Diaphorina citri psyllid: psy11278


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------24
MKLDVSYTDHSHIIGRGGLTIKKVMEETGCHVHFPDSNRSVNAEKSNQVSIAGSLLGLERARYRVRELTPLIFCFEYPLMGSTPNANSPFVQIIQEAYNVQVMFRNRPKLQPTLVMVKGCEKDVERVKEATTKLIEHMCGSLANQTSVIMMMEISPQHHPIMEGPNAINLKTIMAQTGAQIVFPEANDPIIPVLKKSSVTVSGNIDSVYLARQMLVVSSVRPRRRLLLITIPNDIIKS
cCEECcccccccEEccccHHHHHHHHHcccEEEccccccccccccccEEEEEccHHHHHHHHHHHHccccCEEEECccccccccccccHHHHHHHHHcccEEEECccccccccEEEEEccHHHHHHHHHHHHHHHHHHHccccccccEEEEEEccccccccccccccccHHHHHHHcccEEEcccccccccccccccEEEEEccHHHHHHHHHHHHHccccccEEEEEEEcccccccc
MKLDVSYTDHSHIIGRGGLTIKKVMEETGCHVHFPDSNR***AEKSNQVSIAGSLLGLERARYRVRELTPLIFCFEYPLMGSTPNANSPFVQIIQEAYNVQVMFRNRPKLQPTLVMVKGCEKDVERVKEATTKLIEHMCGSLANQTSVIMMMEISPQHHPIMEGPNAINLKTIMAQTGAQIVFPEANDPIIPVLKKSSVTVSGNIDSVYLARQMLVVSSVRPRRRLLLITIPND****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLDVSYTDHSHIIGRGGLTIKKVMEETGCHVHFPDSNRSVNAEKSNQVSIAGSLLGLERARYRVRELTPLIFCFEYPLMGSTPNANSPFVQIIQEAYNVQVMFRNRPKLQPTLVMVKGCEKDVERVKEATTKLIEHMCGSLANQTSVIMMMEISPQHHPIMEGPNAINLKTIMAQTGAQIVFPEANDPIIPVLKKSSVTVSGNIDSVYLARQMLVVSSVRPRRRLLLITIPNDIIKS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein bicaudal C RNA-binding protein that is involved in oogenesis. Required for correct targeting of the migrating anterior follicle cells and the establishment of anterior-posterior polarity in the oocyte. May act as translational repressor of oskar during oogenesis. Function seems to be sensitive to small changes in expression.confidentQ24009
Protein bicaudal C homolog 1 Putative RNA-binding protein. May be involved in regulating gene expression during embryonic development.confidentQ99MQ1
Protein bicaudal C homolog 1 Putative RNA-binding protein. Acts as a negative regulator of Wnt signaling. May be involved in regulating gene expression during embryonic development.confidentQ9H694

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0090090 [BP]negative regulation of canonical Wnt receptor signaling pathwayprobableGO:0009968, GO:0008150, GO:0009966, GO:0048585, GO:0048583, GO:0048519, GO:0050794, GO:0050789, GO:0023057, GO:0030111, GO:0065007, GO:0010648, GO:0023051, GO:0048523, GO:0010646, GO:0030178, GO:0060828

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3N89, chain A
Confidence level:very confident
Coverage over the Query: 1-236
View the alignment between query and template
View the model in PyMOL