Diaphorina citri psyllid: psy1126

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90---
MADIAEDFKEVIKENVTEAVKNATAKIPATPEGMAVAYGSLVAMALLPIFFGAHRSVKYHKNQKQFKAVMMLYLSPPSNQWISTNFNMSNLKL
cHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccc
******D*KEVI***VT*********IPATPEGMAVAYGSLVAMALLPIFFGAHRSVKYHKNQKQFKAVMMLYLSPPSNQWISTNFNMSNLK*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADIAEDFKEVIKENVTEAVKNATAKIPATPEGMAVAYGSLVAMALLPIFFGAHRSVKYHKNQKQFKAVMMLYLSPPSNQWISTNFNMSNLKL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0016020 [CC]membraneprobableGO:0005575
GO:0006465 [BP]signal peptide processingprobableGO:0044267, GO:0051604, GO:1901564, GO:0043603, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0034641, GO:0044237, GO:0043170, GO:0071704, GO:0010467, GO:0006807, GO:0008150, GO:0008152, GO:0016485, GO:0006518

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

No confident structure templates for the query are predicted