oxygen into their preferred substrates. As members of the Class III extradiol dioxygenase family, the enzymes use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon. LigAB-like class III enzymes are usually composed of two subunits, designated A and B, which form a tetramer composed of two copies of each subunit. This model repres
Probab=47.22  E-value=49  Score=22.08  Aligned_cols=31  Identities=3%  Similarity=0.025  Sum_probs=21.4

Q ss_pred             hHHHHHHHHHHHHhHHhhhhccCceeEEeeee
Q psy11264         14 KLDRIGDYLYETASRDISRKRTQCSSTISTHQ   45 (50)
Q Consensus        14 KLDRIG~YL~~rl~RDl~R~R~~~v~iis~~~   45 (50)
                      +.++..+-| +++.+.|...+..-|.|||.|.
T Consensus        25 ~~~~~~~~l-~~~~~~l~~~~Pd~ivvis~~h   55 (271)
T cd07359          25 VRAAVFAAF-ARIRDRLEAARPDVVVVVGNDH   55 (271)
T ss_pred             HHHHHHHHH-HHHHHHHHHhCCCEEEEEeCcH
Confidence            344444444 4477888777888899999954


No 13 
>PF15447 NTS:  N-terminal segments of PfEMP1; PDB: 2XU0_A 2YK0_A.
Probab=46.12  E-value=12  Score=19.88  Aligned_cols=18  Identities=33%  Similarity=0.698  Sum_probs=13.1

Q ss_pred             chHHHHHHHHHHHHhHHh
Q psy11264         13 EKLDRIGDYLYETASRDI   30 (50)
Q Consensus        13 eKLDRIG~YL~~rl~RDl   30 (50)
                      +=||+||+-+.+....+-
T Consensus         4 ~vLd~IG~~I~~~v~~~A   21 (37)
T PF15447_consen    4 NVLDRIGKEIYKKVKKEA   21 (37)
T ss_dssp             HHHHHHHHHHHHHCC-S-
T ss_pred             HHHHHHHHHHHHHHhHhH
Confidence            348999999998876653


No 14 
>PF07958 DUF1688:  Protein of unknown function (DUF1688);  InterPro: IPR012469 A family of uncharacterised fungal proteins. 
Probab=46.10  E-value=18  Score=27.91  Aligned_cols=27  Identities=41%  Similarity=0.764  Sum_probs=22.2

Q ss_pred             cceeeecccCCchHHHHHHHHHHHHhHH
Q psy11264          2 DKLTFYALSSPEKLDRIGDYLYETASRD   29 (50)
Q Consensus         2 ~KLtfYals~PeKLDRIG~YL~~rl~RD   29 (50)
                      .||.++.+. ++|||.+++|.+.-..||
T Consensus        23 g~l~hF~~d-~~kl~~va~~V~~vi~rd   49 (420)
T PF07958_consen   23 GKLNHFDVD-PSKLDDVADYVAEVIRRD   49 (420)
T ss_pred             CCCCCEEec-hhhhHHHHHHHHHHHHHh
Confidence            477888874 999999999998876665


No 15 
>smart00183 NAT_PEP Natriuretic peptide. Atrial natriuretic peptides are vertebrate hormones important in the overall control of cardiovascular homeostasis and sodium and water balance in general.
Probab=45.65  E-value=5  Score=20.63  Aligned_cols=8  Identities=75%  Similarity=1.037  Sum_probs=6.7

Q ss_pred             chHHHHHH
Q psy11264         13 EKLDRIGD   20 (50)
Q Consensus        13 eKLDRIG~   20 (50)
                      .||||||.
T Consensus        11 ~~~DRIgs   18 (26)
T smart00183       11 LKLDRIGS   18 (26)
T ss_pred             cccccccc
Confidence            58999986


No 16 
>PRK13812 orotate phosphoribosyltransferase; Provisional
Probab=44.80  E-value=20  Score=23.29  Aligned_cols=33  Identities=15%  Similarity=0.278  Sum_probs=23.7

Q ss_pred             ccCCchHHHHHHHHHHHHhHHhhhhccCceeEEeeeecc
Q psy11264          9 LSSPEKLDRIGDYLYETASRDISRKRTQCSSTISTHQIP   47 (50)
Q Consensus         9 ls~PeKLDRIG~YL~~rl~RDl~R~R~~~v~iis~~~i~   47 (50)
                      .+.|+-+..||++|++++...      ..+.-+....||
T Consensus        39 ~~~p~~~~~i~~~l~~~i~~~------d~ivg~~~ggi~   71 (176)
T PRK13812         39 ETDPDCLRLIAEAFADRIDED------TKLAGVALGAVP   71 (176)
T ss_pred             cCCHHHHHHHHHHHHHHhccC------CEEEEeecchHH
Confidence            578999999999999997531      345555555554


No 17 
>PF08477 Miro:  Miro-like protein;  InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases. They have a unique domain organisation, with tandem GTP-binding domains and two EF hand domains (IPR002048 from INTERPRO), that may bind calcium. They are also larger than classical small GTPases. It has been proposed that they are involved in mitochondrial homeostasis and apoptosis []. ; GO: 0005525 GTP binding, 0007264 small GTPase mediated signal transduction, 0005622 intracellular; PDB: 2IWR_A 2BMJ_A 3IHW_A 2ZEJ_A 3D6T_B 3DPU_A.
Probab=42.86  E-value=57  Score=17.80  Aligned_cols=40  Identities=18%  Similarity=0.230  Sum_probs=24.7

Q ss_pred             eeecccCCchHHHHHHHHHHHHhHHhhhhccCceeEEeeee
Q psy11264          5 TFYALSSPEKLDRIGDYLYETASRDISRKRTQCSSTISTHQ   45 (50)
Q Consensus         5 tfYals~PeKLDRIG~YL~~rl~RDl~R~R~~~v~iis~~~   45 (50)
                      .-|.++.|+.++.+-++ .+.+..--.+.+.-.+.++.+|+
T Consensus        79 lv~D~s~~~s~~~~~~~-~~~l~~~~~~~~~~piilv~nK~  118 (119)
T PF08477_consen   79 LVYDLSDPESLEYLSQL-LKWLKNIRKRDKNIPIILVGNKS  118 (119)
T ss_dssp             EEEECCGHHHHHHHHHH-HHHHHHHHHHSSCSEEEEEEE-T
T ss_pred             EEEcCCChHHHHHHHHH-HHHHHHHHccCCCCCEEEEEecc
Confidence            45788999999987554 44444433344555667777663


No 18 
>PF05292 MCD:  Malonyl-CoA decarboxylase (MCD);  InterPro: IPR007956 This family consists of several eukaryotic malonyl-CoA decarboxylase (MLYCD) proteins. Malonyl-CoA, in addition to being an intermediate in the de novo synthesis of fatty acids, is an inhibitor of carnitine palmitoyltransferase I, the enzyme that regulates the transfer of long-chain fatty acyl-CoA into mitochondria, where they are oxidised. After exercise, malonyl-CoA decarboxylase participates with acetyl-CoA carboxylase in regulating the concentration of malonyl-CoA in liver and adipose tissue, as well as in muscle. Malonyl-CoA decarboxylase is regulated by AMP-activated protein kinase (AMPK) [].; GO: 0050080 malonyl-CoA decarboxylase activity, 0006633 fatty acid biosynthetic process; PDB: 2YGW_B.
Probab=40.16  E-value=45  Score=25.25  Aligned_cols=43  Identities=28%  Similarity=0.502  Sum_probs=27.1

Q ss_pred             eeeecccCCchH-H--HHHHHHHHHHhHHhhhhccCceeEEee-eecc
Q psy11264          4 LTFYALSSPEKL-D--RIGDYLYETASRDISRKRTQCSSTIST-HQIP   47 (50)
Q Consensus         4 LtfYals~PeKL-D--RIG~YL~~rl~RDl~R~R~~~v~iis~-~~i~   47 (50)
                      =+||++|+=++= -  .+|.+|-+|...+|.+ ....++..+| ..||
T Consensus       182 AiFYSISn~q~GL~Gi~lGn~LIK~Vv~~L~~-e~p~l~~F~TLSPiP  228 (354)
T PF05292_consen  182 AIFYSISNTQKGLRGISLGNFLIKRVVEELQR-EFPNLKTFSTLSPIP  228 (354)
T ss_dssp             EEEEEEEES-GGGTTS-HHHHHHHHHHHHHHH-H-TT--EEEE-B---
T ss_pred             EEEEecccchhhhccCchHHHHHHHHHHHHHH-hCccccccccCCCCc
Confidence            479999988873 2  4799999999999987 4555665554 3444


No 19 
>PRK05250 S-adenosylmethionine synthetase; Validated
Probab=39.25  E-value=28  Score=26.61  Aligned_cols=24  Identities=25%  Similarity=0.444  Sum_probs=21.0

Q ss_pred             cCCchHHHHHHHHHHHHhHHhhhh
Q psy11264         10 SSPEKLDRIGDYLYETASRDISRK   33 (50)
Q Consensus        10 s~PeKLDRIG~YL~~rl~RDl~R~   33 (50)
                      ..|-|.||-|.|+++-+...|...
T Consensus       265 KDptKVDRSaAY~AR~iAKniVaa  288 (384)
T PRK05250        265 KDPTKVDRSAAYAARYVAKNIVAA  288 (384)
T ss_pred             CCcchhhhHHHHHHHHHHHHHHhh
Confidence            479999999999999999888653


No 20 
>PRK12459 S-adenosylmethionine synthetase; Provisional
Probab=39.07  E-value=28  Score=26.63  Aligned_cols=24  Identities=25%  Similarity=0.436  Sum_probs=21.1

Q ss_pred             cCCchHHHHHHHHHHHHhHHhhhh
Q psy11264         10 SSPEKLDRIGDYLYETASRDISRK   33 (50)
Q Consensus        10 s~PeKLDRIG~YL~~rl~RDl~R~   33 (50)
                      ..|-|.||-|.|+++-+...|...
T Consensus       269 KDptKVDRSaAY~AR~iAKniVaA  292 (386)
T PRK12459        269 KDPSKVDRSAAYAARYIAKNIVAA  292 (386)
T ss_pred             CCcchhhhHHHHHHHHHHHHHHhh
Confidence            479999999999999999888654


No 21 
>PRK09213 pur operon repressor; Provisional
Probab=38.88  E-value=25  Score=24.93  Aligned_cols=35  Identities=29%  Similarity=0.484  Sum_probs=27.1

Q ss_pred             ccCCchHHHHHHHHHHHHhHHhhhhccCceeEEeeeecc
Q psy11264          9 LSSPEKLDRIGDYLYETASRDISRKRTQCSSTISTHQIP   47 (50)
Q Consensus         9 ls~PeKLDRIG~YL~~rl~RDl~R~R~~~v~iis~~~i~   47 (50)
                      +++|+-++.+|+.+++++..    .....|..+.++.||
T Consensus       109 l~~P~~l~~i~~~la~~~~~----~~iD~Vvtvet~GIp  143 (271)
T PRK09213        109 LGNPSILRKIGRIIASAFAD----KKIDAVMTVETKGIP  143 (271)
T ss_pred             cCCHHHHHHHHHHHHHHhcc----cCCCEEEEEccccHH
Confidence            67999999999999998853    234567777777776


No 22 
>TIGR01034 metK S-adenosylmethionine synthetase. Tandem isozymes of this S-adenosylmethionine synthetase in E. coli are designated MetK and MetX.
Probab=38.73  E-value=28  Score=26.61  Aligned_cols=24  Identities=25%  Similarity=0.436  Sum_probs=21.3

Q ss_pred             cCCchHHHHHHHHHHHHhHHhhhh
Q psy11264         10 SSPEKLDRIGDYLYETASRDISRK   33 (50)
Q Consensus        10 s~PeKLDRIG~YL~~rl~RDl~R~   33 (50)
                      ..|-|.||-|.|+++-+...|..-
T Consensus       262 KDptKVDRSaAY~AR~iAKniVaA  285 (377)
T TIGR01034       262 KDPSKVDRSAAYAARYIAKNIVAA  285 (377)
T ss_pred             CCcchhhhHHHHHHHHHHHHHHhh
Confidence            479999999999999999988764


No 23 
>PF00212 ANP:  Atrial natriuretic peptide;  InterPro: IPR000663 Atrial natriuretic peptides (ANPs) are vertebrate hormones that play an important role in the control of cardiovascular homeostatis, and sodium and water balance in general [, , ]. There are different NPs that vary in length but share a common core. All are processed from a single precursor. A disulphide bond resident in the C-terminal section is required for full activity of atriopeptins. The family of NPs includes structurally-related peptides that elicit similar pharmacological spectra. Amongst these are brain natriuretic peptide (BNP); C-type natriuretic peptide (CNP); ventricular natriuretic peptide (VNP) []; and green mamba natriuretic peptide (DNP) [].; GO: 0005179 hormone activity, 0005576 extracellular region; PDB: 3N57_C 1YK0_E 1T34_H 1JDP_H 1YK1_E 1Q01_A.
Probab=38.23  E-value=5.7  Score=21.12  Aligned_cols=8  Identities=63%  Similarity=1.120  Sum_probs=6.4

Q ss_pred             chHHHHHH
Q psy11264         13 EKLDRIGD   20 (50)
Q Consensus        13 eKLDRIG~   20 (50)
                      .||||||.
T Consensus        20 ~kiDRIGs   27 (33)
T PF00212_consen   20 RKIDRIGS   27 (33)
T ss_dssp             STTSTTSS
T ss_pred             cccccccc
Confidence            48999984


No 24 
>PLN02243 S-adenosylmethionine synthase
Probab=37.26  E-value=30  Score=26.48  Aligned_cols=24  Identities=29%  Similarity=0.621  Sum_probs=21.2

Q ss_pred             cCCchHHHHHHHHHHHHhHHhhhh
Q psy11264         10 SSPEKLDRIGDYLYETASRDISRK   33 (50)
Q Consensus        10 s~PeKLDRIG~YL~~rl~RDl~R~   33 (50)
                      ..|-|.||-|.|+++-+...|..-
T Consensus       273 KDptKVDRSaAY~AR~iAKniVaa  296 (386)
T PLN02243        273 KDPTKVDRSGAYIVRQAAKSVVAA  296 (386)
T ss_pred             CCcchhhhHHHHHHHHHHHHHHhh
Confidence            479999999999999999888764


No 25 
>PRK13370 mhpB 3-(2,3-dihydroxyphenyl)propionate dioxygenase; Provisional
Probab=36.52  E-value=77  Score=22.63  Aligned_cols=33  Identities=9%  Similarity=0.100  Sum_probs=25.8

Q ss_pred             chHHHHHHHHHHHHhHHhhhhccCceeEEeeeec
Q psy11264         13 EKLDRIGDYLYETASRDISRKRTQCSSTISTHQI   46 (50)
Q Consensus        13 eKLDRIG~YL~~rl~RDl~R~R~~~v~iis~~~i   46 (50)
                      +..+++-.-+ +++.+.|...+..-|.|||.|..
T Consensus        22 ~~~~~v~~a~-~~l~~~l~~~~PD~iVIigpdH~   54 (313)
T PRK13370         22 EVLAEVNAVI-AAAREFVAAFDPELVVLFAPDHY   54 (313)
T ss_pred             HHHHHHHHHH-HHHHHHHHHhCCCEEEEEcCCcc
Confidence            5677777665 78888998888898999998543


No 26 
>PTZ00104 S-adenosylmethionine synthase; Provisional
Probab=36.10  E-value=32  Score=26.44  Aligned_cols=23  Identities=22%  Similarity=0.396  Sum_probs=20.5

Q ss_pred             cCCchHHHHHHHHHHHHhHHhhh
Q psy11264         10 SSPEKLDRIGDYLYETASRDISR   32 (50)
Q Consensus        10 s~PeKLDRIG~YL~~rl~RDl~R   32 (50)
                      ..|-|.||-|.|+++-+...|..
T Consensus       279 KDptKVDRSaAY~ARyiAKniVA  301 (398)
T PTZ00104        279 KDPSKVDRSAAYAARWIAKSLVA  301 (398)
T ss_pred             CCcchhhhHHHHHHHHHHHHHHh
Confidence            47999999999999999988865


No 27 
>TIGR00109 hemH ferrochelatase. Human ferrochelatase, found at the mitochondrial inner membrane inner surface, was shown in an active recombinant form to be a homodimer. This contrasts to an earlier finding by gel filtration that overexpressed E. coli ferrochelatase runs as a monomer.
Probab=34.25  E-value=63  Score=22.68  Aligned_cols=36  Identities=14%  Similarity=0.314  Sum_probs=20.8

Q ss_pred             cCCchHHHHHHHHHHHHhHHhhhhcc-C-ceeEEeeeecccC
Q psy11264         10 SSPEKLDRIGDYLYETASRDISRKRT-Q-CSSTISTHQIPRK   49 (50)
Q Consensus        10 s~PeKLDRIG~YL~~rl~RDl~R~R~-~-~v~iis~~~i~~~   49 (50)
                      .+|+=++-    +++++...+.+... + ...++|.|.||.+
T Consensus       164 ~~p~yi~a----~~~~I~~~l~~~~~~~~~~llfSaHglP~~  201 (322)
T TIGR00109       164 DNPKYIKA----LADSIKETLASFPEPDNAVLLFSAHGLPQS  201 (322)
T ss_pred             cCcHHHHH----HHHHHHHHHHhcCCcCCcEEEEeCCCCchh
Confidence            34544444    44444444444322 3 3799999999964


No 28 
>PF00762 Ferrochelatase:  Ferrochelatase;  InterPro: IPR001015 Synonym(s): Protohaem ferro-lyase, Iron chelatase, etc. Ferrochelatase catalyses the last step in haem biosynthesis: the chelation of a ferrous ion to proto-porphyrin IX, to form protohaem [, ]. In eukaryotic cells, it binds to the mitochondrial inner membrane with its active site on the matrix side of the membrane. The X-ray structure of Bacillus subtilis and human ferrochelatase have been solved [, ]. The human enzyme exists as a homodimer. Each subunit contains one [2Fe-2S] cluster. The monomer is folded into two similar domains, each with a four-stranded parallel beta-sheet flanked by an alpha-helix in a beta-alpha-beta motif that is reminiscent of the fold found in the periplasmic binding proteins. The topological similarity between the domains suggests that they have arisen from a gene duplication event. However, significant differences exist between the two domains, including an N-terminal section (residues 80-130) that forms part of the active site pocket, and a C-terminal extension (residues 390-423) that is involved in coordination of the [2Fe-2S] cluster and in stabilisation of the homodimer.  Ferrochelatase seems to have a structurally conserved core region that is common to the enzyme from bacteria, plants and mammals. Porphyrin binds in the identified cleft; this cleft also includes the metal-binding site of the enzyme. It is likely that the structure of the cleft region will have different conformations upon substrate binding and release [].; GO: 0004325 ferrochelatase activity, 0006783 heme biosynthetic process; PDB: 2QD3_B 2HRE_C 3HCN_B 2PNJ_A 2QD1_C 1HRK_A 2QD4_B 3AQI_B 2HRC_B 3HCO_B ....
Probab=33.99  E-value=65  Score=22.74  Aligned_cols=32  Identities=19%  Similarity=0.203  Sum_probs=22.4

Q ss_pred             HHHHHHHHHhHHhhhh--ccCceeEEeeeecccC
Q psy11264         18 IGDYLYETASRDISRK--RTQCSSTISTHQIPRK   49 (50)
Q Consensus        18 IG~YL~~rl~RDl~R~--R~~~v~iis~~~i~~~   49 (50)
                      .-+++++++...+.+.  ..+...+.|.|.||.+
T Consensus       163 yi~a~~~~i~~~l~~~~~~~~~~llfSaHglP~~  196 (316)
T PF00762_consen  163 YIEALAERIREALERFPRGEPDHLLFSAHGLPQR  196 (316)
T ss_dssp             HHHHHHHHHHHHHTTS-HCCCEEEEEEEE--BHH
T ss_pred             HHHHHHHHHHHHHHhcCCCCCCEEEEccCCCCcc
Confidence            4467778888888776  2367899999999963


No 29 
>TIGR01743 purR_Bsub pur operon repressor, Bacillus subtilis type. This model represents the puring operon repressor PurR of low-GC Gram-positive bacteria. This homodimeric repressor contains a large region homologous to phosphoribosyltransferases and is inhibited by 5-phosphoribosyl 1-pyrophosphate.
Probab=33.83  E-value=31  Score=24.51  Aligned_cols=35  Identities=29%  Similarity=0.486  Sum_probs=26.8

Q ss_pred             ccCCchHHHHHHHHHHHHhHHhhhhccCceeEEeeeecc
Q psy11264          9 LSSPEKLDRIGDYLYETASRDISRKRTQCSSTISTHQIP   47 (50)
Q Consensus         9 ls~PeKLDRIG~YL~~rl~RDl~R~R~~~v~iis~~~i~   47 (50)
                      +++|+-|..+|+.|+.++..    .....|..+.++.||
T Consensus       107 l~~P~~l~~ig~~la~~~~~----~~iD~VvgvetkGIp  141 (268)
T TIGR01743       107 LGKPSILSKIGKILASVFAE----REIDAVMTVATKGIP  141 (268)
T ss_pred             hcCHHHHHHHHHHHHHHhcC----CCCCEEEEEccchHH
Confidence            67999999999999998852    134567777777766


No 30 
>KOG1184|consensus
Probab=33.12  E-value=29  Score=27.94  Aligned_cols=11  Identities=27%  Similarity=0.863  Sum_probs=10.0

Q ss_pred             HHHHHHHHHhH
Q psy11264         18 IGDYLYETASR   28 (50)
Q Consensus        18 IG~YL~~rl~R   28 (50)
                      +|+||++||.+
T Consensus         6 ~G~YLf~RL~q   16 (561)
T KOG1184|consen    6 LGEYLFRRLVQ   16 (561)
T ss_pred             HHHHHHHHHHH
Confidence            89999999975


No 31 
>cd03572 ENTH_epsin_related ENTH domain, Epsin Related family; composed of hypothetical proteins containing an ENTH-like domain. The epsin N-terminal homology (ENTH) domain is an evolutionarily conserved protein module found primarily in proteins that participate in clathrin-mediated endocytosis. A set of proteins previously designated as harboring an ENTH domain in fact contains a highly similar, yet unique module referred to as an AP180 N-terminal homology (ANTH) domain. ENTH and ANTH (E/ANTH) domains are structurally similar to the VHS domain and are composed of a superhelix of eight alpha helices. E/ANTH domains bind both inositol phospholipids and proteins and contribute to the nucleation and formation of clathrin coats on membranes. ENTH domains also function in the development of membrane curvature through lipid remodeling during the formation of clathrin-coated vesicles. E/ANTH-bearing proteins have recently been shown to function with adaptor protein-1 and GGA adaptors at the t
Probab=32.84  E-value=27  Score=22.23  Aligned_cols=20  Identities=20%  Similarity=0.250  Sum_probs=17.5

Q ss_pred             ccCCchHHHHHHHHHHHHhH
Q psy11264          9 LSSPEKLDRIGDYLYETASR   28 (50)
Q Consensus         9 ls~PeKLDRIG~YL~~rl~R   28 (50)
                      .++|+....|.+||..||..
T Consensus        30 ~~s~~~~~ei~d~L~kRL~~   49 (122)
T cd03572          30 RKSVGSCQELLEYLLKRLKR   49 (122)
T ss_pred             HcCHHHHHHHHHHHHHHhcC
Confidence            35789999999999999985


No 32 
>PF04364 DNA_pol3_chi:  DNA polymerase III chi subunit, HolC;  InterPro: IPR007459 The DNA polymerase III holoenzyme (2.7.7.7 from EC) is the polymerase responsible for the replication of the Escherichia coli chromosome. The holoenzyme is composed of the DNA polymerase III core, the sliding clamp, and the DnaX clamp loading complex. The DnaX complex contains either the tau or gamma product of gene dnax, complexed to delta.delta and to chi psi. Chi forms a 1:1 heterodimer with psi. The chi psi complex functions by increasing the affinity of tau and gamma for delta.delta allowing a functional clamp-loading complex to form at physiological subunit concentrations. Psi is responsible for the interaction with DnaX (gamma/tau), but psi is insoluble unless it is in a complex with chi [].; GO: 0003677 DNA binding, 0003887 DNA-directed DNA polymerase activity, 0006260 DNA replication; PDB: 3SXU_A 1EM8_C.
Probab=31.38  E-value=69  Score=19.88  Aligned_cols=14  Identities=43%  Similarity=0.740  Sum_probs=7.6

Q ss_pred             CcceeeecccCCch
Q psy11264          1 MDKLTFYALSSPEK   14 (50)
Q Consensus         1 M~KLtfYals~PeK   14 (50)
                      |.+..||-++....
T Consensus         1 Mt~v~Fy~l~~~~~   14 (137)
T PF04364_consen    1 MTRVDFYHLSSDDL   14 (137)
T ss_dssp             -EEEEEEE-S----
T ss_pred             CCeEEEEEcCCCcH
Confidence            88999999988766


No 33 
>PF14058 PcfK:  PcfK-like protein
Probab=31.05  E-value=33  Score=22.35  Aligned_cols=15  Identities=40%  Similarity=0.616  Sum_probs=12.8

Q ss_pred             HHHHHHHHHHHHhHH
Q psy11264         15 LDRIGDYLYETASRD   29 (50)
Q Consensus        15 LDRIG~YL~~rl~RD   29 (50)
                      .|.|+.||.+|...|
T Consensus         7 k~~I~~yL~~ra~~D   21 (140)
T PF14058_consen    7 KDTIHNYLCQRAQED   21 (140)
T ss_pred             HHHHHHHHHHHhccC
Confidence            589999999988765


No 34 
>PF14129 DUF4296:  Domain of unknown function (DUF4296)
Probab=30.79  E-value=23  Score=20.41  Aligned_cols=25  Identities=24%  Similarity=0.598  Sum_probs=19.3

Q ss_pred             eeeecccCCchHHHHHHHHHHHHhHH
Q psy11264          4 LTFYALSSPEKLDRIGDYLYETASRD   29 (50)
Q Consensus         4 LtfYals~PeKLDRIG~YL~~rl~RD   29 (50)
                      +.||+- +|+.+..|=+-+.+||...
T Consensus        57 ~~YY~~-~p~~~~~Iy~~V~~rL~~~   81 (87)
T PF14129_consen   57 MVYYSR-NPEEYEKIYDKVIERLEKE   81 (87)
T ss_pred             HHHHHh-CHHHHHHHHHHHHHHHHHH
Confidence            346664 5999999988888888754


No 35 
>PF08688 ASD1:  Apx/Shroom domain ASD1;  InterPro: IPR014800 Cell shape changes require the coordination of actin and microtubule cytoskeletons. The Shroom family is a small group of related proteins that are defined by sequence similarity and in most cases by some link to the actin cytoskeleton. The Shroom (Shrm) protein family is found only in animals. Proteins of this family are predicted to be utilised in multiple morphogenic and developmental processes across animal phyla to regulate cells shape or intracellular architecture in an actin and myosin-dependent manner []. While the founding member of the Shrm family is Shrm1 (formerly Apx), it appears that this protein is found only in Xenopus []. In mice and humans, the Shrm family of proteins consists of:  Shrm2 (formerly Apxl), a protein involved in the morphogenesis, maintenance, and/or function of vascular endothelial cells.  Shrm3 (formerly Shroom), a protein necessary for neural tube closure in vertebrate development as deficiency in Shrm results in spina bifida. Shrm3 is also conserved in some invertebrates, as orthologues can be found in sea urchins.  Shrm4, a regulator of cyto-skeletal architecture that may play an important role in vertebrate development. It is implicated in X-linked mental retardation in humans.    This protein family is based on the conservation of a specific arrangement of an N-terminal PDZ domain, a centrally positioned sequence motif termed ASD1 (Apx/Shrm Domain 1) and a C-terminal motif termed ASD2 [, , ]. Shrm2 and Shrm3 contain all three domains, while Shrm4 contains the PDZ and ASD2 domains, but lacks a discernible ASD1 element. To date, the ASD1 and ASD2 elements have only been found in Shrm-related proteins and do not appear in combination with other conserved domains. ASD1 is required for targeting actin, while ASD2 is capable of eliciting an actomyosin based constriction event [, ]. ASD2 is the most highly conserved sequence element shared by Shrm1, Shrm2, Shrm3, and Shrm4. It possesses a well conserved series of leucine residues that exhibit spacing consistent with that of a leucine zipper motif [].  This region is found in the actin binding protein Shroom. ASD1 has been implicated directly in F-actin binding. 
Probab=30.55  E-value=18  Score=24.89  Aligned_cols=12  Identities=42%  Similarity=0.916  Sum_probs=10.5

Q ss_pred             cccCCchHHHHH
Q psy11264          8 ALSSPEKLDRIG   19 (50)
Q Consensus         8 als~PeKLDRIG   19 (50)
                      +-|-|||++.||
T Consensus       138 SYSEPEKmneVG  149 (182)
T PF08688_consen  138 SYSEPEKMNEVG  149 (182)
T ss_pred             ccCCchhhhhcc
Confidence            458999999999


No 36 
>PRK05728 DNA polymerase III subunit chi; Validated
Probab=30.11  E-value=88  Score=19.57  Aligned_cols=15  Identities=27%  Similarity=0.417  Sum_probs=11.3

Q ss_pred             CcceeeecccCCchH
Q psy11264          1 MDKLTFYALSSPEKL   15 (50)
Q Consensus         1 M~KLtfYals~PeKL   15 (50)
                      |.+..||-++.++++
T Consensus         1 Mt~v~FY~l~~~~~~   15 (142)
T PRK05728          1 MTRADFYHLTLSALE   15 (142)
T ss_pred             CCeEEEEecCchhHH
Confidence            889999999555543


No 37 
>PF04501 Baculo_VP39:  Baculovirus major capsid protein VP39;  InterPro: IPR007589 This family constitutes the 39 kDa major capsid protein of the Baculoviridae [].; GO: 0005198 structural molecule activity, 0019028 viral capsid
Probab=29.27  E-value=35  Score=25.35  Aligned_cols=23  Identities=35%  Similarity=0.530  Sum_probs=19.3

Q ss_pred             Ccceeeecc-cCCchHHHHHHHHH
Q psy11264          1 MDKLTFYAL-SSPEKLDRIGDYLY   23 (50)
Q Consensus         1 M~KLtfYal-s~PeKLDRIG~YL~   23 (50)
                      ||||.||-+ ..+++.|+|-+.|.
T Consensus       112 ~EqlIfh~IY~n~~~~~~iC~~L~  135 (300)
T PF04501_consen  112 AEQLIFHMIYENQEKIDRICKSLR  135 (300)
T ss_pred             hhhheeeeecCCHHHHHHHHHHHH
Confidence            689999988 56889999988875


No 38 
>PLN02605 monogalactosyldiacylglycerol synthase
Probab=28.90  E-value=96  Score=21.16  Aligned_cols=27  Identities=7%  Similarity=0.252  Sum_probs=17.4

Q ss_pred             HHHHHHHHhHHhhhhccCceeEEeeeecc
Q psy11264         19 GDYLYETASRDISRKRTQCSSTISTHQIP   47 (50)
Q Consensus        19 G~YL~~rl~RDl~R~R~~~v~iis~~~i~   47 (50)
                      +..+..+|.+-|.+.+  .=.|||||.++
T Consensus        85 ~~~~~~~l~~~i~~~~--pDvIi~thp~~  111 (382)
T PLN02605         85 SAFVAREVAKGLMKYK--PDIIVSVHPLM  111 (382)
T ss_pred             HHHHHHHHHHHHHhcC--cCEEEEeCcCc
Confidence            4455567777666554  45777888763


No 39 
>PRK10122 GalU regulator GalF; Provisional
Probab=27.41  E-value=40  Score=23.12  Aligned_cols=22  Identities=14%  Similarity=0.083  Sum_probs=19.2

Q ss_pred             eecccCCchHHHHHHHHHHHHh
Q psy11264          6 FYALSSPEKLDRIGDYLYETAS   27 (50)
Q Consensus         6 fYals~PeKLDRIG~YL~~rl~   27 (50)
                      -||++.|++.++|=+++.+.|+
T Consensus       275 ~~~~~~~~~~~~~~~~~~~~~~  296 (297)
T PRK10122        275 KYGLRNLKEGAKFRKGIEKLLS  296 (297)
T ss_pred             HHHhcChhHHHHHHHHHHHHhc
Confidence            4789999999999999998876


No 40 
>PRK08558 adenine phosphoribosyltransferase; Provisional
Probab=27.06  E-value=49  Score=22.53  Aligned_cols=35  Identities=26%  Similarity=0.223  Sum_probs=25.8

Q ss_pred             ccCCchHHHHHHHHHHHHhHHhhhhccCceeEEeeeecc
Q psy11264          9 LSSPEKLDRIGDYLYETASRDISRKRTQCSSTISTHQIP   47 (50)
Q Consensus         9 ls~PeKLDRIG~YL~~rl~RDl~R~R~~~v~iis~~~i~   47 (50)
                      +++|+=++.+|+.+++++..    .....|..+-++.||
T Consensus        90 l~~p~~~~~v~~~la~~~~~----~~~D~Vvtv~~~GI~  124 (238)
T PRK08558         90 VFDPSFLRLIAPVVAERFMG----LRVDVVLTAATDGIP  124 (238)
T ss_pred             hcCHHHHHHHHHHHHHHccC----CCCCEEEEECcccHH
Confidence            57899999999999999852    234556666666665


No 41 
>PRK15433 branched-chain amino acid transport system 2 carrier protein BrnQ; Provisional
Probab=26.94  E-value=22  Score=27.02  Aligned_cols=20  Identities=30%  Similarity=0.531  Sum_probs=14.5

Q ss_pred             eeecccCCchH-HHHHHHHHH
Q psy11264          5 TFYALSSPEKL-DRIGDYLYE   24 (50)
Q Consensus         5 tfYals~PeKL-DRIG~YL~~   24 (50)
                      +||---+|.|+ |+||++|.=
T Consensus       133 ~~~l~l~p~klvd~iGK~LTP  153 (439)
T PRK15433        133 VILVSLYPGKLLDTVGNFLAP  153 (439)
T ss_pred             HHHHHcChhhHHHHhHHHHHH
Confidence            44555578885 999999864


No 42 
>PF02900 LigB:  Catalytic LigB subunit of aromatic ring-opening dioxygenase;  InterPro: IPR004183 Dioxygenases catalyse the incorporation of both atoms of molecular oxygen into substrates using a variety of reaction mechanisms. Cleavage of aromatic rings is one of the most important functions of dioxygenases, which play key roles in the degradation of aromatic compounds. The substrates of ring-cleavage dioxygenases can be classified into two groups according to the mode of scission of the aromatic ring. Intradiol enzymes (IPR000627 from INTERPRO) use a non-haem Fe(III) to cleave the aromatic ring between two hydroxyl groups (ortho-cleavage), whereas extradiol enzymes use a non-haem Fe(II) to cleave the aromatic ring between a hydroxylated carbon and an adjacent non-hydroxylated carbon (meta-cleavage) [, ]. These two subfamilies differ in sequence, structural fold, iron ligands, and the orientation of second sphere active site amino acid residues. Extradiol dioxygenases are usually homo-multimeric, bind one atom of ferrous ion per subunit and have a subunit size of about 33 kDa. Extradiol dioxygenases can be divided into three classes. Class I and II enzymes (IPR000486 from INTERPRO) show sequence similarity, with the two-domain class II enzymes having evolved from a class I enzyme through gene duplication. Class III enzymes are different in sequence and structure, but they do share several common active-site characteristics with the class II enzymes, in particular the coordination sphere and the disposition of the putative catalytic base are very similar. Class III enzymes usually have two subunits, designated A and B. Enzymes that belong to the extradiol class III family include Protocatechuate 4,5-dioxygenase (4,5-PCD; LigAB) (1.13.11.8 from EC) []; and 2'-aminobiphenyl-2,3-diol 1,2-dioxygenase (CarBaBb) []. The crystal structure of dioxygenase LigAB revealed that the molecule is an alpha2beta2 tetramer. The active site contains a non-heme iron coordinated by His12, His61, Glu242, and a water molecule located in a deep cleft of the beta subunit, which is covered by the alpha subunit []. This entry represents the structural domain of subunit B.; GO: 0008198 ferrous iron binding, 0016491 oxidoreductase activity, 0006725 cellular aromatic compound metabolic process; PDB: 2PW6_A 1B4U_D 1BOU_B.
Probab=26.50  E-value=77  Score=20.95  Aligned_cols=25  Identities=16%  Similarity=0.260  Sum_probs=20.2

Q ss_pred             HHHHhHHhhhhccCceeEEeeeecc
Q psy11264         23 YETASRDISRKRTQCSSTISTHQIP   47 (50)
Q Consensus        23 ~~rl~RDl~R~R~~~v~iis~~~i~   47 (50)
                      .+++.+.|...+-.-+.|||.|...
T Consensus        30 ~~~~~~~l~~~~pd~ivvis~h~~~   54 (272)
T PF02900_consen   30 LQELGRRLREAKPDVIVVISPHWFT   54 (272)
T ss_dssp             HHHHHHHCHSTS-SEEEEEEEEECC
T ss_pred             HHHHHHHHHHcCCCEEEEEeCCcch
Confidence            5778888888899999999999764


No 43 
>cd03299 ABC_ModC_like Archeal protein closely related to ModC.  ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=26.14  E-value=99  Score=19.78  Aligned_cols=33  Identities=15%  Similarity=0.098  Sum_probs=22.8

Q ss_pred             hHHHHHHHHHHHHhHHhhhhccCceeEEeeeecc
Q psy11264         14 KLDRIGDYLYETASRDISRKRTQCSSTISTHQIP   47 (50)
Q Consensus        14 KLDRIG~YL~~rl~RDl~R~R~~~v~iis~~~i~   47 (50)
                      -||..+......+-+++.. ..|...+|++|.++
T Consensus       159 gLD~~~~~~l~~~l~~~~~-~~~~tili~tH~~~  191 (235)
T cd03299         159 ALDVRTKEKLREELKKIRK-EFGVTVLHVTHDFE  191 (235)
T ss_pred             cCCHHHHHHHHHHHHHHHH-hcCCEEEEEecCHH
Confidence            4667776666666667654 44778899999764


No 44 
>PRK01470 tatA twin arginine translocase protein A; Provisional
Probab=25.94  E-value=78  Score=17.69  Aligned_cols=17  Identities=18%  Similarity=0.120  Sum_probs=13.9

Q ss_pred             CCchHHHHHHHHHHHHh
Q psy11264         11 SPEKLDRIGDYLYETAS   27 (50)
Q Consensus        11 ~PeKLDRIG~YL~~rl~   27 (50)
                      =|+||..+|.-+-+-+.
T Consensus        20 Gp~KLP~l~r~lG~~i~   36 (51)
T PRK01470         20 GAGKLPQVMSDLAKGLK   36 (51)
T ss_pred             CchHhHHHHHHHHHHHH
Confidence            38999999999887554


No 45 
>TIGR00754 bfr bacterioferritin. Bacterioferritin is a homomultimer most species. In Neisseria gonorrhoeae, Synechocystis PCC6803, Magnetospirillum magnetotacticum, and Pseudomonas aeruginosa, two types of subunit are found in a heteromultimeric complex, with each species having one member of each type. At present, both types of subunit are including in this single model.
Probab=25.62  E-value=48  Score=20.35  Aligned_cols=15  Identities=40%  Similarity=0.793  Sum_probs=12.0

Q ss_pred             chHHHHH--HHHHHHHh
Q psy11264         13 EKLDRIG--DYLYETAS   27 (50)
Q Consensus        13 eKLDRIG--~YL~~rl~   27 (50)
                      +.++|+|  .||++.++
T Consensus       139 ~~~~~~g~~~y~~~~~~  155 (157)
T TIGR00754       139 ELIDKLGLENYLQAQVS  155 (157)
T ss_pred             HHHHHhHHHHHHHHhcC
Confidence            4678899  79998876


No 46 
>COG0276 HemH Protoheme ferro-lyase (ferrochelatase) [Coenzyme metabolism]
Probab=25.50  E-value=81  Score=23.19  Aligned_cols=30  Identities=17%  Similarity=0.403  Sum_probs=21.4

Q ss_pred             HHHHHHHhHHhhhh-ccCceeEEeeeecccC
Q psy11264         20 DYLYETASRDISRK-RTQCSSTISTHQIPRK   49 (50)
Q Consensus        20 ~YL~~rl~RDl~R~-R~~~v~iis~~~i~~~   49 (50)
                      +++++..+..+... |.+.+.+.|.|-||.+
T Consensus       167 ~a~a~~I~~~~~~~~~~~~~llfSaHglP~~  197 (320)
T COG0276         167 EALADSIREKLAKHPRDDDVLLFSAHGLPKR  197 (320)
T ss_pred             HHHHHHHHHHHHhcCCCCeEEEEecCCCchh
Confidence            34555555555554 6788999999999964


No 47 
>PF08388 GIIM:  Group II intron, maturase-specific domain;  InterPro: IPR013597 This region is found mainly in various bacterial and archaeal species, but a few members of this family are expressed by fungal and chlamydomonal species. It has been implicated in the binding of intron RNA during reverse transcription and splicing []. 
Probab=25.38  E-value=68  Score=17.27  Aligned_cols=28  Identities=18%  Similarity=0.604  Sum_probs=22.1

Q ss_pred             eecccCCch-HHHHHHHHHHHHhHHhhhh
Q psy11264          6 FYALSSPEK-LDRIGDYLYETASRDISRK   33 (50)
Q Consensus         6 fYals~PeK-LDRIG~YL~~rl~RDl~R~   33 (50)
                      ||..+.+.+ +..|..++.++|.+=+.|+
T Consensus        38 Yy~~~~~~~~f~~ld~~v~~~l~~w~~rr   66 (80)
T PF08388_consen   38 YYRIGNSSKTFSKLDHYVWRRLRRWLRRR   66 (80)
T ss_pred             hhcchhHHHHHHHHHHHHHHHHHHHHHHh
Confidence            677776666 7888899999998887764


No 48 
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms]
Probab=25.35  E-value=1e+02  Score=21.19  Aligned_cols=31  Identities=19%  Similarity=0.188  Sum_probs=23.1

Q ss_pred             HHHHHHHHHHHHhHHhhhhccCceeEEeeeec
Q psy11264         15 LDRIGDYLYETASRDISRKRTQCSSTISTHQI   46 (50)
Q Consensus        15 LDRIG~YL~~rl~RDl~R~R~~~v~iis~~~i   46 (50)
                      ||-.+......+-+++.+ +.|-..+||+|.+
T Consensus       167 LDp~~~~~~~~~l~~l~~-~g~~tvlissH~l  197 (293)
T COG1131         167 LDPESRREIWELLRELAK-EGGVTILLSTHIL  197 (293)
T ss_pred             CCHHHHHHHHHHHHHHHh-CCCcEEEEeCCcH
Confidence            677777777777788776 3336889999975


No 49 
>TIGR01411 tatAE twin arginine-targeting protein translocase, TatA/E family. This model distinguishes TatA/E from the related TatB, but does not distinguish TatA from TatE. The Tat (twin-arginine translocation) system is a Sec-independent exporter for folded proteins, often with a redox cofactor already bound, across the bacterial inner membrane. Functionally equivalent systems are found in the chloroplast and some in archaeal species. The signal peptide recognized by the Tat system is modeled by TIGR01409.
Probab=25.33  E-value=83  Score=16.97  Aligned_cols=16  Identities=25%  Similarity=0.337  Sum_probs=12.8

Q ss_pred             CCchHHHHHHHHHHHH
Q psy11264         11 SPEKLDRIGDYLYETA   26 (50)
Q Consensus        11 ~PeKLDRIG~YL~~rl   26 (50)
                      =|+||..+|+-|-+=+
T Consensus        19 Gp~kLP~~~r~lG~~i   34 (47)
T TIGR01411        19 GAKKLPELGRDLGKAI   34 (47)
T ss_pred             CchHhHHHHHHHHHHH
Confidence            4899999998887644


No 50 
>TIGR00150 HI0065_YjeE ATPase, YjeE family. Members of this family have a conserved nucleotide-binding motif GXXGXGKT and a nucleotide-binding fold. Member protein YjeE of Haemophilus influenzae (HI0065) was shown to have ATPase activity.
Probab=25.07  E-value=49  Score=20.96  Aligned_cols=19  Identities=16%  Similarity=0.293  Sum_probs=16.5

Q ss_pred             cccCCchHHHHHHHHHHHH
Q psy11264          8 ALSSPEKLDRIGDYLYETA   26 (50)
Q Consensus         8 als~PeKLDRIG~YL~~rl   26 (50)
                      ++.+++..+++|+.|++.|
T Consensus         1 ~~~s~~~t~~l~~~l~~~l   19 (133)
T TIGR00150         1 ANPDEKAMDKFGKAFAKPL   19 (133)
T ss_pred             CCCCHHHHHHHHHHHHHhC
Confidence            5788999999999998876


No 51 
>PF05013 FGase:  N-formylglutamate amidohydrolase;  InterPro: IPR007709 Formylglutamate amidohydrolase (FGase) catalyzes the terminal reaction in the five-step pathway for histidine utilization in Pseudomonas putida. By this action, N-formyl-L-glutamate (FG) is hydrolyzed to produce L-glutamate plus formate [].; PDB: 2ODF_G 2Q7S_A.
Probab=24.85  E-value=66  Score=21.03  Aligned_cols=39  Identities=23%  Similarity=0.313  Sum_probs=23.0

Q ss_pred             cCCchHHHHHHH---HHHHHhHHhh--hhccCceeEEeeeeccc
Q psy11264         10 SSPEKLDRIGDY---LYETASRDIS--RKRTQCSSTISTHQIPR   48 (50)
Q Consensus        10 s~PeKLDRIG~Y---L~~rl~RDl~--R~R~~~v~iis~~~i~~   48 (50)
                      +..|.-.||..|   -.+.|..-|.  +.++|.|.+|+.|..|.
T Consensus       100 ~~~e~~~ri~~~y~Pyh~~l~~~l~~~~~~~g~~illd~HS~~~  143 (222)
T PF05013_consen  100 SAAERERRIERYYRPYHRALAALLERLRARFGKVILLDCHSMPP  143 (222)
T ss_dssp             EHHHHHHHHHHTHHHHHHHHHHHHHHHHHCCS-EEEEEEEEE-T
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCceEEEEeccCCC
Confidence            444555566655   2344444443  34699999999999875


No 52 
>PF08738 Gon7:  Gon7 family;  InterPro: IPR014849 In Saccharomyces cerevisiae Gon7 is a member of the KEOPS protein complex. A protein complex proposed to be involved in transcription and promoting telomere uncapping and telomere elongation []. 
Probab=24.78  E-value=72  Score=20.09  Aligned_cols=19  Identities=32%  Similarity=0.532  Sum_probs=15.7

Q ss_pred             HHHHHHHHHHHhHHhhhhc
Q psy11264         16 DRIGDYLYETASRDISRKR   34 (50)
Q Consensus        16 DRIG~YL~~rl~RDl~R~R   34 (50)
                      |+|-++|.+||.-|=.|..
T Consensus        68 ddIN~fLTeRMe~dK~~~~   86 (103)
T PF08738_consen   68 DDINEFLTERMEEDKARDA   86 (103)
T ss_pred             HHHHHHHHHHHHHHHhhhh
Confidence            7899999999998866543


No 53 
>PRK14839 undecaprenyl pyrophosphate synthase; Provisional
Probab=24.58  E-value=1e+02  Score=21.79  Aligned_cols=38  Identities=21%  Similarity=0.243  Sum_probs=25.0

Q ss_pred             cceeeecccC------CchHHHHHHHHHHHHhHHhhhhccCcee
Q psy11264          2 DKLTFYALSS------PEKLDRIGDYLYETASRDISRKRTQCSS   39 (50)
Q Consensus         2 ~KLtfYals~------PeKLDRIG~YL~~rl~RDl~R~R~~~v~   39 (50)
                      +-||+||.|.      ||-++-+=+-+...+.+.+..-....|+
T Consensus        55 ~~lTvYaFS~EN~~R~~~EV~~Lm~L~~~~l~~~~~~~~~~~ir   98 (239)
T PRK14839         55 GTLTLYAFSSDNWRRPAAEVGGLMRLLRAYLRNETERLARNGVR   98 (239)
T ss_pred             CEEEEEEechhhcCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCE
Confidence            3489999984      7788877777777776655443223344


No 54 
>PF13314 DUF4083:  Domain of unknown function (DUF4083)
Probab=24.55  E-value=46  Score=19.59  Aligned_cols=11  Identities=55%  Similarity=0.727  Sum_probs=8.9

Q ss_pred             CchHHHHHHHH
Q psy11264         12 PEKLDRIGDYL   22 (50)
Q Consensus        12 PeKLDRIG~YL   22 (50)
                      .+|||||=+-|
T Consensus        45 eqKLDrIIeLL   55 (58)
T PF13314_consen   45 EQKLDRIIELL   55 (58)
T ss_pred             HHHHHHHHHHH
Confidence            47999998765


No 55 
>PF08518 GIT_SHD:  Spa2 homology domain (SHD) of GIT;  InterPro: IPR013724 GIT proteins are signalling integrators with GTPase-activating function which may be involved in the organisation of the cytoskeletal matrix assembled at active zones (CAZ). The function of the CAZ might be to define sites of neurotransmitter release. Mutations in the Spa2 homology domain (SHD) domain of GIT1 described here interfere with the association of GIT1 with Piccolo, beta-PIX, and focal adhesion kinase []. 
Probab=24.49  E-value=56  Score=16.86  Aligned_cols=19  Identities=26%  Similarity=0.510  Sum_probs=16.6

Q ss_pred             chHHHHHHHHHHHHhHHhh
Q psy11264         13 EKLDRIGDYLYETASRDIS   31 (50)
Q Consensus        13 eKLDRIG~YL~~rl~RDl~   31 (50)
                      +||-++......-|+-||+
T Consensus         3 qKL~~Ls~~~F~eL~~DV~   21 (31)
T PF08518_consen    3 QKLARLSNQRFEELATDVY   21 (31)
T ss_pred             HHHHhCCHHHHHHHHHHHH
Confidence            6888888888999999986


No 56 
>PF09604 Potass_KdpF:  F subunit of K+-transporting ATPase (Potass_KdpF);  InterPro: IPR011726 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [, ]. The different types include:   F-ATPases (F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases), which are primarily found in eukaryotic vacuoles and catalyse ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases (though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases). P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   P-ATPases (sometime known as E1-E2 ATPases) (3.6.3.- from EC) are found in bacteria and in a number of eukaryotic plasma membranes and organelles []. P-ATPases function to transport a variety of different compounds, including ions and phospholipids, across a membrane using ATP hydrolysis for energy. There are many different classes of P-ATPases, each of which transports a specific type of ion: H+, Na+, K+, Mg2+, Ca2+, Ag+ and Ag2+, Zn2+, Co2+, Pb2+, Ni2+, Cd2+, Cu+ and Cu2+. P-ATPases can be composed of one or two polypeptides, and can usually assume two main conformations called E1 and E2. This entry represents the F subunit (KdpF) of a P-type K+-translocating ATPase (Kdp). KdpF is a very small integral membrane peptide. The kdpABC operon of Escherichia coli codes for the high affinity K+-translocating Kdp complex []. KdpF is found upstream of the KdpA subunit (IPR004623 from INTERPRO). Because of its very small size and highly hydrophobic character, it is sometimes missed in genome annotation. More information about this protein can be found at Protein of the Month: ATP Synthases [].
Probab=24.49  E-value=17  Score=17.98  Aligned_cols=9  Identities=67%  Similarity=1.213  Sum_probs=8.0

Q ss_pred             eecccCCch
Q psy11264          6 FYALSSPEK   14 (50)
Q Consensus         6 fYals~PeK   14 (50)
                      +||+=.|||
T Consensus        16 ~~aLl~PEr   24 (25)
T PF09604_consen   16 FYALLRPER   24 (25)
T ss_pred             HHHHhCccc
Confidence            689999998


No 57 
>PF15296 Codanin-1_C:  Codanin-1 C-terminus
Probab=24.16  E-value=1e+02  Score=19.71  Aligned_cols=24  Identities=21%  Similarity=0.419  Sum_probs=21.1

Q ss_pred             cCCchHHHHHHHHHHHHhHHhhhh
Q psy11264         10 SSPEKLDRIGDYLYETASRDISRK   33 (50)
Q Consensus        10 s~PeKLDRIG~YL~~rl~RDl~R~   33 (50)
                      ++|.+|-|.-|+.++|......++
T Consensus        78 ~Qp~SlRRtVeFV~ERv~sn~VK~  101 (121)
T PF15296_consen   78 SQPASLRRTVEFVSERVASNCVKH  101 (121)
T ss_pred             cCCHHHHHHHHHHHHHHHHHHHHH
Confidence            789999999999999998877654


No 58 
>cd03411 Ferrochelatase_N Ferrochelatase, N-terminal domain: Ferrochelatase (protoheme ferrolyase or HemH) is the terminal enzyme of the heme biosynthetic pathway. It catalyzes the insertion of ferrous iron into the protoporphyrin IX ring yielding protoheme. This enzyme is ubiquitous in nature and widely distributed in bacteria and eukaryotes. Recently, some archaeal members have been identified. The oligomeric state of these enzymes varies depending on the presence of a dimerization motif at the C-terminus.
Probab=24.13  E-value=65  Score=20.10  Aligned_cols=20  Identities=30%  Similarity=0.506  Sum_probs=16.6

Q ss_pred             cccCCchHHHHHHHHHHHHh
Q psy11264          8 ALSSPEKLDRIGDYLYETAS   27 (50)
Q Consensus         8 als~PeKLDRIG~YL~~rl~   27 (50)
                      ++=.||+++.+..||.+.++
T Consensus         7 n~G~P~~~~~v~~yL~~~~~   26 (159)
T cd03411           7 NLGGPESLEDVRPFLKNFLS   26 (159)
T ss_pred             eCCCCCCHHHHHHHHHHHcC
Confidence            45689999999999988654


No 59 
>PRK14838 undecaprenyl pyrophosphate synthase; Provisional
Probab=23.96  E-value=1.7e+02  Score=20.54  Aligned_cols=40  Identities=18%  Similarity=0.248  Sum_probs=27.4

Q ss_pred             cceeeeccc------CCchHHHHHHHHHHHHhHHhhhhccCceeEE
Q psy11264          2 DKLTFYALS------SPEKLDRIGDYLYETASRDISRKRTQCSSTI   41 (50)
Q Consensus         2 ~KLtfYals------~PeKLDRIG~YL~~rl~RDl~R~R~~~v~ii   41 (50)
                      +-||+||.|      .|+-++-+=+.+.+.+.+....++.-.|.+|
T Consensus        56 ~~lT~YaFS~EN~kR~~~Ev~~Lm~l~~~~l~~~~~~~~~irir~i  101 (242)
T PRK14838         56 KFLTLYTFSTENWNRPSDEVAALMSLLLDSIEEETFMKNNIRFRII  101 (242)
T ss_pred             CEEEEEeechhhcCCCHHHHHHHHHHHHHHHHHHHHHHcCcEEEEE
Confidence            348999987      3677888888888888776554444445544


No 60 
>cd01871 Rac1_like Rac1-like subfamily.  The Rac1-like subfamily consists of Rac1, Rac2, and Rac3 proteins, plus the splice variant Rac1b that contains a 19-residue insertion near switch II relative to Rac1.  While Rac1 is ubiquitously expressed, Rac2 and Rac3 are largely restricted to hematopoietic and neural tissues respectively.  Rac1 stimulates the formation of actin lamellipodia and membrane ruffles.  It also plays a role in cell-matrix adhesion and cell anoikis.  In intestinal epithelial cells, Rac1 is an important regulator of migration and mediates apoptosis.  Rac1 is also essential for RhoA-regulated actin stress fiber and focal adhesion complex formation.  In leukocytes, Rac1 and Rac2 have distinct roles in regulating cell morphology, migration, and invasion, but are not essential for macrophage migration or chemotaxis.  Rac3 has biochemical properties that are closely related to Rac1, such as effector interaction, nucleotide binding, and hydrolysis; Rac2 has a slower nucleoti
Probab=23.90  E-value=1.8e+02  Score=17.60  Aligned_cols=37  Identities=14%  Similarity=0.244  Sum_probs=24.4

Q ss_pred             eeecccCCchHHHHHHHHHHHHhHHhhhhccCceeEEeee
Q psy11264          5 TFYALSSPEKLDRIGDYLYETASRDISRKRTQCSSTISTH   44 (50)
Q Consensus         5 tfYals~PeKLDRIG~YL~~rl~RDl~R~R~~~v~iis~~   44 (50)
                      .-|.+++|+.++.+.++..+.+....   ..-.+.++..|
T Consensus        78 lv~d~~~~~sf~~~~~~~~~~~~~~~---~~~piilvgnK  114 (174)
T cd01871          78 ICFSLVSPASFENVRAKWYPEVRHHC---PNTPIILVGTK  114 (174)
T ss_pred             EEEECCCHHHHHHHHHHHHHHHHHhC---CCCCEEEEeeC
Confidence            45899999999999876666554421   23345555554


No 61 
>cd02431 Ferritin_CCC1_C CCC1-related domain of ferritin. Ferritin_CCC1_like_C: The proteins of this family contain two domains. This is the C-terminal domain that is closely related to the CCC1, a vacuole transmembrane protein functioning as an iron and manganese transporter. The N-terminal domain is similar to ferritin-like diiron-carboxylate proteins, which are involved in a variety of iron ion related functions, such as iron storage and regulation, mono-oxygenation, and reactive radical production. This family may be unique to certain bacteria and archaea.
Probab=23.89  E-value=65  Score=20.79  Aligned_cols=16  Identities=25%  Similarity=0.524  Sum_probs=14.1

Q ss_pred             HHHHHHHHHhHHhhhh
Q psy11264         18 IGDYLYETASRDISRK   33 (50)
Q Consensus        18 IG~YL~~rl~RDl~R~   33 (50)
                      +|+|+..|-.||..+.
T Consensus        49 ~G~YlS~kse~d~~~~   64 (149)
T cd02431          49 IGAYLSTKSESGVKES   64 (149)
T ss_pred             HHHHHHHhhHHhHHhc
Confidence            6899999999998764


No 62 
>cd01875 RhoG RhoG subfamily.  RhoG is a GTPase with high sequence similarity to members of the Rac subfamily, including the regions involved in effector recognition and binding.  However, RhoG does not bind to known Rac1 and Cdc42 effectors, including proteins containing a Cdc42/Rac interacting binding (CRIB) motif.  Instead, RhoG interacts directly with Elmo, an upstream regulator of Rac1, in a GTP-dependent manner and forms a ternary complex with Dock180 to induce activation of Rac1.  The RhoG-Elmo-Dock180 pathway is required for activation of Rac1 and cell spreading mediated by integrin, as well as for neurite outgrowth induced by nerve growth factor.  Thus RhoG activates Rac1 through Elmo and Dock180 to control cell morphology.  RhoG has also been shown to play a role in caveolar trafficking and has a novel role in signaling the neutrophil respiratory burst stimulated by G protein-coupled receptor (GPCR) agonists.  Most Rho proteins contain a lipid modification site at the C-termin
Probab=23.88  E-value=1.8e+02  Score=17.80  Aligned_cols=25  Identities=8%  Similarity=0.299  Sum_probs=18.3

Q ss_pred             eeeecccCCchHHHHHHHHHHHHhH
Q psy11264          4 LTFYALSSPEKLDRIGDYLYETASR   28 (50)
Q Consensus         4 LtfYals~PeKLDRIG~YL~~rl~R   28 (50)
                      +..|.+++|+.++.+-.+..+.+.+
T Consensus        79 ilvydit~~~Sf~~~~~~w~~~i~~  103 (191)
T cd01875          79 IICFSIASPSSYENVRHKWHPEVCH  103 (191)
T ss_pred             EEEEECCCHHHHHHHHHHHHHHHHh
Confidence            3568999999999997655554443


No 63 
>PF08544 GHMP_kinases_C:  GHMP kinases C terminal ;  InterPro: IPR013750 This domain is found in homoserine kinases (2.7.1.39 from EC), galactokinases (2.7.1.6 from EC) and mevalonate kinases (2.7.1.36 from EC). These kinases make up the GHMP kinase superfamily of ATP-dependent enzymes []. These enzymes are involved in the biosynthesis of isoprenes and amino acids as well as in carbohydrate metabolism. The C-terminal domain of homoserine kinase has a central alpha-beta plait fold and an insertion of four helices, which, together with the N-terminal fold, create a novel nucleotide binding fold [].; PDB: 2R3V_C 4EMD_A 4DXL_A 4ED4_A 2GS8_A 1K47_E 3GON_A 3K17_B 1PIE_A 2AJ4_A ....
Probab=23.64  E-value=70  Score=16.86  Aligned_cols=21  Identities=29%  Similarity=0.528  Sum_probs=16.4

Q ss_pred             eeeccc-CCchHHHHHHHHHHH
Q psy11264          5 TFYALS-SPEKLDRIGDYLYET   25 (50)
Q Consensus         5 tfYals-~PeKLDRIG~YL~~r   25 (50)
                      +.|++. .++..++|-+.|.+.
T Consensus        61 ~v~~l~~~~~~~~~v~~~l~~~   82 (85)
T PF08544_consen   61 TVFALCKDEDDAERVAEALREH   82 (85)
T ss_dssp             EEEEEESSHHHHHHHHHHHHHH
T ss_pred             eEEEEECCHHHHHHHHHHHHHh
Confidence            567888 888889988887654


No 64 
>PF02269 TFIID-18kDa:  Transcription initiation factor IID, 18kD subunit;  InterPro: IPR003195 This family includes the Spt3 yeast transcription factors and the 18 kDa subunit from human transcription initiation factor IID (TFIID-18). Determination of the crystal structure reveals an atypical histone fold [].; GO: 0006366 transcription from RNA polymerase II promoter; PDB: 1BH9_A 1BH8_A.
Probab=23.57  E-value=27  Score=20.88  Aligned_cols=26  Identities=27%  Similarity=0.386  Sum_probs=0.0

Q ss_pred             ceeeecccCCchHHHHHHHHHHHHhH
Q psy11264          3 KLTFYALSSPEKLDRIGDYLYETASR   28 (50)
Q Consensus         3 KLtfYals~PeKLDRIG~YL~~rl~R   28 (50)
                      -|.|--=.+|-||.|+-+||..+-.+
T Consensus        59 Dl~F~lR~D~~Kl~Rl~~~L~~k~~~   84 (93)
T PF02269_consen   59 DLLFLLRKDPKKLARLRELLSMKDEI   84 (93)
T ss_dssp             --------------------------
T ss_pred             HHHHHHhcCHHHHHHHHHHHHHHHHH
Confidence            35566667899999999999876433


No 65 
>cd07368 PhnC_Bs_like PhnC is a Class III Extradiol ring-cleavage dioxygenase involved in the polycyclic aromatic hydrocarbon (PAH) catabolic pathway. This subfamily is composed of Burkholderia sp. PhnC and similar poteins. PhnC is one of nine protein products encoded by the phn locus. These proteins are involved in the polycyclic aromatic hydrocarbon (PAH) catabolic pathway. PhnC is a member of the class III extradiol dioxygenase family, a group os enzymes which use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon. LigAB-like enzymes are usually composed of two subunits, designated A and B, which form a tetramer composed of two copies of each subunit. This model represents the catalytic subunit, B.
Probab=23.53  E-value=2.4e+02  Score=19.47  Aligned_cols=42  Identities=12%  Similarity=0.203  Sum_probs=27.6

Q ss_pred             Ccceee-ecccC-C------c--hHHHHHHHH--HHHHhHHhhhhccCceeEEe
Q psy11264          1 MDKLTF-YALSS-P------E--KLDRIGDYL--YETASRDISRKRTQCSSTIS   42 (50)
Q Consensus         1 M~KLtf-Yals~-P------e--KLDRIG~YL--~~rl~RDl~R~R~~~v~iis   42 (50)
                      |-|+.. |++|| |      |  +-+......  .+++.+.+...+..-+.|||
T Consensus         1 M~~iv~a~~~sH~P~i~~~~~~~~~~~~~~~~~a~~~~~~~v~~~~pD~ivvi~   54 (277)
T cd07368           1 MGKIVGGFMMPHDPVMFVTPTAPPAAQREICWHAYAICAERLAALQVTSVVVIG   54 (277)
T ss_pred             CcceeEEeecCCCccccCCCCCChHHHHHHHHHHHHHHHHHHHHcCCCEEEEEc
Confidence            667777 78888 2      2  113333333  46788889888888788887


No 66 
>PRK10646 ADP-binding protein; Provisional
Probab=23.23  E-value=77  Score=20.68  Aligned_cols=26  Identities=12%  Similarity=0.143  Sum_probs=21.0

Q ss_pred             CcceeeecccCCchHHHHHHHHHHHHh
Q psy11264          1 MDKLTFYALSSPEKLDRIGDYLYETAS   27 (50)
Q Consensus         1 M~KLtfYals~PeKLDRIG~YL~~rl~   27 (50)
                      |+..+| .++++|...++|+.|++.|.
T Consensus         1 m~~~~~-~~~s~~~t~~l~~~la~~l~   26 (153)
T PRK10646          1 MMNRVI-PLPDEQATLDLGARVAKACD   26 (153)
T ss_pred             CCceEE-ECCCHHHHHHHHHHHHHhCC
Confidence            666665 47899999999999988763


No 67 
>PRK14831 undecaprenyl pyrophosphate synthase; Provisional
Probab=23.18  E-value=1.3e+02  Score=21.07  Aligned_cols=29  Identities=24%  Similarity=0.344  Sum_probs=18.1

Q ss_pred             cceeeeccc------CCchHHHHHHHHHHHHhHHh
Q psy11264          2 DKLTFYALS------SPEKLDRIGDYLYETASRDI   30 (50)
Q Consensus         2 ~KLtfYals------~PeKLDRIG~YL~~rl~RDl   30 (50)
                      +=||+||.|      .++-++-+=+-+.+.+.+.+
T Consensus        66 ~~vT~yaFS~eN~kR~~~Ev~~Lm~L~~~~l~~~~  100 (249)
T PRK14831         66 GALTAYAFSTENWSRPLEEVNFLMTLFERVLRREL  100 (249)
T ss_pred             CEEEEeecchhhhCcCHHHHHHHHHHHHHHHHHHH
Confidence            348999999      45566665555555554433


No 68 
>PF00438 S-AdoMet_synt_N:  S-adenosylmethionine synthetase, N-terminal domain;  InterPro: IPR022628  The three domains of S-adenosylmethionine synthetase have the same alpha+beta fold. This entry represents the N-terminal domain of S-adenosylmethionine synthetase and is found in association with PF02772 from PFAM and PF02773 from PFAM. S-adenosylmethionine synthetase (MAT, 2.5.1.6 from EC) is the enzyme that catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP []. AdoMet is an important methyl donor for transmethylation and is also the propylamino donor in polyamine biosynthesis. In bacteria there is a single isoform of AdoMet synthetase (gene metK), there are two in budding yeast (genes SAM1 and SAM2) and in mammals while in plants there is generally a multigene family. The sequence of AdoMet synthetase is highly conserved throughout isozymes and species. The active sites of both the Escherichia coli and rat liver MAT reside between two subunits, with contributions from side chains of residues from both subunits, resulting in a dimer as the minimal catalytic entity. The side chains that contribute to the ligand binding sites are conserved between the two proteins. In the structures of complexes with the E. coli enzyme, the phosphate groups have the same positions in the (PPi plus Pi) complex and the (ADP plus Pi) complex, and are located at the bottom of a deep cavity with the adenosyl group nearer the entrance []; GO: 0004478 methionine adenosyltransferase activity; PDB: 3RV2_A 3TDE_B 3S82_B 3IML_B 2P02_A 2OBV_A 1QM4_B 1O9T_B 1O93_A 1O92_B ....
Probab=22.96  E-value=89  Score=19.48  Aligned_cols=20  Identities=30%  Similarity=0.662  Sum_probs=12.5

Q ss_pred             cCCchH-HHHHHHHHH-HHhHH
Q psy11264         10 SSPEKL-DRIGDYLYE-TASRD   29 (50)
Q Consensus        10 s~PeKL-DRIG~YL~~-rl~RD   29 (50)
                      =||+|+ |+|..-+.. =|..|
T Consensus        13 GHPDKicDqISDailD~~l~~d   34 (100)
T PF00438_consen   13 GHPDKICDQISDAILDACLKQD   34 (100)
T ss_dssp             TSHHHHHHHHHHHHHHHHHHH-
T ss_pred             CCchhhhceeeeccchHHHhcC
Confidence            489997 788877544 33444


No 69 
>PF02416 MttA_Hcf106:  mttA/Hcf106 family;  InterPro: IPR003369 Members of this protein family are involved in a sec-independent translocation mechanism. This pathway has been called the DeltapH pathway in chloroplasts []. Members of this family in Escherichia coli are involved in export of redox proteins with a "twin arginine" leader motif (S/T-R-R-X-F-L-K) []. This sec-independent pathway is termed TAT for twin-arginine translocation system. This system mainly transports proteins with bound cofactors that require folding prior to export.; GO: 0008565 protein transporter activity, 0015031 protein transport; PDB: 2L16_A.
Probab=22.81  E-value=1.1e+02  Score=16.70  Aligned_cols=16  Identities=25%  Similarity=0.380  Sum_probs=12.0

Q ss_pred             CCchHHHHHHHHHHHH
Q psy11264         11 SPEKLDRIGDYLYETA   26 (50)
Q Consensus        11 ~PeKLDRIG~YL~~rl   26 (50)
                      =|+||..+|.-|.+=+
T Consensus        18 Gp~kLP~~~r~lG~~i   33 (53)
T PF02416_consen   18 GPKKLPELARSLGKAI   33 (53)
T ss_dssp             -TTTHHHHHHHHHHHH
T ss_pred             CchHHHHHHHHHHHHH
Confidence            4899999998886543


No 70 
>KOG3142|consensus
Probab=22.76  E-value=25  Score=24.20  Aligned_cols=33  Identities=21%  Similarity=0.231  Sum_probs=26.2

Q ss_pred             eecccCCchHHHHHHHHHHHHhHHhhhhccCceeEEe
Q psy11264          6 FYALSSPEKLDRIGDYLYETASRDISRKRTQCSSTIS   42 (50)
Q Consensus         6 fYals~PeKLDRIG~YL~~rl~RDl~R~R~~~v~iis   42 (50)
                      +=++|.|+.+.+.    ..|+.+.+++=|-+|+.|++
T Consensus        46 ~~~fs~P~s~s~a----~sRi~~Nl~yF~~NY~~iv~   78 (187)
T KOG3142|consen   46 RSAFSRPRSLSDA----TSRIKRNLSYFRVNYVIIVA   78 (187)
T ss_pred             ccccCCCccHHHH----HHHHHHHHHHHHHhHHHHHH
Confidence            3468899999874    57888889988998887765


No 71 
>PRK09636 RNA polymerase sigma factor SigJ; Provisional
Probab=22.38  E-value=24  Score=23.59  Aligned_cols=15  Identities=27%  Similarity=0.687  Sum_probs=12.4

Q ss_pred             eeecccCCchHHHHH
Q psy11264          5 TFYALSSPEKLDRIG   19 (50)
Q Consensus         5 tfYals~PeKLDRIG   19 (50)
                      .+|.+-.|+||.+++
T Consensus       276 ~i~~~~~p~kl~~~~  290 (293)
T PRK09636        276 AIYDVRNPDKLTHLP  290 (293)
T ss_pred             EEEEEcCHHHhcCCC
Confidence            478899999998764


No 72 
>PF05798 Phage_FRD3:  Bacteriophage FRD3 protein;  InterPro: IPR008765 This is a group of proteins of unknown function from bacteriophage T2 and related phage. 
Probab=22.13  E-value=85  Score=19.42  Aligned_cols=19  Identities=21%  Similarity=0.165  Sum_probs=15.8

Q ss_pred             HhhhhccCceeEEeeeecc
Q psy11264         29 DISRKRTQCSSTISTHQIP   47 (50)
Q Consensus        29 Dl~R~R~~~v~iis~~~i~   47 (50)
                      .+-|+||+-+.|+|++.-|
T Consensus        16 EvIRNRyPelsi~si~d~~   34 (75)
T PF05798_consen   16 EVIRNRYPELSITSIQDSK   34 (75)
T ss_pred             HHHHccCCceEEEEeecCC
Confidence            4678999999999998644


No 73 
>PRK14833 undecaprenyl pyrophosphate synthase; Provisional
Probab=21.79  E-value=1.4e+02  Score=20.80  Aligned_cols=31  Identities=26%  Similarity=0.327  Sum_probs=21.4

Q ss_pred             cceeeecccC------CchHHHHHHHHHHHHhHHhhh
Q psy11264          2 DKLTFYALSS------PEKLDRIGDYLYETASRDISR   32 (50)
Q Consensus         2 ~KLtfYals~------PeKLDRIG~YL~~rl~RDl~R   32 (50)
                      +-||+||.|.      |+-++-+=+-+.+.+.+.+..
T Consensus        50 ~~lTvyaFS~eN~~R~~~Ev~~Lm~L~~~~l~~~~~~   86 (233)
T PRK14833         50 ECLTLYAFSTENWKRPKSEVDFLMKLLKKYLKDERST   86 (233)
T ss_pred             CEEEEeecchhhcCcCHHHHHHHHHHHHHHHHHHHHH
Confidence            3489999984      777787777677766654333


No 74 
>PRK14841 undecaprenyl pyrophosphate synthase; Provisional
Probab=21.55  E-value=1.2e+02  Score=20.99  Aligned_cols=31  Identities=19%  Similarity=0.363  Sum_probs=21.8

Q ss_pred             cceeeecccC------CchHHHHHHHHHHHHhHHhhh
Q psy11264          2 DKLTFYALSS------PEKLDRIGDYLYETASRDISR   32 (50)
Q Consensus         2 ~KLtfYals~------PeKLDRIG~YL~~rl~RDl~R   32 (50)
                      +-||+||.|.      |+-++-+=+-+.+.+.+.+..
T Consensus        49 k~lTvYaFS~eN~~R~~~Ev~~Lm~L~~~~l~~~~~~   85 (233)
T PRK14841         49 KYLTAFSFSTENWKRPKEEVEFLMDLFVQMIDREMEL   85 (233)
T ss_pred             CEEEEEeeeHhhcCCCHHHHHHHHHHHHHHHHHHHHH
Confidence            3589999984      677777777777777665443


No 75 
>COG3961 Pyruvate decarboxylase and related thiamine pyrophosphate-requiring enzymes [Carbohydrate transport and metabolism / Coenzyme metabolism / General function prediction only]
Probab=21.42  E-value=63  Score=26.02  Aligned_cols=12  Identities=33%  Similarity=0.971  Sum_probs=10.5

Q ss_pred             HHHHHHHHHHhH
Q psy11264         17 RIGDYLYETASR   28 (50)
Q Consensus        17 RIG~YL~~rl~R   28 (50)
                      .||+||.+||.+
T Consensus         5 tvG~YL~~RL~q   16 (557)
T COG3961           5 TVGDYLFDRLAQ   16 (557)
T ss_pred             eHHHHHHHHHHh
Confidence            589999999975


No 76 
>PRK13364 protocatechuate 4,5-dioxygenase subunit beta; Provisional
Probab=21.23  E-value=79  Score=22.21  Aligned_cols=44  Identities=11%  Similarity=0.046  Sum_probs=29.3

Q ss_pred             Ccceee-ecccC-CchH-------------HHHHHHHHHHHhHHhhhhccCceeEEe-eee
Q psy11264          1 MDKLTF-YALSS-PEKL-------------DRIGDYLYETASRDISRKRTQCSSTIS-THQ   45 (50)
Q Consensus         1 M~KLtf-Yals~-PeKL-------------DRIG~YL~~rl~RDl~R~R~~~v~iis-~~~   45 (50)
                      |-++.. |++|| |+--             +++- --.+++.+.+...+-.-+.||| -|.
T Consensus         1 M~~iv~~~~~sH~P~vg~~~~~~~~~~~~~~~v~-~a~~~~~~~v~~~~PDvvVvis~dH~   60 (278)
T PRK13364          1 MAKIIGGITTSHVPAIGGAIAKGLQQDPYWKPFF-DGFPPVREWLEKVKPDVAVVFYNDHG   60 (278)
T ss_pred             ChhhhceeecCCCCccccccccccccChhHHHHH-HHHHHHHHHHHHhCCCEEEEECCchH
Confidence            555554 77888 6432             2222 2357889999999988888888 553


No 77 
>PRK13810 orotate phosphoribosyltransferase; Provisional
Probab=21.22  E-value=81  Score=20.78  Aligned_cols=35  Identities=11%  Similarity=0.144  Sum_probs=27.1

Q ss_pred             ccCCchHHHHHHHHHHHHhHHhhhhccCceeEEeeeecc
Q psy11264          9 LSSPEKLDRIGDYLYETASRDISRKRTQCSSTISTHQIP   47 (50)
Q Consensus         9 ls~PeKLDRIG~YL~~rl~RDl~R~R~~~v~iis~~~i~   47 (50)
                      +++|+=+..||+-|++++..    .....|.-+....||
T Consensus        52 ~~~p~~~~~i~~~la~~~~~----~~~d~I~g~~~~Gip   86 (187)
T PRK13810         52 STDPKTLKLIARQAALRIKE----MDVDTVAGVELGGVP   86 (187)
T ss_pred             cCCHHHHHHHHHHHHHHhcc----CCCCEEEEEccchHH
Confidence            68999999999999998863    245667777777666


No 78 
>PF12682 Flavodoxin_4:  Flavodoxin; PDB: 3EDO_B 3KLB_A.
Probab=21.06  E-value=37  Score=21.46  Aligned_cols=28  Identities=14%  Similarity=0.343  Sum_probs=19.6

Q ss_pred             eeecccCCchHHHHHHHHHHHHhHHhhhhc
Q psy11264          5 TFYALSSPEKLDRIGDYLYETASRDISRKR   34 (50)
Q Consensus         5 tfYals~PeKLDRIG~YL~~rl~RDl~R~R   34 (50)
                      .||+.+  ..-.+|++.|++.+.-|+.+-+
T Consensus         5 vYyS~t--GnT~~vA~~Ia~~~gadi~eI~   32 (156)
T PF12682_consen    5 VYYSRT--GNTKKVAEKIAEKTGADIFEIE   32 (156)
T ss_dssp             EE--SS--SHHHHHHHHHHHCCT-EEEE-B
T ss_pred             EEECCC--chHHHHHHHHHHHHCCCEEEEE
Confidence            577666  8889999999999888877643


No 79 
>PLN02293 adenine phosphoribosyltransferase
Probab=20.88  E-value=88  Score=20.56  Aligned_cols=20  Identities=20%  Similarity=0.238  Sum_probs=17.7

Q ss_pred             ccCCchHHHHHHHHHHHHhH
Q psy11264          9 LSSPEKLDRIGDYLYETASR   28 (50)
Q Consensus         9 ls~PeKLDRIG~YL~~rl~R   28 (50)
                      +++||-++.+++.|++++..
T Consensus        41 ~~~p~~~~~~~~~l~~~~~~   60 (187)
T PLN02293         41 LLDPKAFKDTIDLFVERYRD   60 (187)
T ss_pred             hhCHHHHHHHHHHHHHHHhh
Confidence            57899999999999999954


No 80 
>PF08573 SAE2:  DNA repair protein endonuclease SAE2/CtIP C-terminus;  InterPro: IPR013882 SAE2 is a protein involved in repairing meiotic and mitotic double-strand breaks in DNA. It has been shown to negatively regulate DNA damage checkpoint signalling [, ]. SAE2 is homologous to the CtIP proteins in mammals and an homologous protein in plants. Crucial sequence motifs that are highly conserved are the CxxC and the RHR motifs in this C-terminal part of the protein []. It is now known to be an endonuclease. In budding yeast, genetic evidence suggests that the SAE2 protein is essential for the processing of hairpin DNA intermediates and meiotic double-strand breaks by Mre11/Rad50 complexes. SAE2 binds DNA and exhibits endonuclease activity on single-stranded DNA independently of Mre11/Rad50 complexes, but hairpin DNA structures are cleaved cooperatively in the presence of Mre11/Rad50 or Mre11/Rad50/Xrs2. Hairpin structures are not processed at the tip by SAE2 but rather at single-stranded DNA regions adjacent to the hairpin. The catalytic activities of SAE2 are important for its biological functions [].
Probab=20.86  E-value=1e+02  Score=18.31  Aligned_cols=16  Identities=19%  Similarity=0.275  Sum_probs=13.7

Q ss_pred             HHHHhHHhhhhccCce
Q psy11264         23 YETASRDISRKRTQCS   38 (50)
Q Consensus        23 ~~rl~RDl~R~R~~~v   38 (50)
                      .+++...++|||+-+.
T Consensus        63 ~~~~~~~~sRHR~~~~   78 (93)
T PF08573_consen   63 KKELANKFSRHRYRYA   78 (93)
T ss_pred             HHHHHHHhccCCCCCC
Confidence            7788999999999773


No 81 
>PF05525 Branch_AA_trans:  Branched-chain amino acid transport protein;  InterPro: IPR004685 Characterised members of the branched chain Amino Acid:Cation Symporter (LIVCS) family transport all three of the branched chain aliphatic amino acids (leucine (L), isoleucine (I) and valine (V)). They function by a Na+ or H+ symport mechanism and display 12 putative transmembrane helical spanners.; GO: 0015658 branched-chain aliphatic amino acid transmembrane transporter activity, 0015803 branched-chain aliphatic amino acid transport, 0016021 integral to membrane
Probab=20.84  E-value=34  Score=25.77  Aligned_cols=20  Identities=40%  Similarity=0.718  Sum_probs=13.9

Q ss_pred             eeecccCCch-HHHHHHHHHH
Q psy11264          5 TFYALSSPEK-LDRIGDYLYE   24 (50)
Q Consensus         5 tfYals~PeK-LDRIG~YL~~   24 (50)
                      +||---+|.| +|+||++|.=
T Consensus       129 ~~~l~~~p~kivd~iGk~LTP  149 (427)
T PF05525_consen  129 TYLLSLNPSKIVDRIGKFLTP  149 (427)
T ss_pred             HHHHHhchhhHHHHHHHHHHH
Confidence            3444456777 4999999863


No 82 
>PHA03065 Hypothetical protein; Provisional
Probab=20.80  E-value=73  Score=24.98  Aligned_cols=44  Identities=25%  Similarity=0.368  Sum_probs=32.7

Q ss_pred             cceeee-cccCCchHHHHHHHHHHHH---------------------hHHhhhhccCceeEEeeee
Q psy11264          2 DKLTFY-ALSSPEKLDRIGDYLYETA---------------------SRDISRKRTQCSSTISTHQ   45 (50)
Q Consensus         2 ~KLtfY-als~PeKLDRIG~YL~~rl---------------------~RDl~R~R~~~v~iis~~~   45 (50)
                      +||.|| -|+.+..|.++-+-.-.++                     .|.++.+--.|-.+||+.|
T Consensus       132 ~Kl~F~~fLa~~~nlk~~l~~~L~~~~~~v~I~yCdgvDAEfvMC~~ak~~a~~~g~WPl~iStDQ  197 (438)
T PHA03065        132 DKLSFQLFLANSNNLKRLLESALARLGENVEIVYCDGVDAEFVMCARAKELAATTGEWPLLISTDQ  197 (438)
T ss_pred             HHHHHHHHHcchhhHHHHHHHHHHhccCCceEEEECCcchhHHHHHHHHHHHhhcCCCceEEeccC
Confidence            688888 8888888888877655555                     4566666667778888766


No 83 
>cd07949 PCA_45_Doxase_B_like_1 The B subunit of unknown Class III extradiol dioxygenases with similarity to Protocatechuate 4,5-dioxygenase. This subfamily is composed of proteins of unknown function with similarity to the B subunit of Protocatechuate 4,5-dioxygenase (LigAB). LigAB belongs to the class III extradiol dioxygenase family, a group of enzymes which use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon. Dioxygenases play key roles in the degradation of aromatic compounds. LigAB-like enzymes are usually composed of two subunits, designated A and B, which form a tetramer composed of two copies of each subunit. This model represents the catalytic subunit, B.
Probab=20.78  E-value=66  Score=22.39  Aligned_cols=23  Identities=4%  Similarity=0.138  Sum_probs=18.9

Q ss_pred             HHHHHhHHhhhhccCceeEEee-e
Q psy11264         22 LYETASRDISRKRTQCSSTIST-H   44 (50)
Q Consensus        22 L~~rl~RDl~R~R~~~v~iis~-~   44 (50)
                      =.+++.+.+...+-.-|.|||. |
T Consensus        36 a~~~~~~~v~~~~PD~iVvis~dH   59 (276)
T cd07949          36 GFPPVHDWLEKAKPDVAVVFYNDH   59 (276)
T ss_pred             HHHHHHHHHHHcCCCEEEEECCcH
Confidence            3578888998888898999995 7


No 84 
>PF13524 Glyco_trans_1_2:  Glycosyl transferases group 1
Probab=20.75  E-value=75  Score=17.08  Aligned_cols=20  Identities=35%  Similarity=0.507  Sum_probs=13.3

Q ss_pred             ecccCCchHHHHHHHHHHHH
Q psy11264          7 YALSSPEKLDRIGDYLYETA   26 (50)
Q Consensus         7 Yals~PeKLDRIG~YL~~rl   26 (50)
                      |.+++|+...+|++.-.++.
T Consensus        58 ~ll~~~~~~~~ia~~a~~~v   77 (92)
T PF13524_consen   58 YLLENPEERRRIAKNARERV   77 (92)
T ss_pred             HHHCCHHHHHHHHHHHHHHH
Confidence            34568888888777665554


No 85 
>TIGR03180 UraD_2 OHCU decarboxylase. Previously thought to only proceed spontaneously, the decarboxylation of 2-oxo-4-hydroxy-4-carboxy--5-ureidoimidazoline (OHCU) has been recently been shown to be catalyzed by this enzyme in Mus musculus. Homologs of this enzyme are found adjacent to and fused with uricase in a number of prokaryotes and are represented by this model. This model is a separate (but related) clade from that represented by TIGR3164. This model places a second homolog in streptomyces species which (are not in the vicinity of other urate catabolism associated genes) below the trusted cutoff.
Probab=20.52  E-value=70  Score=20.77  Aligned_cols=18  Identities=6%  Similarity=-0.129  Sum_probs=15.2

Q ss_pred             HHhhhhccCceeEEeeee
Q psy11264         28 RDISRKRTQCSSTISTHQ   45 (50)
Q Consensus        28 RDl~R~R~~~v~iis~~~   45 (50)
                      ..-|+.|+|++.||-++.
T Consensus       100 N~~Y~~kFGfpFii~v~g  117 (158)
T TIGR03180       100 NAAYEEKFGRIFLIRAAG  117 (158)
T ss_pred             HHHHHHHCCCeEEEeeCC
Confidence            467999999999998863


No 86 
>COG0347 GlnK Nitrogen regulatory protein PII [Amino acid transport and metabolism]
Probab=20.49  E-value=67  Score=20.66  Aligned_cols=17  Identities=35%  Similarity=0.462  Sum_probs=14.0

Q ss_pred             cccCCchHHHHHHHHHH
Q psy11264          8 ALSSPEKLDRIGDYLYE   24 (50)
Q Consensus         8 als~PeKLDRIG~YL~~   24 (50)
                      |+-.|+|||.+=+-|.+
T Consensus         6 aIiRP~kl~~vkeaL~~   22 (112)
T COG0347           6 AIIRPFKLDDVKEALEK   22 (112)
T ss_pred             EEeCHHHhHHHHHHHHH
Confidence            67789999999887754


No 87 
>PF06792 UPF0261:  Uncharacterised protein family (UPF0261);  InterPro: IPR008322 The proteins in this entry are functionally uncharacterised.
Probab=20.41  E-value=1.1e+02  Score=23.42  Aligned_cols=27  Identities=19%  Similarity=0.452  Sum_probs=21.2

Q ss_pred             cCCchHHHHHHHHHHHHhHHhhhhccCceeEE
Q psy11264         10 SSPEKLDRIGDYLYETASRDISRKRTQCSSTI   41 (50)
Q Consensus        10 s~PeKLDRIG~YL~~rl~RDl~R~R~~~v~ii   41 (50)
                      .+||-.-+||+.|++||.+     -.|.|.++
T Consensus       312 tt~eE~~~~g~~ia~kLn~-----~~gpv~v~  338 (403)
T PF06792_consen  312 TTPEENRQLGEFIAEKLNR-----AKGPVRVL  338 (403)
T ss_pred             CCHHHHHHHHHHHHHHHhc-----CCCCEEEE
Confidence            3688899999999999987     44556654


No 88 
>PF13454 NAD_binding_9:  FAD-NAD(P)-binding
Probab=20.37  E-value=2.2e+02  Score=17.27  Aligned_cols=18  Identities=28%  Similarity=0.466  Sum_probs=15.1

Q ss_pred             HHHHHHHHHHhHHhhhhc
Q psy11264         17 RIGDYLYETASRDISRKR   34 (50)
Q Consensus        17 RIG~YL~~rl~RDl~R~R   34 (50)
                      -.|+||.+++++-+.+-.
T Consensus        95 ~~G~YL~~~~~~~~~~~~  112 (156)
T PF13454_consen   95 LFGEYLRDRFDRLLARLP  112 (156)
T ss_pred             HHHHHHHHHHHHHHHhhc
Confidence            479999999999887763


Done!