Query         psy11318
Match_columns 263
No_of_seqs    174 out of 2217
Neff          10.4
Searched_HMMs 46136
Date          Fri Aug 16 15:20:42 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy11318.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/11318hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus              100.0   5E-31 1.1E-35  202.1   6.6  134   29-166   130-266 (279)
  2 KOG2462|consensus              100.0 5.1E-30 1.1E-34  196.6   3.7  133   57-193   130-265 (279)
  3 KOG1074|consensus              100.0 1.2E-29 2.7E-34  218.9   1.3  142   58-201   606-937 (958)
  4 KOG3608|consensus               99.9 5.3E-24 1.1E-28  167.9   8.6  183    6-193   183-374 (467)
  5 KOG3623|consensus               99.9 9.1E-25   2E-29  186.3   4.5   78  114-193   895-972 (1007)
  6 KOG3608|consensus               99.9 5.7E-23 1.2E-27  162.1   6.7  185    6-195   140-345 (467)
  7 KOG1074|consensus               99.9 1.6E-23 3.4E-28  181.5   3.7  170    2-173   605-937 (958)
  8 KOG3623|consensus               99.8 8.2E-22 1.8E-26  168.5   3.2   77   86-164   895-971 (1007)
  9 KOG3576|consensus               99.8 1.5E-19 3.3E-24  132.5   3.6  108    2-109   117-236 (267)
 10 KOG3576|consensus               99.7 2.9E-19 6.4E-24  131.0   0.9  111   84-196   116-237 (267)
 11 PLN03086 PRLI-interacting fact  99.4 3.4E-13 7.4E-18  116.4   8.9   96   59-163   455-560 (567)
 12 PLN03086 PRLI-interacting fact  99.3 4.9E-12 1.1E-16  109.4   7.5  143   29-192   407-561 (567)
 13 PHA00733 hypothetical protein   99.1 3.7E-11 8.1E-16   85.2   4.2   82   27-110    38-124 (128)
 14 PHA00733 hypothetical protein   99.1 6.5E-11 1.4E-15   84.0   4.4   81   84-168    39-124 (128)
 15 KOG3993|consensus               99.1 1.1E-11 2.5E-16  100.9  -0.7  188    3-193   268-480 (500)
 16 PHA02768 hypothetical protein;  99.1 4.4E-11 9.5E-16   70.0   1.7   43    3-46      6-48  (55)
 17 PHA02768 hypothetical protein;  99.0 4.4E-10 9.4E-15   65.8   3.1   45  143-189     5-49  (55)
 18 KOG3993|consensus               98.6 3.2E-09   7E-14   86.9  -1.2   52   30-81    268-319 (500)
 19 PHA00732 hypothetical protein   98.6 2.4E-08 5.3E-13   64.3   2.8   49    2-55      1-50  (79)
 20 PF13465 zf-H2C2_2:  Zinc-finge  98.5 3.4E-08 7.3E-13   49.4   1.5   23  159-181     2-24  (26)
 21 PHA00616 hypothetical protein   98.5 6.3E-08 1.4E-12   54.0   2.2   33  143-175     1-33  (44)
 22 PF13465 zf-H2C2_2:  Zinc-finge  98.5 5.2E-08 1.1E-12   48.8   1.7   26  130-155     1-26  (26)
 23 PF05605 zf-Di19:  Drought indu  98.4 4.6E-07   1E-11   54.2   4.3   48    3-53      3-53  (54)
 24 PHA00616 hypothetical protein   98.4 1.2E-07 2.7E-12   52.8   1.6   33   30-62      2-34  (44)
 25 PF05605 zf-Di19:  Drought indu  98.3 9.2E-07   2E-11   52.9   4.5   50   29-81      2-53  (54)
 26 PHA00732 hypothetical protein   98.3 4.7E-07   1E-11   58.3   2.2   44   29-77      1-44  (79)
 27 PF00096 zf-C2H2:  Zinc finger,  98.2 1.1E-06 2.4E-11   42.6   1.9   22    3-24      1-22  (23)
 28 KOG2231|consensus               98.1 4.5E-05 9.8E-10   67.7  12.1  134   31-175   117-275 (669)
 29 PF00096 zf-C2H2:  Zinc finger,  98.0 4.9E-06 1.1E-10   40.3   2.1   22   30-51      1-22  (23)
 30 PF13894 zf-C2H2_4:  C2H2-type   97.9   7E-06 1.5E-10   40.0   2.1   23    3-25      1-23  (24)
 31 PF12756 zf-C2H2_2:  C2H2 type   97.9 6.5E-06 1.4E-10   56.1   2.7   23    5-27      2-24  (100)
 32 PF13894 zf-C2H2_4:  C2H2-type   97.9   1E-05 2.2E-10   39.4   2.3   24   30-53      1-24  (24)
 33 PF13912 zf-C2H2_6:  C2H2-type   97.7 2.1E-05 4.5E-10   39.7   1.8   25    2-26      1-25  (27)
 34 PF12756 zf-C2H2_2:  C2H2 type   97.7 2.2E-05 4.8E-10   53.4   2.4   73   31-108     1-73  (100)
 35 COG5236 Uncharacterized conser  97.6  0.0003 6.5E-09   56.9   7.2  130   29-168   151-306 (493)
 36 PF13912 zf-C2H2_6:  C2H2-type   97.6 3.5E-05 7.6E-10   38.8   1.3   25   29-53      1-25  (27)
 37 COG5189 SFP1 Putative transcri  97.6 4.5E-05 9.7E-10   60.8   2.3   53  140-192   346-419 (423)
 38 KOG1146|consensus               97.6 2.4E-05 5.3E-10   73.3   1.0   80    1-80    464-612 (1406)
 39 COG5189 SFP1 Putative transcri  97.5 2.6E-05 5.7E-10   62.1   0.8   54  111-164   347-419 (423)
 40 smart00355 ZnF_C2H2 zinc finge  97.4 0.00017 3.7E-09   35.6   2.3   23    3-25      1-23  (26)
 41 KOG2231|consensus               97.2  0.0011 2.3E-08   59.2   6.8  134    3-146   100-274 (669)
 42 PF13909 zf-H2C2_5:  C2H2-type   97.1 0.00027 5.9E-09   34.4   1.5   22    3-25      1-22  (24)
 43 PF09237 GAGA:  GAGA factor;  I  97.1  0.0004 8.7E-09   39.7   1.9   29   28-56     23-51  (54)
 44 KOG1146|consensus               97.1 0.00017 3.8E-09   67.9   0.6  129   60-193   439-611 (1406)
 45 PF13909 zf-H2C2_5:  C2H2-type   97.0 0.00053 1.1E-08   33.3   2.0   23   30-53      1-23  (24)
 46 smart00355 ZnF_C2H2 zinc finge  97.0 0.00086 1.9E-08   32.9   2.5   23   30-52      1-23  (26)
 47 PF09237 GAGA:  GAGA factor;  I  96.9 0.00059 1.3E-08   39.0   1.9   31  141-171    22-52  (54)
 48 PF12874 zf-met:  Zinc-finger o  96.9 0.00056 1.2E-08   33.6   1.6   22    3-24      1-22  (25)
 49 PF12874 zf-met:  Zinc-finger o  96.8 0.00076 1.6E-08   33.1   1.3   22   30-51      1-22  (25)
 50 COG5236 Uncharacterized conser  96.7  0.0023 4.9E-08   52.0   4.2  130    2-140   151-306 (493)
 51 PF12171 zf-C2H2_jaz:  Zinc-fin  96.5 0.00084 1.8E-08   33.7   0.5   22    3-24      2-23  (27)
 52 KOG2785|consensus               96.4  0.0084 1.8E-07   49.6   6.0   49    3-51      4-90  (390)
 53 PRK04860 hypothetical protein;  96.3  0.0018   4E-08   47.8   1.4   39  143-185   119-157 (160)
 54 KOG2785|consensus               96.2  0.0079 1.7E-07   49.7   4.4   51  143-193   166-242 (390)
 55 PF12171 zf-C2H2_jaz:  Zinc-fin  96.1  0.0013 2.9E-08   32.9  -0.2   22   30-51      2-23  (27)
 56 PRK04860 hypothetical protein;  95.9  0.0043 9.3E-08   45.9   1.8   34   30-67    120-153 (160)
 57 COG5048 FOG: Zn-finger [Genera  95.5  0.0017 3.6E-08   56.4  -2.0   60   29-88    289-354 (467)
 58 KOG2482|consensus               95.5   0.033 7.1E-07   45.5   5.2  134    3-138   145-357 (423)
 59 KOG2893|consensus               95.4   0.003 6.5E-08   48.6  -0.6   50   30-83     11-60  (341)
 60 KOG2482|consensus               95.3   0.042 9.1E-07   44.8   5.4   50  144-193   280-356 (423)
 61 KOG4173|consensus               95.1   0.011 2.4E-07   44.5   1.5  105   38-165    48-168 (253)
 62 smart00451 ZnF_U1 U1-like zinc  95.0   0.019   4E-07   30.6   1.8   21    3-23      4-24  (35)
 63 COG5048 FOG: Zn-finger [Genera  94.8  0.0059 1.3E-07   52.9  -0.9  142   56-197   288-444 (467)
 64 cd00350 rubredoxin_like Rubred  94.2   0.024 5.3E-07   29.8   1.1   24    3-37      2-25  (33)
 65 PF13913 zf-C2HC_2:  zinc-finge  94.2   0.045 9.8E-07   26.7   1.9   19    4-23      4-22  (25)
 66 PF13913 zf-C2HC_2:  zinc-finge  94.2   0.048   1E-06   26.6   2.0   21   30-51      3-23  (25)
 67 smart00451 ZnF_U1 U1-like zinc  94.1   0.035 7.7E-07   29.4   1.6   23   29-51      3-25  (35)
 68 TIGR02098 MJ0042_CXXC MJ0042 f  94.0   0.024 5.2E-07   30.9   0.9   36    1-40      1-36  (38)
 69 KOG2893|consensus               94.0   0.016 3.4E-07   44.8   0.1   51    2-55     10-60  (341)
 70 TIGR00622 ssl1 transcription f  93.2    0.11 2.5E-06   35.6   3.2   49  115-167    57-105 (112)
 71 KOG2186|consensus               92.8   0.047   1E-06   42.7   1.0   54    3-58      4-57  (276)
 72 PF12013 DUF3505:  Protein of u  92.7     0.2 4.4E-06   34.5   4.0   26  143-168    80-109 (109)
 73 PF13717 zinc_ribbon_4:  zinc-r  92.6    0.06 1.3E-06   28.9   1.0   35    1-39      1-35  (36)
 74 TIGR00622 ssl1 transcription f  92.4     0.2 4.4E-06   34.4   3.6   24  113-138    81-104 (112)
 75 PF09986 DUF2225:  Uncharacteri  92.1   0.022 4.8E-07   44.5  -1.6   23    1-23      4-26  (214)
 76 COG4049 Uncharacterized protei  91.9   0.094   2E-06   30.6   1.3   30  139-168    13-42  (65)
 77 PF12013 DUF3505:  Protein of u  91.7     0.4 8.7E-06   33.1   4.5   25   86-110    81-109 (109)
 78 KOG4173|consensus               91.5     0.1 2.3E-06   39.5   1.5   79   29-110    79-171 (253)
 79 cd00729 rubredoxin_SM Rubredox  90.5    0.13 2.8E-06   27.2   0.8   25    2-37      2-26  (34)
 80 COG4049 Uncharacterized protei  90.1    0.15 3.1E-06   29.8   0.9   26   84-109    16-41  (65)
 81 PF13719 zinc_ribbon_5:  zinc-r  89.6    0.19 4.2E-06   27.1   1.1   36    1-40      1-36  (37)
 82 smart00659 RPOLCX RNA polymera  87.7    0.31 6.6E-06   27.5   1.1   28    1-38      1-28  (44)
 83 PF06524 NOA36:  NOA36 protein;  87.7    0.23 4.9E-06   39.1   0.8   92   80-192   137-230 (314)
 84 PF09538 FYDLN_acid:  Protein o  86.3    0.56 1.2E-05   32.2   2.0   13   85-97     26-38  (108)
 85 PF06524 NOA36:  NOA36 protein;  85.7    0.72 1.6E-05   36.4   2.5   94   52-166   137-232 (314)
 86 smart00834 CxxC_CXXC_SSSS Puta  85.1    0.17 3.7E-06   27.9  -0.8   11    3-13      6-16  (41)
 87 smart00531 TFIIE Transcription  85.1    0.44 9.4E-06   34.9   1.1   36   28-67     98-133 (147)
 88 COG1592 Rubrerythrin [Energy p  83.2    0.67 1.5E-05   34.4   1.4   24  143-179   134-157 (166)
 89 TIGR02605 CxxC_CxxC_SSSS putat  82.5    0.27 5.9E-06   28.7  -0.7   11    3-13      6-16  (52)
 90 PF09538 FYDLN_acid:  Protein o  82.1     1.1 2.4E-05   30.8   2.0   30  144-184    10-39  (108)
 91 PF15269 zf-C2H2_7:  Zinc-finge  82.1       1 2.2E-05   25.1   1.5   21   30-50     21-41  (54)
 92 PRK00398 rpoP DNA-directed RNA  82.0    0.32   7E-06   27.7  -0.5   12    2-13      3-14  (46)
 93 PRK00464 nrdR transcriptional   82.0    0.18 3.9E-06   37.0  -2.0   16   30-45     29-44  (154)
 94 PF02892 zf-BED:  BED zinc fing  81.7     1.3 2.7E-05   24.9   1.9   23   29-51     16-42  (45)
 95 PF09986 DUF2225:  Uncharacteri  81.4    0.24 5.2E-06   38.7  -1.6   22   29-50      5-26  (214)
 96 smart00734 ZnF_Rad18 Rad18-lik  81.2     1.5 3.3E-05   21.5   1.8   19    4-23      3-21  (26)
 97 COG1996 RPC10 DNA-directed RNA  79.6    0.75 1.6E-05   26.5   0.4   11    2-12      6-16  (49)
 98 PF15269 zf-C2H2_7:  Zinc-finge  79.5     1.3 2.9E-05   24.6   1.4   21    2-22     20-40  (54)
 99 PF14353 CpXC:  CpXC protein     78.9    0.19   4E-06   35.9  -2.7   20   29-48     38-57  (128)
100 TIGR00373 conserved hypothetic  78.4     2.3   5E-05   31.5   2.9   34  139-181   105-138 (158)
101 TIGR00373 conserved hypothetic  77.5       3 6.5E-05   30.9   3.3   18   84-101   108-125 (158)
102 COG2888 Predicted Zn-ribbon RN  77.5     2.3   5E-05   25.4   2.1    8  113-120    50-57  (61)
103 PF02176 zf-TRAF:  TRAF-type zi  77.4     1.7 3.7E-05   26.1   1.6   21   42-62     23-43  (60)
104 smart00614 ZnF_BED BED zinc fi  77.0     2.5 5.3E-05   24.5   2.1   23   29-51     18-45  (50)
105 PF05443 ROS_MUCR:  ROS/MUCR tr  76.1     1.1 2.4E-05   31.9   0.6   26  143-171    72-97  (132)
106 PF08274 PhnA_Zn_Ribbon:  PhnA   75.7     1.1 2.3E-05   23.0   0.3   24    4-37      4-27  (30)
107 PF03604 DNA_RNApol_7kD:  DNA d  75.5     1.9 4.1E-05   22.4   1.2   26    3-38      1-26  (32)
108 TIGR02300 FYDLN_acid conserved  75.1     2.4 5.1E-05   29.8   1.9   30   86-128    10-39  (129)
109 PF09723 Zn-ribbon_8:  Zinc rib  74.0    0.53 1.2E-05   26.2  -1.2   11    3-13      6-16  (42)
110 PRK06266 transcription initiat  73.2     4.3 9.3E-05   30.8   3.1   13   58-70    118-130 (178)
111 PF05443 ROS_MUCR:  ROS/MUCR tr  73.2     2.1 4.6E-05   30.5   1.4   26   29-57     72-97  (132)
112 PRK06266 transcription initiat  73.1     3.3 7.2E-05   31.3   2.5   35  140-183   114-148 (178)
113 KOG1280|consensus               72.9     1.2 2.7E-05   36.7   0.2   36   58-93     80-117 (381)
114 COG4957 Predicted transcriptio  72.1     1.9 4.2E-05   30.4   1.0   25  144-171    77-101 (148)
115 COG5151 SSL1 RNA polymerase II  71.7     1.8 3.9E-05   35.2   0.9   26  142-167   387-412 (421)
116 PF10571 UPF0547:  Uncharacteri  71.4     2.7 5.9E-05   20.6   1.2    6  115-120    16-21  (26)
117 PRK04023 DNA polymerase II lar  70.4     4.5 9.9E-05   38.6   3.2    9   86-94    664-672 (1121)
118 PF07754 DUF1610:  Domain of un  70.3     1.7 3.7E-05   20.9   0.3    9    2-10     16-24  (24)
119 PF06220 zf-U1:  U1 zinc finger  69.9     3.7 7.9E-05   22.3   1.6   12    1-12      2-13  (38)
120 KOG2186|consensus               69.7     2.8   6E-05   33.2   1.4   48   30-80      4-51  (276)
121 smart00531 TFIIE Transcription  69.3     6.1 0.00013   28.9   3.2   37  141-181    97-133 (147)
122 TIGR01206 lysW lysine biosynth  69.1     2.1 4.6E-05   25.3   0.6   11    2-12      2-12  (54)
123 COG1592 Rubrerythrin [Energy p  69.0     3.3 7.1E-05   30.9   1.6   23   85-120   134-156 (166)
124 PRK09678 DNA-binding transcrip  68.6     1.4 3.1E-05   27.7  -0.2   12   58-69     28-41  (72)
125 PHA00626 hypothetical protein   68.2     2.2 4.8E-05   25.1   0.5   12    2-13     23-34  (59)
126 KOG2807|consensus               67.8     8.8 0.00019   31.7   3.9   25  143-167   345-369 (378)
127 COG1198 PriA Primosomal protei  67.3     3.4 7.4E-05   38.5   1.8   29  137-180   456-484 (730)
128 COG5188 PRP9 Splicing factor 3  67.1     8.1 0.00018   32.2   3.7   29  107-136   368-396 (470)
129 KOG4124|consensus               67.0    0.66 1.4E-05   38.3  -2.5   49    1-49    348-418 (442)
130 COG1198 PriA Primosomal protei  66.6     3.7   8E-05   38.2   1.8    9  112-120   474-482 (730)
131 KOG2593|consensus               65.9     5.7 0.00012   34.1   2.7   37  141-180   126-162 (436)
132 PF04959 ARS2:  Arsenite-resist  65.9     2.5 5.3E-05   33.0   0.5   27   29-55     77-103 (214)
133 KOG2807|consensus               65.7     9.5 0.00021   31.5   3.7   31  112-150   344-374 (378)
134 KOG1280|consensus               64.7     5.7 0.00012   33.0   2.4   23    3-25     80-102 (381)
135 PF13878 zf-C2H2_3:  zinc-finge  64.5     9.5 0.00021   21.0   2.6   26  114-139    14-39  (41)
136 PRK14890 putative Zn-ribbon RN  62.3     7.3 0.00016   23.4   1.9    8  113-120    48-55  (59)
137 COG1997 RPL43A Ribosomal prote  62.0     3.3 7.2E-05   26.9   0.5   11  144-154    54-64  (89)
138 COG3357 Predicted transcriptio  59.0     4.7  0.0001   26.4   0.8   27   84-120    57-83  (97)
139 COG5188 PRP9 Splicing factor 3  58.4      13 0.00028   31.1   3.3   22   86-107   239-260 (470)
140 PF09963 DUF2197:  Uncharacteri  57.8       4 8.6E-05   24.2   0.3   37    1-37      1-39  (56)
141 KOG2593|consensus               56.9     5.1 0.00011   34.4   0.9   35   29-66    128-162 (436)
142 KOG4377|consensus               56.4     3.5 7.7E-05   35.0  -0.1   25  144-168   402-428 (480)
143 KOG4377|consensus               55.8     4.4 9.4E-05   34.5   0.3   22  176-197   408-429 (480)
144 KOG4167|consensus               55.3     3.2 6.8E-05   38.0  -0.6   22    4-25    794-815 (907)
145 PRK14873 primosome assembly pr  53.1     8.3 0.00018   35.8   1.7    7   59-65    385-391 (665)
146 COG1773 Rubredoxin [Energy pro  52.9       6 0.00013   23.4   0.5   13    2-14      3-15  (55)
147 COG4530 Uncharacterized protei  52.3     9.7 0.00021   25.9   1.5   11   85-95     26-36  (129)
148 PF05191 ADK_lid:  Adenylate ki  52.3     5.4 0.00012   21.3   0.2   29  145-181     3-31  (36)
149 PF08790 zf-LYAR:  LYAR-type C2  51.6     3.3 7.1E-05   20.7  -0.6    8   32-39      3-10  (28)
150 PF14446 Prok-RING_1:  Prokaryo  51.5      12 0.00026   22.0   1.6   10    4-13      7-16  (54)
151 TIGR00595 priA primosomal prot  50.7     8.7 0.00019   34.4   1.4   13  138-150   235-247 (505)
152 PRK14714 DNA polymerase II lar  50.3      15 0.00032   36.4   2.8   11   57-67    692-702 (1337)
153 KOG4167|consensus               50.1     5.6 0.00012   36.5   0.1   26   58-83    793-818 (907)
154 PF04959 ARS2:  Arsenite-resist  49.7     8.1 0.00018   30.2   0.9   29   84-112    76-104 (214)
155 PF14445 Prok-RING_2:  Prokaryo  49.3     5.3 0.00012   22.9  -0.1   20    2-22      7-26  (57)
156 PF15135 UPF0515:  Uncharacteri  48.4      14 0.00031   29.2   2.1   26   41-66     91-121 (278)
157 TIGR00595 priA primosomal prot  48.3      11 0.00024   33.7   1.7    8  113-120   253-260 (505)
158 COG1655 Uncharacterized protei  47.7     3.4 7.3E-05   32.2  -1.4   27   29-55     19-45  (267)
159 PF05290 Baculo_IE-1:  Baculovi  47.1     3.8 8.3E-05   29.0  -1.1   54   28-99     79-135 (140)
160 PF00301 Rubredoxin:  Rubredoxi  46.5     6.9 0.00015   22.4   0.1   15    2-16      1-15  (47)
161 KOG1044|consensus               45.2     2.7 5.8E-05   37.3  -2.5   28  172-199   219-248 (670)
162 PF13453 zf-TFIIB:  Transcripti  44.8      11 0.00023   20.7   0.7   19   29-47     19-37  (41)
163 KOG0717|consensus               44.7      12 0.00027   32.5   1.3   22    3-24    293-314 (508)
164 COG2331 Uncharacterized protei  44.5     9.5 0.00021   24.1   0.5   31   30-67     13-43  (82)
165 PRK12380 hydrogenase nickel in  44.5     8.9 0.00019   26.6   0.4   25   29-65     70-94  (113)
166 PF03833 PolC_DP2:  DNA polymer  44.4     7.4 0.00016   36.5   0.0    8   30-37    656-663 (900)
167 PF12760 Zn_Tnp_IS1595:  Transp  44.0      17 0.00036   20.5   1.4    7  144-150    19-25  (46)
168 PF13824 zf-Mss51:  Zinc-finger  43.8      28  0.0006   20.7   2.3   14   29-42     14-27  (55)
169 PF09416 UPF1_Zn_bind:  RNA hel  43.8      33 0.00072   25.2   3.2   17   53-69     10-26  (152)
170 PF08271 TF_Zn_Ribbon:  TFIIB z  43.8     7.6 0.00016   21.5  -0.0    9    3-11      1-9   (43)
171 PF07282 OrfB_Zn_ribbon:  Putat  43.8      17 0.00036   22.4   1.6   29   31-69     30-58  (69)
172 PF01363 FYVE:  FYVE zinc finge  43.0      14  0.0003   22.8   1.1    9   31-39     11-19  (69)
173 KOG4124|consensus               43.0     9.4  0.0002   31.8   0.4   51  142-192   348-419 (442)
174 PF03884 DUF329:  Domain of unk  42.8     7.9 0.00017   23.1  -0.0   13    1-13      1-13  (57)
175 KOG3408|consensus               42.5      13 0.00028   25.9   0.9   23   29-51     57-79  (129)
176 PRK03824 hypA hydrogenase nick  40.4      10 0.00022   27.3   0.2   12   58-69     71-82  (135)
177 KOG2907|consensus               39.6      10 0.00022   26.0   0.1   11  144-154   103-113 (116)
178 TIGR00100 hypA hydrogenase nic  39.2      11 0.00024   26.2   0.2   26   29-66     70-95  (115)
179 PRK00432 30S ribosomal protein  38.1      14 0.00031   21.4   0.5   11   57-67     37-47  (50)
180 cd00730 rubredoxin Rubredoxin;  37.8      15 0.00033   21.3   0.6   12    3-14      2-13  (50)
181 smart00154 ZnF_AN1 AN1-like Zi  37.5      15 0.00032   20.0   0.5   13    2-14     12-24  (39)
182 smart00661 RPOL9 RNA polymeras  36.8      13 0.00028   21.4   0.2   11   29-39     20-30  (52)
183 KOG2636|consensus               36.3      23  0.0005   30.7   1.7   23   29-51    401-424 (497)
184 PF13451 zf-trcl:  Probable zin  36.1      22 0.00048   20.5   1.1   12   58-69      5-16  (49)
185 COG1571 Predicted DNA-binding   35.8      22 0.00048   30.8   1.5   32  145-187   352-383 (421)
186 PF06397 Desulfoferrod_N:  Desu  35.5      13 0.00029   19.8   0.1    9    3-11      7-15  (36)
187 PF04780 DUF629:  Protein of un  35.3      22 0.00048   31.3   1.5   25  143-167    57-81  (466)
188 PTZ00255 60S ribosomal protein  35.1      11 0.00024   24.9  -0.3   10  144-153    55-64  (90)
189 KOG0782|consensus               34.9     9.9 0.00022   33.9  -0.7   55   17-76    240-296 (1004)
190 KOG3408|consensus               34.6      28 0.00062   24.3   1.6   27  140-166    54-80  (129)
191 PRK05978 hypothetical protein;  34.1      13 0.00028   27.2  -0.1   32   29-69     33-64  (148)
192 smart00440 ZnF_C2C2 C2C2 Zinc   34.1     3.6 7.9E-05   22.5  -2.3    9  172-180    29-37  (40)
193 PRK00564 hypA hydrogenase nick  34.1      21 0.00045   25.0   0.9   14   29-42     71-84  (117)
194 PF11672 DUF3268:  Protein of u  34.0      16 0.00035   24.8   0.4   10    1-10      1-10  (102)
195 COG1571 Predicted DNA-binding   33.7      22 0.00048   30.8   1.2   30  115-157   352-381 (421)
196 PRK03681 hypA hydrogenase nick  32.9      22 0.00047   24.7   0.9   13   29-41     70-82  (114)
197 KOG2071|consensus               32.6      27 0.00058   31.5   1.6   23   30-52    419-441 (579)
198 PF04780 DUF629:  Protein of un  32.1      34 0.00073   30.2   2.1   27   30-56     58-84  (466)
199 COG4896 Uncharacterized protei  32.1      33 0.00071   20.7   1.4    9    2-10      2-10  (68)
200 PF14369 zf-RING_3:  zinc-finge  31.9      30 0.00065   18.3   1.1   11    2-12      2-12  (35)
201 PF01428 zf-AN1:  AN1-like Zinc  31.5      15 0.00032   20.4  -0.1   13    2-14     13-25  (43)
202 KOG0717|consensus               31.4      26 0.00056   30.6   1.2   22   30-51    293-314 (508)
203 CHL00174 accD acetyl-CoA carbo  31.2      31 0.00068   28.4   1.6   34   29-71     38-71  (296)
204 COG1656 Uncharacterized conser  30.9      48   0.001   24.6   2.4   18  143-160   130-147 (165)
205 TIGR00515 accD acetyl-CoA carb  30.8      33 0.00072   28.2   1.7   34   29-71     26-59  (285)
206 KOG1940|consensus               30.7      38 0.00083   27.6   2.0   46   58-104   197-253 (276)
207 PF01155 HypA:  Hydrogenase exp  29.9      18 0.00038   25.1   0.0   15   29-43     70-84  (113)
208 cd00065 FYVE FYVE domain; Zinc  29.8      37 0.00079   19.8   1.4    9   32-40      5-13  (57)
209 COG3677 Transposase and inacti  29.7      18 0.00039   25.8   0.0   11    3-13     54-64  (129)
210 KOG1842|consensus               29.6      30 0.00065   30.0   1.3   28   29-56     15-42  (505)
211 PF04438 zf-HIT:  HIT zinc fing  29.5      21 0.00046   18.1   0.3   11    2-12     13-23  (30)
212 COG3364 Zn-ribbon containing p  29.4      33 0.00072   23.1   1.2   14   29-42      2-15  (112)
213 PF14690 zf-ISL3:  zinc-finger   29.4     5.4 0.00012   22.5  -2.2   10    2-11      2-11  (47)
214 PF12907 zf-met2:  Zinc-binding  28.8      57  0.0012   17.9   1.9   26  144-169     2-30  (40)
215 PF14311 DUF4379:  Domain of un  28.5      36 0.00079   19.9   1.2   19   29-47     28-46  (55)
216 COG4888 Uncharacterized Zn rib  28.4     6.5 0.00014   26.3  -2.2   36   29-68     22-57  (104)
217 TIGR00310 ZPR1_znf ZPR1 zinc f  28.0     8.3 0.00018   29.6  -2.0   10   30-39     31-40  (192)
218 cd02341 ZZ_ZZZ3 Zinc finger, Z  27.7      40 0.00088   19.3   1.3   10   27-36     13-22  (48)
219 PF07975 C1_4:  TFIIH C1-like d  27.4      13 0.00029   21.6  -0.7   26  142-167    20-45  (51)
220 PRK05654 acetyl-CoA carboxylas  27.0      38 0.00082   28.0   1.5   33   29-70     27-59  (292)
221 PF03145 Sina:  Seven in absent  27.0      59  0.0013   24.9   2.5   19   16-34     31-49  (198)
222 PF14255 Cys_rich_CPXG:  Cystei  26.1      29 0.00062   20.3   0.5    8    4-11      2-9   (52)
223 PF07295 DUF1451:  Protein of u  25.6      25 0.00054   25.7   0.2   32  143-184   112-143 (146)
224 PF11789 zf-Nse:  Zinc-finger o  25.5      50  0.0011   19.7   1.4   14   57-70     24-37  (57)
225 KOG1842|consensus               25.5      43 0.00092   29.2   1.5   26   58-83     16-41  (505)
226 COG1779 C4-type Zn-finger prot  24.9      10 0.00023   28.9  -1.9   12   58-69     44-55  (201)
227 COG3091 SprT Zn-dependent meta  24.7      23 0.00051   25.8  -0.1   32  143-179   117-148 (156)
228 PF04810 zf-Sec23_Sec24:  Sec23  24.3      12 0.00025   20.5  -1.4   13  140-152    21-33  (40)
229 PF01780 Ribosomal_L37ae:  Ribo  24.1      33 0.00071   22.7   0.5   10    2-11     35-44  (90)
230 TIGR01562 FdhE formate dehydro  24.1      16 0.00036   30.2  -1.1   11   84-94    209-219 (305)
231 PF04606 Ogr_Delta:  Ogr/Delta-  24.1      13 0.00029   21.1  -1.2    8    5-12      2-9   (47)
232 COG1326 Uncharacterized archae  24.0      74  0.0016   24.4   2.4   11   85-95     30-40  (201)
233 PF08209 Sgf11:  Sgf11 (transcr  23.9      54  0.0012   17.1   1.2   21    3-24      5-25  (33)
234 PRK12860 transcriptional activ  23.7      45 0.00098   25.5   1.2   47  123-178   115-161 (189)
235 TIGR03830 CxxCG_CxxCG_HTH puta  23.5      32  0.0007   24.0   0.4   18   30-47     32-49  (127)
236 KOG4727|consensus               23.5      40 0.00086   25.1   0.9   23   29-51     75-97  (193)
237 smart00064 FYVE Protein presen  23.2      53  0.0011   20.0   1.3   10   31-40     12-21  (68)
238 KOG2636|consensus               23.0      67  0.0015   28.0   2.2   18   32-49    274-291 (497)
239 PTZ00448 hypothetical protein;  22.5      58  0.0013   27.7   1.7   23   29-51    314-336 (373)
240 KOG4118|consensus               22.1      68  0.0015   19.7   1.5   29  144-172    39-67  (74)
241 KOG3214|consensus               22.1      40 0.00087   22.6   0.6   38   29-70     23-60  (109)
242 PF13248 zf-ribbon_3:  zinc-rib  22.0      43 0.00093   16.2   0.6    9    2-10      2-10  (26)
243 PRK10220 hypothetical protein;  22.0      45 0.00097   22.9   0.8   30  145-185     5-34  (111)
244 COG1675 TFA1 Transcription ini  21.7 1.5E+02  0.0033   22.4   3.6   16   83-98    111-126 (176)
245 PF03811 Zn_Tnp_IS1:  InsA N-te  21.3      12 0.00025   20.1  -1.7    7  143-149    29-35  (36)
246 PLN02294 cytochrome c oxidase   21.2      31 0.00067   25.8  -0.1   15   26-40    138-152 (174)
247 TIGR00686 phnA alkylphosphonat  21.1      38 0.00082   23.2   0.4   30  145-185     4-33  (109)
248 cd00924 Cyt_c_Oxidase_Vb Cytoc  21.1      29 0.00062   23.4  -0.2   16   25-40     75-90  (97)
249 KOG2857|consensus               20.9      48   0.001   23.9   0.8   21    2-22     17-37  (157)
250 PF10013 DUF2256:  Uncharacteri  20.5      60  0.0013   18.0   1.0   16    4-19     10-25  (42)
251 PF05495 zf-CHY:  CHY zinc fing  20.4     8.8 0.00019   24.1  -2.6    8   58-65     42-49  (71)
252 KOG3990|consensus               20.0 1.5E+02  0.0032   23.8   3.4   37   58-94     38-79  (305)

No 1  
>KOG2462|consensus
Probab=99.97  E-value=5e-31  Score=202.11  Aligned_cols=134  Identities=28%  Similarity=0.554  Sum_probs=99.3

Q ss_pred             ccccCCCccccCChhHHHHHHHHhcCC---CceecccccccccchHHHHHHHHHhcCCCcccCCcCCCcCCCHHHHHHHH
Q psy11318         29 RYQCEECPKDFSTRKYLTQHQNAIHRG---IRFQCNKCFRAYKLKKDLLAHTMLEHFGIRHPCSECPKTFASRHSLKNHI  105 (263)
Q Consensus        29 ~~~C~~C~~~f~~~~~l~~H~~~~~~~---~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~  105 (263)
                      .|+|..||+.|.+..+|-+|..+|...   +.+.|..|++.|.+...|..|++.|.  .+.+|.+||+.|.+.+.|+.|+
T Consensus       130 r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQGHi  207 (279)
T KOG2462|consen  130 RYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLLQGHI  207 (279)
T ss_pred             ceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccC--CCcccccccccccchHHhhccc
Confidence            567777777777777777777665432   23666666666666666666665555  4577888888888888888888


Q ss_pred             HHhcCCccccCCCCCCCcccCCHHHHHHHHHHhCCCCCccCCcchhhhcChHHHHHHHhhc
Q psy11318        106 LKIHKAVLYQCNECSTSKDYLTKRDLRRHMKLHFNGKRYHCTQCSKFYIQESDLMEHMAVH  166 (263)
Q Consensus       106 ~~~~~~~~~~C~~C~~~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h  166 (263)
                      |.|+|||||.|+.|+  ++|...++|+.|+.+|.+.|+|.|..|++.|++.+-|.+|...-
T Consensus       208 RTHTGEKPF~C~hC~--kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~ES~  266 (279)
T KOG2462|consen  208 RTHTGEKPFSCPHCG--KAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHSESA  266 (279)
T ss_pred             ccccCCCCccCCccc--chhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhhhhc
Confidence            888888888888888  88888888888888888888888888888888888888886543


No 2  
>KOG2462|consensus
Probab=99.96  E-value=5.1e-30  Score=196.58  Aligned_cols=133  Identities=25%  Similarity=0.443  Sum_probs=127.1

Q ss_pred             ceecccccccccchHHHHHHHHHhcCC---CcccCCcCCCcCCCHHHHHHHHHHhcCCccccCCCCCCCcccCCHHHHHH
Q psy11318         57 RFQCNKCFRAYKLKKDLLAHTMLEHFG---IRHPCSECPKTFASRHSLKNHILKIHKAVLYQCNECSTSKDYLTKRDLRR  133 (263)
Q Consensus        57 ~~~C~~C~~~f~~~~~l~~H~~~~~~~---~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~~~f~~~~~l~~  133 (263)
                      .|+|+.|++.+.+..+|.+|.+.|..-   +-+.|++|++.+.+...|.+|++.|.  -+.+|.+||  +.|...+.|+.
T Consensus       130 r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCG--KaFSRPWLLQG  205 (279)
T KOG2462|consen  130 RYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICG--KAFSRPWLLQG  205 (279)
T ss_pred             ceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccC--CCccccccc--ccccchHHhhc
Confidence            499999999999999999999988764   67999999999999999999999987  578999999  99999999999


Q ss_pred             HHHHhCCCCCccCCcchhhhcChHHHHHHHhhccCCCCCcCCCCcccccccceeeeccCC
Q psy11318        134 HMKLHFNGKRYHCTQCSKFYIQESDLMEHMAVHSGVRKLTTGPIKTEQTFGVRELRHVGF  193 (263)
Q Consensus       134 H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~c~~~~~~~~~l~~H~~~  193 (263)
                      |+++|+|||||.|+.|++.|+++++|+.||++|.+.+.|.|..|++.|...+-|-+|...
T Consensus       206 HiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  206 HIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHSES  265 (279)
T ss_pred             ccccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhhhh
Confidence            999999999999999999999999999999999999999999999999999999999875


No 3  
>KOG1074|consensus
Probab=99.95  E-value=1.2e-29  Score=218.91  Aligned_cols=142  Identities=23%  Similarity=0.379  Sum_probs=125.6

Q ss_pred             eecccccccccchHHHHHHHHHhcCCCcccCCcCCCcCCCHHHHHHHHHHhcCC----ccccCC---CCCCCcccCCHHH
Q psy11318         58 FQCNKCFRAYKLKKDLLAHTMLEHFGIRHPCSECPKTFASRHSLKNHILKIHKA----VLYQCN---ECSTSKDYLTKRD  130 (263)
Q Consensus        58 ~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~----~~~~C~---~C~~~~~f~~~~~  130 (263)
                      -.|=+|.+...-...|+.|.+.|.+++||+|.+|++.|.++.+|+.||..|...    ..+.|+   +|.  +.|...-.
T Consensus       606 NqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~ic~--~kftn~V~  683 (958)
T KOG1074|consen  606 NQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTFICQ--KKFTNAVT  683 (958)
T ss_pred             cceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcccccccCccccccccCCchhhhc--cccccccc
Confidence            358899999999999999999999999999999999999999999999887643    347788   888  88888888


Q ss_pred             HHHHHHHhCCCC--------------------------------------------------------------------
Q psy11318        131 LRRHMKLHFNGK--------------------------------------------------------------------  142 (263)
Q Consensus       131 l~~H~~~h~~~~--------------------------------------------------------------------  142 (263)
                      |..|+++|.+..                                                                    
T Consensus       684 lpQhIriH~~~~~s~g~~a~e~~~~adq~~~~qk~~~~a~~f~~~~se~~~~~s~~~~~~~~~t~t~~~~~tp~~~e~~~  763 (958)
T KOG1074|consen  684 LPQHIRIHLGGQISNGGTAAEGILAADQCSSCQKTFSDARSFSQQISEQPSPESEPDEQMDERTETEELDVTPPPPENSC  763 (958)
T ss_pred             ccceEEeecCCCCCCCcccccccchhcccchhhhcccccccchhhhhccCCcccCCcccccccccccccccCCCcccccc
Confidence            888888886321                                                                    


Q ss_pred             --------------------------------------------------------------------------------
Q psy11318        143 --------------------------------------------------------------------------------  142 (263)
Q Consensus       143 --------------------------------------------------------------------------------  142 (263)
                                                                                                      
T Consensus       764 ~~~~~~e~~i~~~g~te~asa~~~~vg~~s~~~~~~~~~~T~~k~~~~~~~~~~~~~~~v~~~pvl~~~~~~~l~eg~~t  843 (958)
T KOG1074|consen  764 GRELEGEMAISVRGSTEEASANLDEVGTVSAAGEAGEEDDTSEKPTQASSFPGEILAPSVNMDPVLWNQETSMLNEGLAT  843 (958)
T ss_pred             ccccCcccccccccchhhhhcChhhhcCccccchhhhhcccCCCCcccccCCCcCCccccccCchhhccccccccccccc
Confidence                                                                                            


Q ss_pred             -----------------------------------CccCCcchhhhcChHHHHHHHhhccCCCCCcCCCCccccccccee
Q psy11318        143 -----------------------------------RYHCTQCSKFYIQESDLMEHMAVHSGVRKLTTGPIKTEQTFGVRE  187 (263)
Q Consensus       143 -----------------------------------~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~c~~~~~~~~~l  187 (263)
                                                         ...|.+|++.|...+.|.+|+++|+++|+|.|..|++.|..+.+|
T Consensus       844 ~~n~~t~~~~~~sv~qs~~~p~l~p~l~~~~pvnn~h~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFttrgnL  923 (958)
T KOG1074|consen  844 KTNEITPEGPADSVIQSGGVPTLEPSLGRPGPVNNAHVCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFTTRGNL  923 (958)
T ss_pred             ccccccCCCcchhhhhhccccccCCCCCCCCcccchhhhccchhcccchHHHHHhhhcCCCCCCccchhhhhhhhhhhhh
Confidence                                               378999999999999999999999999999999999999999999


Q ss_pred             eeccCCCcccccCC
Q psy11318        188 LRHVGFPMKTDHWS  201 (263)
Q Consensus       188 ~~H~~~~~~~~~~~  201 (263)
                      ..||.+|+.....+
T Consensus       924 KvHMgtH~w~q~~s  937 (958)
T KOG1074|consen  924 KVHMGTHMWVQPPS  937 (958)
T ss_pred             hhhhccccccCCCc
Confidence            99999999755443


No 4  
>KOG3608|consensus
Probab=99.90  E-value=5.3e-24  Score=167.93  Aligned_cols=183  Identities=25%  Similarity=0.408  Sum_probs=164.2

Q ss_pred             cccccccCChHHHHHHHHhhCCc-ccccCCCccccCChhHHHHHHHHh--cCCCceecccccccccchHHHHHHHHHhcC
Q psy11318          6 NACSKNFSAKDTLNKHMDIHKGV-RYQCEECPKDFSTRKYLTQHQNAI--HRGIRFQCNKCFRAYKLKKDLLAHTMLEHF   82 (263)
Q Consensus         6 ~~C~~~f~~~~~L~~H~~~h~~~-~~~C~~C~~~f~~~~~l~~H~~~~--~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~   82 (263)
                      .-|-+.|.+++.|++|+++|+++ ...|+.||.-|.++..|..|++..  ....+|.|..|.+.|.+...|..|+..|-.
T Consensus       183 ~~Ct~~~~~k~~LreH~r~Hs~eKvvACp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHvn  262 (467)
T KOG3608|consen  183 AMCTKHMGNKYRLREHIRTHSNEKVVACPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRHVN  262 (467)
T ss_pred             hhhhhhhccHHHHHHHHHhcCCCeEEecchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHhhh
Confidence            46888999999999999999995 789999999999999999998753  344579999999999999999999977764


Q ss_pred             CCcccCCcCCCcCCCHHHHHHHHHHhc-CCccccCCCCCCCcccCCHHHHHHHHHHhCCCCCccCCc--chhhhcChHHH
Q psy11318         83 GIRHPCSECPKTFASRHSLKNHILKIH-KAVLYQCNECSTSKDYLTKRDLRRHMKLHFNGKRYHCTQ--CSKFYIQESDL  159 (263)
Q Consensus        83 ~~~~~C~~C~~~f~~~~~l~~H~~~~~-~~~~~~C~~C~~~~~f~~~~~l~~H~~~h~~~~~~~C~~--C~~~f~~~~~l  159 (263)
                        -|+|+.|+.+....+.|..|++..| ..+||+|..|.  ..|.+.++|.+|+..|. +-.|.|..  |.+.|....++
T Consensus       263 --~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd--~~c~~esdL~kH~~~HS-~~~y~C~h~~C~~s~r~~~q~  337 (467)
T KOG3608|consen  263 --CYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECD--TRCVRESDLAKHVQVHS-KTVYQCEHPDCHYSVRTYTQM  337 (467)
T ss_pred             --cccccccccCCCChHHHHHHHHhhhccCCCccccchh--hhhccHHHHHHHHHhcc-ccceecCCCCCcHHHHHHHHH
Confidence              3899999999999999999998766 67999999999  99999999999999887 66799988  99999999999


Q ss_pred             HHHHhhcc-CCCC--CcCCCCcccccccceeeeccCC
Q psy11318        160 MEHMAVHS-GVRK--LTTGPIKTEQTFGVRELRHVGF  193 (263)
Q Consensus       160 ~~H~~~h~-~~~~--~~c~~c~~~~~~~~~l~~H~~~  193 (263)
                      ++|++.++ |..|  |.|..|++-|++..+|..|+..
T Consensus       338 ~~H~~evhEg~np~~Y~CH~Cdr~ft~G~~L~~HL~k  374 (467)
T KOG3608|consen  338 RRHFLEVHEGNNPILYACHCCDRFFTSGKSLSAHLMK  374 (467)
T ss_pred             HHHHHHhccCCCCCceeeecchhhhccchhHHHHHHH
Confidence            99998766 5554  9999999999999999999765


No 5  
>KOG3623|consensus
Probab=99.90  E-value=9.1e-25  Score=186.33  Aligned_cols=78  Identities=24%  Similarity=0.505  Sum_probs=75.8

Q ss_pred             ccCCCCCCCcccCCHHHHHHHHHHhCCCCCccCCcchhhhcChHHHHHHHhhccCCCCCcCCCCcccccccceeeeccCC
Q psy11318        114 YQCNECSTSKDYLTKRDLRRHMKLHFNGKRYHCTQCSKFYIQESDLMEHMAVHSGVRKLTTGPIKTEQTFGVRELRHVGF  193 (263)
Q Consensus       114 ~~C~~C~~~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~c~~~~~~~~~l~~H~~~  193 (263)
                      |.|..|.  +.|.-.+.|.+|.-.|+|.+||.|..|.+.|..+..|..|+|.|.|++||.|..|++.|+...++-.||.-
T Consensus       895 yaCDqCD--K~FqKqSSLaRHKYEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKPfQCdKClKRFSHSGSYSQHMNH  972 (1007)
T KOG3623|consen  895 YACDQCD--KAFQKQSSLARHKYEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKPFQCDKCLKRFSHSGSYSQHMNH  972 (1007)
T ss_pred             chHHHHH--HHHHhhHHHHHhhhhhcCCCCcccchhhHhhhhhhhhhhhhhhccCCCcchhhhhhhhcccccchHhhhcc
Confidence            9999999  99999999999999999999999999999999999999999999999999999999999999999999973


No 6  
>KOG3608|consensus
Probab=99.88  E-value=5.7e-23  Score=162.15  Aligned_cols=185  Identities=22%  Similarity=0.379  Sum_probs=167.8

Q ss_pred             cccccccCChHHHHHHHHhhCCc----------------ccccCCCccccCChhHHHHHHHHhcCCCceecccccccccc
Q psy11318          6 NACSKNFSAKDTLNKHMDIHKGV----------------RYQCEECPKDFSTRKYLTQHQNAIHRGIRFQCNKCFRAYKL   69 (263)
Q Consensus         6 ~~C~~~f~~~~~L~~H~~~h~~~----------------~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~   69 (263)
                      ..|+..|.+...|..|+..|..-                +..+..|-+.+.++..|++|+++|.+++...|+.|+..|.+
T Consensus       140 edCe~~F~s~~ef~dHV~~H~l~ceyd~~~~~~D~~pv~~C~W~~Ct~~~~~k~~LreH~r~Hs~eKvvACp~Cg~~F~~  219 (467)
T KOG3608|consen  140 EDCEREFVSIVEFQDHVVKHALFCEYDIQKTPEDERPVTMCNWAMCTKHMGNKYRLREHIRTHSNEKVVACPHCGELFRT  219 (467)
T ss_pred             hhcCCcccCHHHHHHHHHHhhhhhhhhhhhCCCCCCceeeccchhhhhhhccHHHHHHHHHhcCCCeEEecchHHHHhcc
Confidence            68999999999999999887331                35567799999999999999999999999999999999999


Q ss_pred             hHHHHHHHHHhcCC--CcccCCcCCCcCCCHHHHHHHHHHhcCCccccCCCCCCCcccCCHHHHHHHHHH-hCCCCCccC
Q psy11318         70 KKDLLAHTMLEHFG--IRHPCSECPKTFASRHSLKNHILKIHKAVLYQCNECSTSKDYLTKRDLRRHMKL-HFNGKRYHC  146 (263)
Q Consensus        70 ~~~l~~H~~~~~~~--~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~~~f~~~~~l~~H~~~-h~~~~~~~C  146 (263)
                      ...|-.|++....-  .+|.|..|.+.|.+...|..|+..|-.  -|+|+.|.  -+....+.|..|++. |...+||+|
T Consensus       220 ~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHvn--~ykCplCd--mtc~~~ssL~~H~r~rHs~dkpfKC  295 (467)
T KOG3608|consen  220 KTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRHVN--CYKCPLCD--MTCSSASSLTTHIRYRHSKDKPFKC  295 (467)
T ss_pred             ccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHhhh--cccccccc--cCCCChHHHHHHHHhhhccCCCccc
Confidence            99999999776643  689999999999999999999998854  68999999  889999999999986 778899999


Q ss_pred             CcchhhhcChHHHHHHHhhccCCCCCcCCC--CcccccccceeeeccCCCc
Q psy11318        147 TQCSKFYIQESDLMEHMAVHSGVRKLTTGP--IKTEQTFGVRELRHVGFPM  195 (263)
Q Consensus       147 ~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~--c~~~~~~~~~l~~H~~~~~  195 (263)
                      ..|++.|.+.++|.+|..+|. +-.|.|..  |.+++.+...+++|++.+.
T Consensus       296 d~Cd~~c~~esdL~kH~~~HS-~~~y~C~h~~C~~s~r~~~q~~~H~~evh  345 (467)
T KOG3608|consen  296 DECDTRCVRESDLAKHVQVHS-KTVYQCEHPDCHYSVRTYTQMRRHFLEVH  345 (467)
T ss_pred             cchhhhhccHHHHHHHHHhcc-ccceecCCCCCcHHHHHHHHHHHHHHHhc
Confidence            999999999999999999887 77899988  9999999999999998655


No 7  
>KOG1074|consensus
Probab=99.88  E-value=1.6e-23  Score=181.50  Aligned_cols=170  Identities=25%  Similarity=0.492  Sum_probs=149.2

Q ss_pred             CccccccccccCChHHHHHHHHhhCCc-ccccCCCccccCChhHHHHHHHHhcCCCc----eecc---cccccccchHHH
Q psy11318          2 RYYCNACSKNFSAKDTLNKHMDIHKGV-RYQCEECPKDFSTRKYLTQHQNAIHRGIR----FQCN---KCFRAYKLKKDL   73 (263)
Q Consensus         2 ~y~C~~C~~~f~~~~~L~~H~~~h~~~-~~~C~~C~~~f~~~~~l~~H~~~~~~~~~----~~C~---~C~~~f~~~~~l   73 (263)
                      +.+|.+|.++...+..|+.|+++|+|+ ||+|++||++|.++++|+.||-.|...-+    |.|+   +|-+.|...-.|
T Consensus       605 PNqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~ic~~kftn~V~l  684 (958)
T KOG1074|consen  605 PNQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTFICQKKFTNAVTL  684 (958)
T ss_pred             ccceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcccccccCccccccccCCchhhhcccccccccc
Confidence            568999999999999999999999995 99999999999999999999998554433    8999   999999999999


Q ss_pred             HHHHHHhcCCC-------------cccCCcCCCcCCCHHHHHHHHHHhcCCcc---------------------------
Q psy11318         74 LAHTMLEHFGI-------------RHPCSECPKTFASRHSLKNHILKIHKAVL---------------------------  113 (263)
Q Consensus        74 ~~H~~~~~~~~-------------~~~C~~C~~~f~~~~~l~~H~~~~~~~~~---------------------------  113 (263)
                      ..|+++|.++.             .-.|..|.+.|.....+..++..+.+...                           
T Consensus       685 pQhIriH~~~~~s~g~~a~e~~~~adq~~~~qk~~~~a~~f~~~~se~~~~~s~~~~~~~~~t~t~~~~~tp~~~e~~~~  764 (958)
T KOG1074|consen  685 PQHIRIHLGGQISNGGTAAEGILAADQCSSCQKTFSDARSFSQQISEQPSPESEPDEQMDERTETEELDVTPPPPENSCG  764 (958)
T ss_pred             cceEEeecCCCCCCCcccccccchhcccchhhhcccccccchhhhhccCCcccCCcccccccccccccccCCCccccccc
Confidence            99999887441             14688999999888777777776632100                           


Q ss_pred             --------------------------------------------------------------------------------
Q psy11318        114 --------------------------------------------------------------------------------  113 (263)
Q Consensus       114 --------------------------------------------------------------------------------  113 (263)
                                                                                                      
T Consensus       765 ~~~~~e~~i~~~g~te~asa~~~~vg~~s~~~~~~~~~~T~~k~~~~~~~~~~~~~~~v~~~pvl~~~~~~~l~eg~~t~  844 (958)
T KOG1074|consen  765 RELEGEMAISVRGSTEEASANLDEVGTVSAAGEAGEEDDTSEKPTQASSFPGEILAPSVNMDPVLWNQETSMLNEGLATK  844 (958)
T ss_pred             cccCcccccccccchhhhhcChhhhcCccccchhhhhcccCCCCcccccCCCcCCccccccCchhhcccccccccccccc
Confidence                                                                                            


Q ss_pred             -----------------------------------ccCCCCCCCcccCCHHHHHHHHHHhCCCCCccCCcchhhhcChHH
Q psy11318        114 -----------------------------------YQCNECSTSKDYLTKRDLRRHMKLHFNGKRYHCTQCSKFYIQESD  158 (263)
Q Consensus       114 -----------------------------------~~C~~C~~~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~  158 (263)
                                                         ..|.+|+  +.|.+.+.|..|+++|+++++|.|.+|++.|.++.+
T Consensus       845 ~n~~t~~~~~~sv~qs~~~p~l~p~l~~~~pvnn~h~C~vCg--k~FsSSsALqiH~rTHtg~KPF~C~fC~~aFttrgn  922 (958)
T KOG1074|consen  845 TNEITPEGPADSVIQSGGVPTLEPSLGRPGPVNNAHVCNVCG--KQFSSSAALEIHMRTHTGPKPFFCHFCEEAFTTRGN  922 (958)
T ss_pred             cccccCCCcchhhhhhccccccCCCCCCCCcccchhhhccch--hcccchHHHHHhhhcCCCCCCccchhhhhhhhhhhh
Confidence                                               6799999  999999999999999999999999999999999999


Q ss_pred             HHHHHhhccCCCCCc
Q psy11318        159 LMEHMAVHSGVRKLT  173 (263)
Q Consensus       159 l~~H~~~h~~~~~~~  173 (263)
                      |+.||.+|.+..++.
T Consensus       923 LKvHMgtH~w~q~~s  937 (958)
T KOG1074|consen  923 LKVHMGTHMWVQPPS  937 (958)
T ss_pred             hhhhhccccccCCCc
Confidence            999999999887754


No 8  
>KOG3623|consensus
Probab=99.84  E-value=8.2e-22  Score=168.46  Aligned_cols=77  Identities=30%  Similarity=0.610  Sum_probs=74.6

Q ss_pred             ccCCcCCCcCCCHHHHHHHHHHhcCCccccCCCCCCCcccCCHHHHHHHHHHhCCCCCccCCcchhhhcChHHHHHHHh
Q psy11318         86 HPCSECPKTFASRHSLKNHILKIHKAVLYQCNECSTSKDYLTKRDLRRHMKLHFNGKRYHCTQCSKFYIQESDLMEHMA  164 (263)
Q Consensus        86 ~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~  164 (263)
                      |.|..|++.|...+.|.+|.-.|.|.+||+|.+|.  +.|..+..|..|.+.|.|+|||.|..|++.|....++..||.
T Consensus       895 yaCDqCDK~FqKqSSLaRHKYEHsGqRPyqC~iCk--KAFKHKHHLtEHkRLHSGEKPfQCdKClKRFSHSGSYSQHMN  971 (1007)
T KOG3623|consen  895 YACDQCDKAFQKQSSLARHKYEHSGQRPYQCIICK--KAFKHKHHLTEHKRLHSGEKPFQCDKCLKRFSHSGSYSQHMN  971 (1007)
T ss_pred             chHHHHHHHHHhhHHHHHhhhhhcCCCCcccchhh--HhhhhhhhhhhhhhhccCCCcchhhhhhhhcccccchHhhhc
Confidence            45999999999999999999999999999999999  999999999999999999999999999999999999999984


No 9  
>KOG3576|consensus
Probab=99.77  E-value=1.5e-19  Score=132.48  Aligned_cols=108  Identities=25%  Similarity=0.431  Sum_probs=80.4

Q ss_pred             CccccccccccCChHHHHHHHHhhCCc-ccccCCCccccCChhHHHHHHHHhcCCCceecccccccccchHHHHHHHHHh
Q psy11318          2 RYYCNACSKNFSAKDTLNKHMDIHKGV-RYQCEECPKDFSTRKYLTQHQNAIHRGIRFQCNKCFRAYKLKKDLLAHTMLE   80 (263)
Q Consensus         2 ~y~C~~C~~~f~~~~~L~~H~~~h~~~-~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~   80 (263)
                      .+.|.+|+|.|+..-.|++|+..|..+ .|.|..||+.|++...|++|+++|++.+||+|..|++.|...-.|..|++..
T Consensus       117 ~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsleshl~kv  196 (267)
T KOG3576|consen  117 SFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHLKKV  196 (267)
T ss_pred             eeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHHHHHH
Confidence            367888888888888888888888774 7888888888888888888888888888888888888888888888888776


Q ss_pred             cCC-----------CcccCCcCCCcCCCHHHHHHHHHHhc
Q psy11318         81 HFG-----------IRHPCSECPKTFASRHSLKNHILKIH  109 (263)
Q Consensus        81 ~~~-----------~~~~C~~C~~~f~~~~~l~~H~~~~~  109 (263)
                      |+.           +.|.|+.||.+-.....+..|++.++
T Consensus       197 hgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~h  236 (267)
T KOG3576|consen  197 HGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHH  236 (267)
T ss_pred             cCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcC
Confidence            654           33445555555555555555555444


No 10 
>KOG3576|consensus
Probab=99.74  E-value=2.9e-19  Score=131.00  Aligned_cols=111  Identities=22%  Similarity=0.350  Sum_probs=100.2

Q ss_pred             CcccCCcCCCcCCCHHHHHHHHHHhcCCccccCCCCCCCcccCCHHHHHHHHHHhCCCCCccCCcchhhhcChHHHHHHH
Q psy11318         84 IRHPCSECPKTFASRHSLKNHILKIHKAVLYQCNECSTSKDYLTKRDLRRHMKLHFNGKRYHCTQCSKFYIQESDLMEHM  163 (263)
Q Consensus        84 ~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~  163 (263)
                      ..|.|.+|++.|.....|.+|++-|...+.+.|..||  ++|...-+|++|.++|+|.+||+|..|++.|+.+-+|..|+
T Consensus       116 d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cg--kgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsleshl  193 (267)
T KOG3576|consen  116 DSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCG--KGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHL  193 (267)
T ss_pred             CeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhcc--CcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHHH
Confidence            3478999999999999999999999999999999999  99999999999999999999999999999999999999999


Q ss_pred             hhccCC-----------CCCcCCCCcccccccceeeeccCCCcc
Q psy11318        164 AVHSGV-----------RKLTTGPIKTEQTFGVRELRHVGFPMK  196 (263)
Q Consensus       164 ~~h~~~-----------~~~~c~~c~~~~~~~~~l~~H~~~~~~  196 (263)
                      +.-+|.           +-|+|+.||+.....+.+..|++.+..
T Consensus       194 ~kvhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp  237 (267)
T KOG3576|consen  194 KKVHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHHP  237 (267)
T ss_pred             HHHcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcCC
Confidence            877664           568999999999999999999887553


No 11 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.44  E-value=3.4e-13  Score=116.44  Aligned_cols=96  Identities=18%  Similarity=0.423  Sum_probs=44.6

Q ss_pred             ecccccccccchHHHHHHHHHhcCCCcccCCcCCCcCCCHHHHHHHHHHhcCCccccCCCCCCCcccC----------CH
Q psy11318         59 QCNKCFRAYKLKKDLLAHTMLEHFGIRHPCSECPKTFASRHSLKNHILKIHKAVLYQCNECSTSKDYL----------TK  128 (263)
Q Consensus        59 ~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~~~f~----------~~  128 (263)
                      .|+.|++.|. ...|..|++.+|  .++.|+ |++.+ ....|..|+..|.+.+++.|..|+  ..+.          ..
T Consensus       455 ~C~~Cgk~f~-~s~LekH~~~~H--kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~--~~v~~g~~~~d~~d~~  527 (567)
T PLN03086        455 HCEKCGQAFQ-QGEMEKHMKVFH--EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCG--DMVQAGGSAMDVRDRL  527 (567)
T ss_pred             cCCCCCCccc-hHHHHHHHHhcC--CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCC--CccccCccccchhhhh
Confidence            4555555553 344555554443  445555 55433 334555555555555555555555  4342          12


Q ss_pred             HHHHHHHHHhCCCCCccCCcchhhhcChHHHHHHH
Q psy11318        129 RDLRRHMKLHFNGKRYHCTQCSKFYIQESDLMEHM  163 (263)
Q Consensus       129 ~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~  163 (263)
                      +.|..|.... |.+++.|..||+.+..+ .+..|+
T Consensus       528 s~Lt~HE~~C-G~rt~~C~~Cgk~Vrlr-dm~~H~  560 (567)
T PLN03086        528 RGMSEHESIC-GSRTAPCDSCGRSVMLK-EMDIHQ  560 (567)
T ss_pred             hhHHHHHHhc-CCcceEccccCCeeeeh-hHHHHH
Confidence            3444554443 44555555555444433 234443


No 12 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.31  E-value=4.9e-12  Score=109.39  Aligned_cols=143  Identities=16%  Similarity=0.335  Sum_probs=111.3

Q ss_pred             ccccCCCccccCChhHHHHHHHHhcCCCceeccc--ccccccchHHHHHHHHHhcCCCcccCCcCCCcCCCHHHHHHHHH
Q psy11318         29 RYQCEECPKDFSTRKYLTQHQNAIHRGIRFQCNK--CFRAYKLKKDLLAHTMLEHFGIRHPCSECPKTFASRHSLKNHIL  106 (263)
Q Consensus        29 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~--C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~  106 (263)
                      .-.|+.|..... ...|..|... .......|+.  |+..|.. ..+..|         +.|+.|++.|. ...|..|+.
T Consensus       407 ~V~C~NC~~~i~-l~~l~lHe~~-C~r~~V~Cp~~~Cg~v~~r-~el~~H---------~~C~~Cgk~f~-~s~LekH~~  473 (567)
T PLN03086        407 TVECRNCKHYIP-SRSIALHEAY-CSRHNVVCPHDGCGIVLRV-EEAKNH---------VHCEKCGQAFQ-QGEMEKHMK  473 (567)
T ss_pred             eEECCCCCCccc-hhHHHHHHhh-CCCcceeCCcccccceeec-cccccC---------ccCCCCCCccc-hHHHHHHHH
Confidence            357888877654 4456688865 5555678984  9998843 334444         59999999996 678999999


Q ss_pred             HhcCCccccCCCCCCCcccCCHHHHHHHHHHhCCCCCccCCcchhhhc----------ChHHHHHHHhhccCCCCCcCCC
Q psy11318        107 KIHKAVLYQCNECSTSKDYLTKRDLRRHMKLHFNGKRYHCTQCSKFYI----------QESDLMEHMAVHSGVRKLTTGP  176 (263)
Q Consensus       107 ~~~~~~~~~C~~C~~~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~----------~~~~l~~H~~~h~~~~~~~c~~  176 (263)
                      .+|  +++.|+ |+  ..+ ....|..|+.+|.+.+++.|.+|++.|.          ....|..|.... +.+++.|..
T Consensus       474 ~~H--kpv~Cp-Cg--~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~C-G~rt~~C~~  546 (567)
T PLN03086        474 VFH--EPLQCP-CG--VVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESIC-GSRTAPCDS  546 (567)
T ss_pred             hcC--CCccCC-CC--CCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccchhhhhhhHHHHHHhc-CCcceEccc
Confidence            986  789999 98  655 6689999999999999999999999985          245899999885 999999999


Q ss_pred             CcccccccceeeeccC
Q psy11318        177 IKTEQTFGVRELRHVG  192 (263)
Q Consensus       177 c~~~~~~~~~l~~H~~  192 (263)
                      |++.+..+ .|..|+.
T Consensus       547 Cgk~Vrlr-dm~~H~~  561 (567)
T PLN03086        547 CGRSVMLK-EMDIHQI  561 (567)
T ss_pred             cCCeeeeh-hHHHHHH
Confidence            99877544 3444543


No 13 
>PHA00733 hypothetical protein
Probab=99.15  E-value=3.7e-11  Score=85.23  Aligned_cols=82  Identities=17%  Similarity=0.244  Sum_probs=65.3

Q ss_pred             CcccccCCCccccCChhHHHHH--H---HHhcCCCceecccccccccchHHHHHHHHHhcCCCcccCCcCCCcCCCHHHH
Q psy11318         27 GVRYQCEECPKDFSTRKYLTQH--Q---NAIHRGIRFQCNKCFRAYKLKKDLLAHTMLEHFGIRHPCSECPKTFASRHSL  101 (263)
Q Consensus        27 ~~~~~C~~C~~~f~~~~~l~~H--~---~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l  101 (263)
                      ..++.|.+|+..|.+...|..|  +   ..++++.+|.|..|++.|.+...|..|++.+  ..+|.|+.|++.|.....|
T Consensus        38 ~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~F~~~~sL  115 (128)
T PHA00733         38 QKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKEFRNTDST  115 (128)
T ss_pred             hhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCccCCHHHH
Confidence            3478888888887777666655  1   1335577899999999999999999998754  3568999999999999999


Q ss_pred             HHHHHHhcC
Q psy11318        102 KNHILKIHK  110 (263)
Q Consensus       102 ~~H~~~~~~  110 (263)
                      ..|+...|+
T Consensus       116 ~~H~~~~h~  124 (128)
T PHA00733        116 LDHVCKKHN  124 (128)
T ss_pred             HHHHHHhcC
Confidence            999988876


No 14 
>PHA00733 hypothetical protein
Probab=99.12  E-value=6.5e-11  Score=84.02  Aligned_cols=81  Identities=14%  Similarity=0.292  Sum_probs=52.8

Q ss_pred             CcccCCcCCCcCCCHHHHHHH--HH---HhcCCccccCCCCCCCcccCCHHHHHHHHHHhCCCCCccCCcchhhhcChHH
Q psy11318         84 IRHPCSECPKTFASRHSLKNH--IL---KIHKAVLYQCNECSTSKDYLTKRDLRRHMKLHFNGKRYHCTQCSKFYIQESD  158 (263)
Q Consensus        84 ~~~~C~~C~~~f~~~~~l~~H--~~---~~~~~~~~~C~~C~~~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~  158 (263)
                      +++.|.+|.+.|.....|..+  ++   .+++.++|.|+.|+  +.|.+...|..|++.+  +.+|.|..|++.|.....
T Consensus        39 ~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cg--k~Fss~s~L~~H~r~h--~~~~~C~~CgK~F~~~~s  114 (128)
T PHA00733         39 KRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCL--MPFSSSVSLKQHIRYT--EHSKVCPVCGKEFRNTDS  114 (128)
T ss_pred             hhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCC--CcCCCHHHHHHHHhcC--CcCccCCCCCCccCCHHH
Confidence            455565555555554444443  11   22346677777777  7777777777777765  345778888888888888


Q ss_pred             HHHHHhhccC
Q psy11318        159 LMEHMAVHSG  168 (263)
Q Consensus       159 l~~H~~~h~~  168 (263)
                      |.+|+...|+
T Consensus       115 L~~H~~~~h~  124 (128)
T PHA00733        115 TLDHVCKKHN  124 (128)
T ss_pred             HHHHHHHhcC
Confidence            8887776665


No 15 
>KOG3993|consensus
Probab=99.09  E-value=1.1e-11  Score=100.91  Aligned_cols=188  Identities=14%  Similarity=0.102  Sum_probs=110.3

Q ss_pred             ccccccccccCChHHHHHHHHhhCC-cccccCCCccccCChhHHHHHHHHhcCCCcee---cccccccccchHHHHHHHH
Q psy11318          3 YYCNACSKNFSAKDTLNKHMDIHKG-VRYQCEECPKDFSTRKYLTQHQNAIHRGIRFQ---CNKCFRAYKLKKDLLAHTM   78 (263)
Q Consensus         3 y~C~~C~~~f~~~~~L~~H~~~h~~-~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~---C~~C~~~f~~~~~l~~H~~   78 (263)
                      |.|-+|...|.+...|.+|.=.... +.|+|+.|+|+|+.-.+|-.|.+.|.....-.   -+.=.+. .....+.....
T Consensus       268 yiCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~-~~~rae~~ea~  346 (500)
T KOG3993|consen  268 YICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQA-VETRAEVQEAE  346 (500)
T ss_pred             HHHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhh-hhhhhhhhhcc
Confidence            7899999999999999999644333 37999999999999999999998865332110   0000000 00011111110


Q ss_pred             H---hcCCCcccCCcCCCcCCCHHHHHHHHHHhcCCc-----------------cccCCCCCCCcccCCHHHHHHHHHHh
Q psy11318         79 L---EHFGIRHPCSECPKTFASRHSLKNHILKIHKAV-----------------LYQCNECSTSKDYLTKRDLRRHMKLH  138 (263)
Q Consensus        79 ~---~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~-----------------~~~C~~C~~~~~f~~~~~l~~H~~~h  138 (263)
                      .   ...+-.|.|.+|++.|.+...|+.|+..|+...                 .+-|..+.  -.+...+.--.+...+
T Consensus       347 rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~~~~~k~~a~~f~~s~~~~l~~~~~~~a--~h~~a~~~~g~~vl~~  424 (500)
T KOG3993|consen  347 RSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQRAPLAKEKAPKFLLSRVIPLMHFNQAVA--THSSASDSHGDEVLYV  424 (500)
T ss_pred             ccCCcccCceeecHHhhhhhHHHHHHHHhHHhhhccccchhcccCcchhhcccccccccccc--cccccccccccceeee
Confidence            0   011235777777777777777777766665211                 02233333  1121111111111111


Q ss_pred             CC-CCCccCCcchhhhcChHHHHHHHhhccCCCCCcCCCCcccccccceeeeccCC
Q psy11318        139 FN-GKRYHCTQCSKFYIQESDLMEHMAVHSGVRKLTTGPIKTEQTFGVRELRHVGF  193 (263)
Q Consensus       139 ~~-~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~c~~~~~~~~~l~~H~~~  193 (263)
                      .+ .....|++|+..+..+..-..+.+.-.....|.|..|.-.|.+...|.+|+..
T Consensus       425 a~sael~~pp~~~~ppsss~~sgg~~rlg~~~q~f~~ky~~atfyss~~ltrhin~  480 (500)
T KOG3993|consen  425 AGSAELELPPYDGSPPSSSGSSGGYGRLGIAEQGFTCKYCPATFYSSPGLTRHINK  480 (500)
T ss_pred             eccccccCCCCCCCCcccCCCCCccccccchhhccccccchHhhhcCcchHhHhhh
Confidence            11 11245677777777666656666666667778888888888888888888775


No 16 
>PHA02768 hypothetical protein; Provisional
Probab=99.08  E-value=4.4e-11  Score=69.98  Aligned_cols=43  Identities=14%  Similarity=0.370  Sum_probs=32.7

Q ss_pred             ccccccccccCChHHHHHHHHhhCCcccccCCCccccCChhHHH
Q psy11318          3 YYCNACSKNFSAKDTLNKHMDIHKGVRYQCEECPKDFSTRKYLT   46 (263)
Q Consensus         3 y~C~~C~~~f~~~~~L~~H~~~h~~~~~~C~~C~~~f~~~~~l~   46 (263)
                      |.|++||+.|.....|..|+++|+ .+|+|..|++.|...+.|.
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~-k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHN-TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcC-CcccCCcccceecccceeE
Confidence            678888888888888888888877 4778888888777666554


No 17 
>PHA02768 hypothetical protein; Provisional
Probab=98.98  E-value=4.4e-10  Score=65.82  Aligned_cols=45  Identities=20%  Similarity=0.432  Sum_probs=39.8

Q ss_pred             CccCCcchhhhcChHHHHHHHhhccCCCCCcCCCCcccccccceeee
Q psy11318        143 RYHCTQCSKFYIQESDLMEHMAVHSGVRKLTTGPIKTEQTFGVRELR  189 (263)
Q Consensus       143 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~c~~~~~~~~~l~~  189 (263)
                      .|.|+.||+.|++.+.|.+|+++|+  ++++|..|++.|+..++|..
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l~~   49 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEYIE   49 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceecccceeEE
Confidence            4889999999999999999999988  78999999999998887764


No 18 
>KOG3993|consensus
Probab=98.64  E-value=3.2e-09  Score=86.89  Aligned_cols=52  Identities=19%  Similarity=0.503  Sum_probs=31.4

Q ss_pred             cccCCCccccCChhHHHHHHHHhcCCCceecccccccccchHHHHHHHHHhc
Q psy11318         30 YQCEECPKDFSTRKYLTQHQNAIHRGIRFQCNKCFRAYKLKKDLLAHTMLEH   81 (263)
Q Consensus        30 ~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~   81 (263)
                      |.|..|...|.+.+.|-+|.-.---.++|+|++|+|.|+--.||..|.+-|.
T Consensus       268 yiCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRWHK  319 (500)
T KOG3993|consen  268 YICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRWHK  319 (500)
T ss_pred             HHHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhhcccC
Confidence            6666666666666666666533222234666666666666666666665443


No 19 
>PHA00732 hypothetical protein
Probab=98.63  E-value=2.4e-08  Score=64.26  Aligned_cols=49  Identities=22%  Similarity=0.339  Sum_probs=38.8

Q ss_pred             CccccccccccCChHHHHHHHHh-hCCcccccCCCccccCChhHHHHHHHHhcCC
Q psy11318          2 RYYCNACSKNFSAKDTLNKHMDI-HKGVRYQCEECPKDFSTRKYLTQHQNAIHRG   55 (263)
Q Consensus         2 ~y~C~~C~~~f~~~~~L~~H~~~-h~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~   55 (263)
                      +|.|.+||+.|.+...|..|++. |.+  +.|+.|++.|.   .|..|++++.+-
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~~--~~C~~CgKsF~---~l~~H~~~~~~~   50 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHTL--TKCPVCNKSYR---RLNQHFYSQYDI   50 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccCC--CccCCCCCEeC---ChhhhhcccCCc
Confidence            58899999999999999999874 553  68899998887   588888775543


No 20 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.55  E-value=3.4e-08  Score=49.42  Aligned_cols=23  Identities=22%  Similarity=0.250  Sum_probs=9.7

Q ss_pred             HHHHHhhccCCCCCcCCCCcccc
Q psy11318        159 LMEHMAVHSGVRKLTTGPIKTEQ  181 (263)
Q Consensus       159 l~~H~~~h~~~~~~~c~~c~~~~  181 (263)
                      |.+|+++|+++++|.|+.|++.|
T Consensus         2 l~~H~~~H~~~k~~~C~~C~k~F   24 (26)
T PF13465_consen    2 LRRHMRTHTGEKPYKCPYCGKSF   24 (26)
T ss_dssp             HHHHHHHHSSSSSEEESSSSEEE
T ss_pred             HHHHhhhcCCCCCCCCCCCcCee
Confidence            33444444444444444444443


No 21 
>PHA00616 hypothetical protein
Probab=98.52  E-value=6.3e-08  Score=53.97  Aligned_cols=33  Identities=24%  Similarity=0.572  Sum_probs=27.4

Q ss_pred             CccCCcchhhhcChHHHHHHHhhccCCCCCcCC
Q psy11318        143 RYHCTQCSKFYIQESDLMEHMAVHSGVRKLTTG  175 (263)
Q Consensus       143 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c~  175 (263)
                      +|.|+.||+.|...++|.+|++.|++.+++.|+
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~   33 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLE   33 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCcccee
Confidence            578888888888888888888888888887765


No 22 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.52  E-value=5.2e-08  Score=48.75  Aligned_cols=26  Identities=42%  Similarity=0.866  Sum_probs=23.9

Q ss_pred             HHHHHHHHhCCCCCccCCcchhhhcC
Q psy11318        130 DLRRHMKLHFNGKRYHCTQCSKFYIQ  155 (263)
Q Consensus       130 ~l~~H~~~h~~~~~~~C~~C~~~f~~  155 (263)
                      +|.+|+++|+|+++|.|+.|++.|.+
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEESS
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeCc
Confidence            48899999999999999999999964


No 23 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.41  E-value=4.6e-07  Score=54.19  Aligned_cols=48  Identities=23%  Similarity=0.452  Sum_probs=23.1

Q ss_pred             ccccccccccCChHHHHHHHHhhCC---cccccCCCccccCChhHHHHHHHHhc
Q psy11318          3 YYCNACSKNFSAKDTLNKHMDIHKG---VRYQCEECPKDFSTRKYLTQHQNAIH   53 (263)
Q Consensus         3 y~C~~C~~~f~~~~~L~~H~~~h~~---~~~~C~~C~~~f~~~~~l~~H~~~~~   53 (263)
                      |.||+|++ ..+...|..|....+.   ..+.|++|...+.  .+|..|++..|
T Consensus         3 f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    3 FTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             cCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            55555555 3344555555444332   1455555554332  25555555443


No 24 
>PHA00616 hypothetical protein
Probab=98.41  E-value=1.2e-07  Score=52.78  Aligned_cols=33  Identities=24%  Similarity=0.507  Sum_probs=17.0

Q ss_pred             cccCCCccccCChhHHHHHHHHhcCCCceeccc
Q psy11318         30 YQCEECPKDFSTRKYLTQHQNAIHRGIRFQCNK   62 (263)
Q Consensus        30 ~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~   62 (263)
                      |+|+.||+.|...++|.+|++.+|++.++.|..
T Consensus         2 YqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~~   34 (44)
T PHA00616          2 YQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLEY   34 (44)
T ss_pred             CccchhhHHHhhHHHHHHHHHHhcCCCccceeE
Confidence            455555555555555555555555555544443


No 25 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.35  E-value=9.2e-07  Score=52.90  Aligned_cols=50  Identities=24%  Similarity=0.440  Sum_probs=31.3

Q ss_pred             ccccCCCccccCChhHHHHHHHHhcCC--CceecccccccccchHHHHHHHHHhc
Q psy11318         29 RYQCEECPKDFSTRKYLTQHQNAIHRG--IRFQCNKCFRAYKLKKDLLAHTMLEH   81 (263)
Q Consensus        29 ~~~C~~C~~~f~~~~~l~~H~~~~~~~--~~~~C~~C~~~f~~~~~l~~H~~~~~   81 (263)
                      .|.|++|++ ..+...|..|....|..  ..+.|++|...+.  .+|..|+..+|
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            367777777 45566777777765553  2366777766433  36666665554


No 26 
>PHA00732 hypothetical protein
Probab=98.28  E-value=4.7e-07  Score=58.33  Aligned_cols=44  Identities=27%  Similarity=0.453  Sum_probs=31.8

Q ss_pred             ccccCCCccccCChhHHHHHHHHhcCCCceecccccccccchHHHHHHH
Q psy11318         29 RYQCEECPKDFSTRKYLTQHQNAIHRGIRFQCNKCFRAYKLKKDLLAHT   77 (263)
Q Consensus        29 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~   77 (263)
                      ||.|..|++.|.+...|+.|++.+|.  ++.|+.|++.|.   .+..|+
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~--~~~C~~CgKsF~---~l~~H~   44 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT--LTKCPVCNKSYR---RLNQHF   44 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC--CCccCCCCCEeC---Chhhhh
Confidence            57788888888888888888874333  257888888776   366676


No 27 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.18  E-value=1.1e-06  Score=42.58  Aligned_cols=22  Identities=45%  Similarity=0.925  Sum_probs=13.3

Q ss_pred             ccccccccccCChHHHHHHHHh
Q psy11318          3 YYCNACSKNFSAKDTLNKHMDI   24 (263)
Q Consensus         3 y~C~~C~~~f~~~~~L~~H~~~   24 (263)
                      |.|+.|++.|.++..|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            4566666666666666666554


No 28 
>KOG2231|consensus
Probab=98.13  E-value=4.5e-05  Score=67.67  Aligned_cols=134  Identities=22%  Similarity=0.422  Sum_probs=85.6

Q ss_pred             ccCCCccccCChhHHHHHHHHhcCCCceeccccc---------ccccchHHHHHHHHHhcC-C---C-cccCCcCCCcCC
Q psy11318         31 QCEECPKDFSTRKYLTQHQNAIHRGIRFQCNKCF---------RAYKLKKDLLAHTMLEHF-G---I-RHPCSECPKTFA   96 (263)
Q Consensus        31 ~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~---------~~f~~~~~l~~H~~~~~~-~---~-~~~C~~C~~~f~   96 (263)
                      .|.+| -.|.....|+.|+...|+.  +.|.+|-         ....+...|..|++.--. +   + --.|..|...|.
T Consensus       117 ~~~~c-~~~~s~~~Lk~H~~~~H~~--~~c~lC~~~~kif~~e~k~Yt~~el~~h~~~gd~d~~s~rGhp~C~~C~~~fl  193 (669)
T KOG2231|consen  117 ECLHC-TEFKSVENLKNHMRDQHKL--HLCSLCLQNLKIFINERKLYTRAELNLHLMFGDPDDESCRGHPLCKFCHERFL  193 (669)
T ss_pred             CCccc-cchhHHHHHHHHHHHhhhh--hccccccccceeeeeeeehehHHHHHHHHhcCCCccccccCCccchhhhhhhc
Confidence            45555 5566888899999766653  5555543         233456778888764333 2   1 146899999999


Q ss_pred             CHHHHHHHHHHhcCCccccCCCCC----CCcccCCHHHHHHHHHHhCCCCCccCC--cch-hhhcCh----HHHHHHHhh
Q psy11318         97 SRHSLKNHILKIHKAVLYQCNECS----TSKDYLTKRDLRRHMKLHFNGKRYHCT--QCS-KFYIQE----SDLMEHMAV  165 (263)
Q Consensus        97 ~~~~l~~H~~~~~~~~~~~C~~C~----~~~~f~~~~~l~~H~~~h~~~~~~~C~--~C~-~~f~~~----~~l~~H~~~  165 (263)
                      ....|..|++..|-    .|-.|.    ...-|....+|..|.+.+|    |.|.  .|. +.|...    ..|++|.+.
T Consensus       194 d~~el~rH~~~~h~----~chfC~~~~~~neyy~~~~dLe~HfR~~H----flCE~~~C~~~~f~~~~~~ei~lk~~~~~  265 (669)
T KOG2231|consen  194 DDDELYRHLRFDHE----FCHFCDYKTGQNEYYNDYDDLEEHFRKGH----FLCEEEFCRTKKFYVAFELEIELKAHNRF  265 (669)
T ss_pred             cHHHHHHhhcccee----heeecCcccccchhcccchHHHHHhhhcC----ccccccccccceeeehhHHHHHHHhhccc
Confidence            99999999998774    455552    2367888889999998766    6676  453 334444    344444433


Q ss_pred             ccCCCCCcCC
Q psy11318        166 HSGVRKLTTG  175 (263)
Q Consensus       166 h~~~~~~~c~  175 (263)
                      +.-++.|.|.
T Consensus       266 ~~~e~~~~~~  275 (669)
T KOG2231|consen  266 IQHEKCYICR  275 (669)
T ss_pred             cchheeccCC
Confidence            3334445553


No 29 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.99  E-value=4.9e-06  Score=40.28  Aligned_cols=22  Identities=36%  Similarity=0.812  Sum_probs=15.7

Q ss_pred             cccCCCccccCChhHHHHHHHH
Q psy11318         30 YQCEECPKDFSTRKYLTQHQNA   51 (263)
Q Consensus        30 ~~C~~C~~~f~~~~~l~~H~~~   51 (263)
                      |.|++|++.|.+...|+.|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            5677777777777777777765


No 30 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.94  E-value=7e-06  Score=40.05  Aligned_cols=23  Identities=39%  Similarity=0.896  Sum_probs=10.8

Q ss_pred             ccccccccccCChHHHHHHHHhh
Q psy11318          3 YYCNACSKNFSAKDTLNKHMDIH   25 (263)
Q Consensus         3 y~C~~C~~~f~~~~~L~~H~~~h   25 (263)
                      |.|++|++.|.+...|+.|+++|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            34555555555555555555443


No 31 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.94  E-value=6.5e-06  Score=56.09  Aligned_cols=23  Identities=39%  Similarity=0.762  Sum_probs=0.0

Q ss_pred             ccccccccCChHHHHHHHHhhCC
Q psy11318          5 CNACSKNFSAKDTLNKHMDIHKG   27 (263)
Q Consensus         5 C~~C~~~f~~~~~L~~H~~~h~~   27 (263)
                      |..|+..|.+...|..||...++
T Consensus         2 C~~C~~~f~~~~~l~~H~~~~H~   24 (100)
T PF12756_consen    2 CLFCDESFSSVDDLLQHMKKKHG   24 (100)
T ss_dssp             -----------------------
T ss_pred             ccccccccccccccccccccccc
Confidence            55555555555555555554444


No 32 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.90  E-value=1e-05  Score=39.44  Aligned_cols=24  Identities=38%  Similarity=0.754  Sum_probs=17.0

Q ss_pred             cccCCCccccCChhHHHHHHHHhc
Q psy11318         30 YQCEECPKDFSTRKYLTQHQNAIH   53 (263)
Q Consensus        30 ~~C~~C~~~f~~~~~l~~H~~~~~   53 (263)
                      |.|++|++.|.+...|+.|++++|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            578888888888888888887764


No 33 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.73  E-value=2.1e-05  Score=39.66  Aligned_cols=25  Identities=32%  Similarity=0.684  Sum_probs=14.4

Q ss_pred             CccccccccccCChHHHHHHHHhhC
Q psy11318          2 RYYCNACSKNFSAKDTLNKHMDIHK   26 (263)
Q Consensus         2 ~y~C~~C~~~f~~~~~L~~H~~~h~   26 (263)
                      +|.|..|++.|.+...|..|++.|.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            3556666666666666666655543


No 34 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.72  E-value=2.2e-05  Score=53.44  Aligned_cols=73  Identities=27%  Similarity=0.296  Sum_probs=17.6

Q ss_pred             ccCCCccccCChhHHHHHHHHhcCCCceecccccccccchHHHHHHHHHhcCCCcccCCcCCCcCCCHHHHHHHHHHh
Q psy11318         31 QCEECPKDFSTRKYLTQHQNAIHRGIRFQCNKCFRAYKLKKDLLAHTMLEHFGIRHPCSECPKTFASRHSLKNHILKI  108 (263)
Q Consensus        31 ~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~  108 (263)
                      +|..|+..|.+...|..||...|+-..   . ....+.....+..++... ....+.|..|++.|.+...|..|++.+
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~---~-~~~~l~~~~~~~~~~~~~-~~~~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDI---P-DQKYLVDPNRLLNYLRKK-VKESFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             -----------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             Ccccccccccccccccccccccccccc---c-cccccccccccccccccc-cCCCCCCCccCCCCcCHHHHHHHHcCc
Confidence            488888888888888888877665321   1 111111222333333221 122577777777777777777777764


No 35 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=97.57  E-value=0.0003  Score=56.91  Aligned_cols=130  Identities=22%  Similarity=0.433  Sum_probs=90.8

Q ss_pred             ccccCC--CccccCChhHHHHHHHHhcCCCceecccccc---ccc------chHHHHHHHHHhcCCCcc----cCCcCCC
Q psy11318         29 RYQCEE--CPKDFSTRKYLTQHQNAIHRGIRFQCNKCFR---AYK------LKKDLLAHTMLEHFGIRH----PCSECPK   93 (263)
Q Consensus        29 ~~~C~~--C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~---~f~------~~~~l~~H~~~~~~~~~~----~C~~C~~   93 (263)
                      .|.|+.  |..+......|+.|.+..|+.  +.|.+|-.   .|.      ++..|..|...--.+..|    .|..|..
T Consensus       151 ~F~CP~skc~~~C~~~k~lk~H~K~~H~~--~~C~~C~~nKk~F~~E~~lF~~~~Lr~H~~~G~~e~GFKGHP~C~FC~~  228 (493)
T COG5236         151 SFKCPKSKCHRRCGSLKELKKHYKAQHGF--VLCSECIGNKKDFWNEIRLFRSSTLRDHKNGGLEEEGFKGHPLCIFCKI  228 (493)
T ss_pred             HhcCCchhhhhhhhhHHHHHHHHHhhcCc--EEhHhhhcCcccCccceeeeecccccccccCCccccCcCCCchhhhccc
Confidence            488876  777777788899999987764  77887752   343      344555555332223233    6999999


Q ss_pred             cCCCHHHHHHHHHHhcCCccccCCCCCCC-----cccCCHHHHHHHHHHhCCCCCccCCc--ch----hhhcChHHHHHH
Q psy11318         94 TFASRHSLKNHILKIHKAVLYQCNECSTS-----KDYLTKRDLRRHMKLHFNGKRYHCTQ--CS----KFYIQESDLMEH  162 (263)
Q Consensus        94 ~f~~~~~l~~H~~~~~~~~~~~C~~C~~~-----~~f~~~~~l~~H~~~h~~~~~~~C~~--C~----~~f~~~~~l~~H  162 (263)
                      .|-+...|..|++..|.    .|-+|...     .-|.+...|.+|.+.-+    |.|.+  |-    +.|.....|..|
T Consensus       229 ~FYdDDEL~~HcR~~HE----~ChICD~v~p~~~QYFK~Y~~Le~HF~~~h----y~ct~qtc~~~k~~vf~~~~el~~h  300 (493)
T COG5236         229 YFYDDDELRRHCRLRHE----ACHICDMVGPIRYQYFKSYEDLEAHFRNAH----YCCTFQTCRVGKCYVFPYHTELLEH  300 (493)
T ss_pred             eecChHHHHHHHHhhhh----hhhhhhccCccchhhhhCHHHHHHHhhcCc----eEEEEEEEecCcEEEeccHHHHHHH
Confidence            99999999999998875    46555521     34778888888886432    67755  42    568888899999


Q ss_pred             HhhccC
Q psy11318        163 MAVHSG  168 (263)
Q Consensus       163 ~~~h~~  168 (263)
                      +...|+
T Consensus       301 ~~~~h~  306 (493)
T COG5236         301 LTRFHK  306 (493)
T ss_pred             HHHHhh
Confidence            866554


No 36 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.57  E-value=3.5e-05  Score=38.80  Aligned_cols=25  Identities=32%  Similarity=0.721  Sum_probs=16.7

Q ss_pred             ccccCCCccccCChhHHHHHHHHhc
Q psy11318         29 RYQCEECPKDFSTRKYLTQHQNAIH   53 (263)
Q Consensus        29 ~~~C~~C~~~f~~~~~l~~H~~~~~   53 (263)
                      +|.|..|++.|.+...|..|++.|+
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            4667777777777777777766544


No 37 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.56  E-value=4.5e-05  Score=60.84  Aligned_cols=53  Identities=21%  Similarity=0.222  Sum_probs=45.1

Q ss_pred             CCCCccCCc--chhhhcChHHHHHHHhhcc-------------------CCCCCcCCCCcccccccceeeeccC
Q psy11318        140 NGKRYHCTQ--CSKFYIQESDLMEHMAVHS-------------------GVRKLTTGPIKTEQTFGVRELRHVG  192 (263)
Q Consensus       140 ~~~~~~C~~--C~~~f~~~~~l~~H~~~h~-------------------~~~~~~c~~c~~~~~~~~~l~~H~~  192 (263)
                      +++||+|++  |++.|+....|+-|+.--|                   ..+||+|++|++.+.....|..|..
T Consensus       346 d~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         346 DGKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             cCceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceeccc
Confidence            458999988  9999999999999986432                   2389999999999999999998875


No 38 
>KOG1146|consensus
Probab=97.56  E-value=2.4e-05  Score=73.34  Aligned_cols=80  Identities=23%  Similarity=0.445  Sum_probs=64.5

Q ss_pred             CCccccccccccCChHHHHHHHHhh--------------------------CCcccccCCCccccCChhHHHHHHHHhc-
Q psy11318          1 MRYYCNACSKNFSAKDTLNKHMDIH--------------------------KGVRYQCEECPKDFSTRKYLTQHQNAIH-   53 (263)
Q Consensus         1 ~~y~C~~C~~~f~~~~~L~~H~~~h--------------------------~~~~~~C~~C~~~f~~~~~l~~H~~~~~-   53 (263)
                      |-|+|+.|+..|.....|..|||.-                          .+.+|.|..|...+..+++|-+|++... 
T Consensus       464 kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p~~C~~C~~stttng~LsihlqS~~h  543 (1406)
T KOG1146|consen  464 KTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKPYPCRACNYSTTTNGNLSIHLQSDLH  543 (1406)
T ss_pred             ccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCcccceeeeeeeecchHHHHHHHHHhh
Confidence            4689999999999999999999981                          1227999999999999999999997422 


Q ss_pred             CCC------------------------------------------ceecccccccccchHHHHHHHHHh
Q psy11318         54 RGI------------------------------------------RFQCNKCFRAYKLKKDLLAHTMLE   80 (263)
Q Consensus        54 ~~~------------------------------------------~~~C~~C~~~f~~~~~l~~H~~~~   80 (263)
                      ...                                          .|.|.+|++.-.-..+|..|+...
T Consensus       544 ~~~lee~~~~~g~~v~~~~~~v~s~~P~~ag~~~~ags~~pktkP~~~C~vc~yetniarnlrihmtss  612 (1406)
T KOG1146|consen  544 RNELEEAEENAGEQVRLLPASVTSAVPEEAGLGPSAGSSGPKTKPSWRCEVCSYETNIARNLRIHMTAS  612 (1406)
T ss_pred             HHHHHHHHhccccchhhhhhhhcccCcccccCCCCCCCCCCCCCCCcchhhhcchhhhhhccccccccC
Confidence            111                                          178999999888888888888543


No 39 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.54  E-value=2.6e-05  Score=62.14  Aligned_cols=54  Identities=28%  Similarity=0.468  Sum_probs=44.0

Q ss_pred             CccccCCCCCCCcccCCHHHHHHHHHHhC-------------------CCCCccCCcchhhhcChHHHHHHHh
Q psy11318        111 AVLYQCNECSTSKDYLTKRDLRRHMKLHF-------------------NGKRYHCTQCSKFYIQESDLMEHMA  164 (263)
Q Consensus       111 ~~~~~C~~C~~~~~f~~~~~l~~H~~~h~-------------------~~~~~~C~~C~~~f~~~~~l~~H~~  164 (263)
                      ++||+|++-||.+.|.+...|+-|+..-+                   ..|||+|++|++.|.....|+-|..
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceeccc
Confidence            47888888888788888888888876422                   1379999999999999999998854


No 40 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.36  E-value=0.00017  Score=35.55  Aligned_cols=23  Identities=43%  Similarity=0.918  Sum_probs=13.6

Q ss_pred             ccccccccccCChHHHHHHHHhh
Q psy11318          3 YYCNACSKNFSAKDTLNKHMDIH   25 (263)
Q Consensus         3 y~C~~C~~~f~~~~~L~~H~~~h   25 (263)
                      |.|..|++.|.....|..|++.|
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHh
Confidence            45666666666666666666544


No 41 
>KOG2231|consensus
Probab=97.19  E-value=0.0011  Score=59.23  Aligned_cols=134  Identities=23%  Similarity=0.474  Sum_probs=88.8

Q ss_pred             ccccccccccC---------------ChHHHHHHHHhhCCcccccCCC---------ccccCChhHHHHHHHHhcC-CC-
Q psy11318          3 YYCNACSKNFS---------------AKDTLNKHMDIHKGVRYQCEEC---------PKDFSTRKYLTQHQNAIHR-GI-   56 (263)
Q Consensus         3 y~C~~C~~~f~---------------~~~~L~~H~~~h~~~~~~C~~C---------~~~f~~~~~l~~H~~~~~~-~~-   56 (263)
                      +.|.+|+..|+               +...|+.|+...++ -+.|..|         .....+...|.+|++.--. ++ 
T Consensus       100 ~~C~~C~~~~~~~~~~~~~~~c~~~~s~~~Lk~H~~~~H~-~~~c~lC~~~~kif~~e~k~Yt~~el~~h~~~gd~d~~s  178 (669)
T KOG2231|consen  100 HSCHICDRRFRALYNKKECLHCTEFKSVENLKNHMRDQHK-LHLCSLCLQNLKIFINERKLYTRAELNLHLMFGDPDDES  178 (669)
T ss_pred             hhcCccccchhhhcccCCCccccchhHHHHHHHHHHHhhh-hhccccccccceeeeeeeehehHHHHHHHHhcCCCcccc
Confidence            56788887774               77889999966555 3455554         2334566778999876322 22 


Q ss_pred             ---ceecccccccccchHHHHHHHHHhcCCCcccCCcC------CCcCCCHHHHHHHHHHhcCCccccCC--CCCCCccc
Q psy11318         57 ---RFQCNKCFRAYKLKKDLLAHTMLEHFGIRHPCSEC------PKTFASRHSLKNHILKIHKAVLYQCN--ECSTSKDY  125 (263)
Q Consensus        57 ---~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C------~~~f~~~~~l~~H~~~~~~~~~~~C~--~C~~~~~f  125 (263)
                         --.|..|...|.....|..|++.+|    |.|..|      +.-|.....|..|.+.+|    |.|.  .|.+. .|
T Consensus       179 ~rGhp~C~~C~~~fld~~el~rH~~~~h----~~chfC~~~~~~neyy~~~~dLe~HfR~~H----flCE~~~C~~~-~f  249 (669)
T KOG2231|consen  179 CRGHPLCKFCHERFLDDDELYRHLRFDH----EFCHFCDYKTGQNEYYNDYDDLEEHFRKGH----FLCEEEFCRTK-KF  249 (669)
T ss_pred             ccCCccchhhhhhhccHHHHHHhhccce----eheeecCcccccchhcccchHHHHHhhhcC----ccccccccccc-ee
Confidence               2579999999999999999998777    556665      345777899999999887    4665  56542 33


Q ss_pred             CCH----HHHHHHHHHhCCCCCccC
Q psy11318        126 LTK----RDLRRHMKLHFNGKRYHC  146 (263)
Q Consensus       126 ~~~----~~l~~H~~~h~~~~~~~C  146 (263)
                      ...    -.|++|.+.+.-++.|.|
T Consensus       250 ~~~~~~ei~lk~~~~~~~~e~~~~~  274 (669)
T KOG2231|consen  250 YVAFELEIELKAHNRFIQHEKCYIC  274 (669)
T ss_pred             eehhHHHHHHHhhccccchheeccC
Confidence            333    344444433333444555


No 42 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.14  E-value=0.00027  Score=34.37  Aligned_cols=22  Identities=41%  Similarity=0.797  Sum_probs=10.0

Q ss_pred             ccccccccccCChHHHHHHHHhh
Q psy11318          3 YYCNACSKNFSAKDTLNKHMDIH   25 (263)
Q Consensus         3 y~C~~C~~~f~~~~~L~~H~~~h   25 (263)
                      |+|++|++... ...|..|++.+
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~   22 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRH   22 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhh
Confidence            44555555554 44555555443


No 43 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.07  E-value=0.0004  Score=39.68  Aligned_cols=29  Identities=17%  Similarity=0.222  Sum_probs=18.0

Q ss_pred             cccccCCCccccCChhHHHHHHHHhcCCC
Q psy11318         28 VRYQCEECPKDFSTRKYLTQHQNAIHRGI   56 (263)
Q Consensus        28 ~~~~C~~C~~~f~~~~~l~~H~~~~~~~~   56 (263)
                      .|..|++|+..+....+|++|+...|+.+
T Consensus        23 ~PatCP~C~a~~~~srnLrRHle~~H~~k   51 (54)
T PF09237_consen   23 QPATCPICGAVIRQSRNLRRHLEIRHFKK   51 (54)
T ss_dssp             --EE-TTT--EESSHHHHHHHHHHHTTTS
T ss_pred             CCCCCCcchhhccchhhHHHHHHHHhccc
Confidence            37778888888888888888877766654


No 44 
>KOG1146|consensus
Probab=97.06  E-value=0.00017  Score=67.88  Aligned_cols=129  Identities=19%  Similarity=0.235  Sum_probs=81.5

Q ss_pred             cccccccccchHHHHHHHHHhc-CCCcccCCcCCCcCCCHHHHHHHHHHhcCCccccCCCCCCCcccCCHHHHHHHHHHh
Q psy11318         60 CNKCFRAYKLKKDLLAHTMLEH-FGIRHPCSECPKTFASRHSLKNHILKIHKAVLYQCNECSTSKDYLTKRDLRRHMKLH  138 (263)
Q Consensus        60 C~~C~~~f~~~~~l~~H~~~~~-~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~~~f~~~~~l~~H~~~h  138 (263)
                      |.-|+..+.+...+.-|+...+ ..+.++|+.|+..|.....|..|+|..|.+-.-  .+|   +.+.....+.+-....
T Consensus       439 ~~~~e~~~~s~r~~~~~t~~L~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~--~~c---~~gq~~~~~arg~~~~  513 (1406)
T KOG1146|consen  439 LTKAEPLLESKRSLEGQTVVLHSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQS--AYC---KAGQNHPRLARGEVYR  513 (1406)
T ss_pred             ccchhhhhhhhcccccceeeeecccccccCCccchhhhhHHHhhhcccccccccch--hHh---Hhcccccccccccccc
Confidence            3344444555555555543333 337788999999998888899998886643211  223   2222222222212223


Q ss_pred             CCCCCccCCcchhhhcChHHHHHHHhhc--c----------C-------------------------------CCCCcCC
Q psy11318        139 FNGKRYHCTQCSKFYIQESDLMEHMAVH--S----------G-------------------------------VRKLTTG  175 (263)
Q Consensus       139 ~~~~~~~C~~C~~~f~~~~~l~~H~~~h--~----------~-------------------------------~~~~~c~  175 (263)
                      .+.++|.|..|.+.++...+|.+|+..-  -          +                               .-.+.|.
T Consensus       514 ~~~~p~~C~~C~~stttng~LsihlqS~~h~~~lee~~~~~g~~v~~~~~~v~s~~P~~ag~~~~ags~~pktkP~~~C~  593 (1406)
T KOG1146|consen  514 CPGKPYPCRACNYSTTTNGNLSIHLQSDLHRNELEEAEENAGEQVRLLPASVTSAVPEEAGLGPSAGSSGPKTKPSWRCE  593 (1406)
T ss_pred             CCCCcccceeeeeeeecchHHHHHHHHHhhHHHHHHHHhccccchhhhhhhhcccCcccccCCCCCCCCCCCCCCCcchh
Confidence            3556788888888888888888887421  1          0                               0237899


Q ss_pred             CCcccccccceeeeccCC
Q psy11318        176 PIKTEQTFGVRELRHVGF  193 (263)
Q Consensus       176 ~c~~~~~~~~~l~~H~~~  193 (263)
                      +|++..+-..+|+.|+..
T Consensus       594 vc~yetniarnlrihmts  611 (1406)
T KOG1146|consen  594 VCSYETNIARNLRIHMTA  611 (1406)
T ss_pred             hhcchhhhhhcccccccc
Confidence            999999999999999985


No 45 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.04  E-value=0.00053  Score=33.32  Aligned_cols=23  Identities=30%  Similarity=0.673  Sum_probs=15.7

Q ss_pred             cccCCCccccCChhHHHHHHHHhc
Q psy11318         30 YQCEECPKDFSTRKYLTQHQNAIH   53 (263)
Q Consensus        30 ~~C~~C~~~f~~~~~l~~H~~~~~   53 (263)
                      |+|+.|++... ...|.+|++.+|
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            57788887777 777888877765


No 46 
>smart00355 ZnF_C2H2 zinc finger.
Probab=96.97  E-value=0.00086  Score=32.90  Aligned_cols=23  Identities=35%  Similarity=0.765  Sum_probs=16.7

Q ss_pred             cccCCCccccCChhHHHHHHHHh
Q psy11318         30 YQCEECPKDFSTRKYLTQHQNAI   52 (263)
Q Consensus        30 ~~C~~C~~~f~~~~~l~~H~~~~   52 (263)
                      |.|..|++.|.+...|..|++.|
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHh
Confidence            46777777777777777777753


No 47 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=96.95  E-value=0.00059  Score=39.01  Aligned_cols=31  Identities=16%  Similarity=0.330  Sum_probs=17.0

Q ss_pred             CCCccCCcchhhhcChHHHHHHHhhccCCCC
Q psy11318        141 GKRYHCTQCSKFYIQESDLMEHMAVHSGVRK  171 (263)
Q Consensus       141 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~  171 (263)
                      +.|-.|+.|+..+.+.-+|++|+...|+.+|
T Consensus        22 ~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   22 EQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             S--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             CCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            4556677777777777777777766666554


No 48 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.93  E-value=0.00056  Score=33.56  Aligned_cols=22  Identities=36%  Similarity=1.059  Sum_probs=11.1

Q ss_pred             ccccccccccCChHHHHHHHHh
Q psy11318          3 YYCNACSKNFSAKDTLNKHMDI   24 (263)
Q Consensus         3 y~C~~C~~~f~~~~~L~~H~~~   24 (263)
                      |.|..|+..|.+...|..|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            3455555555555555555543


No 49 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.78  E-value=0.00076  Score=33.08  Aligned_cols=22  Identities=36%  Similarity=0.780  Sum_probs=15.0

Q ss_pred             cccCCCccccCChhHHHHHHHH
Q psy11318         30 YQCEECPKDFSTRKYLTQHQNA   51 (263)
Q Consensus        30 ~~C~~C~~~f~~~~~l~~H~~~   51 (263)
                      |.|.+|++.|.+...|+.|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            4577777777777777777654


No 50 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=96.70  E-value=0.0023  Score=52.02  Aligned_cols=130  Identities=25%  Similarity=0.419  Sum_probs=90.2

Q ss_pred             Ccccc--ccccccCChHHHHHHHHhhCCcccccCCCc---cccC------ChhHHHHHHHHhcCCCc----eeccccccc
Q psy11318          2 RYYCN--ACSKNFSAKDTLNKHMDIHKGVRYQCEECP---KDFS------TRKYLTQHQNAIHRGIR----FQCNKCFRA   66 (263)
Q Consensus         2 ~y~C~--~C~~~f~~~~~L~~H~~~h~~~~~~C~~C~---~~f~------~~~~l~~H~~~~~~~~~----~~C~~C~~~   66 (263)
                      .|.||  .|..+......|+.|....++ .+.|.+|-   +.|.      +...|..|......+.=    -.|..|...
T Consensus       151 ~F~CP~skc~~~C~~~k~lk~H~K~~H~-~~~C~~C~~nKk~F~~E~~lF~~~~Lr~H~~~G~~e~GFKGHP~C~FC~~~  229 (493)
T COG5236         151 SFKCPKSKCHRRCGSLKELKKHYKAQHG-FVLCSECIGNKKDFWNEIRLFRSSTLRDHKNGGLEEEGFKGHPLCIFCKIY  229 (493)
T ss_pred             HhcCCchhhhhhhhhHHHHHHHHHhhcC-cEEhHhhhcCcccCccceeeeecccccccccCCccccCcCCCchhhhccce
Confidence            35664  366677778999999988877 46777772   3343      44557777654332222    469999999


Q ss_pred             ccchHHHHHHHHHhcCCCcccCCcCCCc-------CCCHHHHHHHHHHhcCCccccCCCCC----CCcccCCHHHHHHHH
Q psy11318         67 YKLKKDLLAHTMLEHFGIRHPCSECPKT-------FASRHSLKNHILKIHKAVLYQCNECS----TSKDYLTKRDLRRHM  135 (263)
Q Consensus        67 f~~~~~l~~H~~~~~~~~~~~C~~C~~~-------f~~~~~l~~H~~~~~~~~~~~C~~C~----~~~~f~~~~~l~~H~  135 (263)
                      |..-..|..|++..|.    .|.+|++.       |.+...|..|.+..|    |.|.+=.    ....|.....|..|+
T Consensus       230 FYdDDEL~~HcR~~HE----~ChICD~v~p~~~QYFK~Y~~Le~HF~~~h----y~ct~qtc~~~k~~vf~~~~el~~h~  301 (493)
T COG5236         230 FYDDDELRRHCRLRHE----ACHICDMVGPIRYQYFKSYEDLEAHFRNAH----YCCTFQTCRVGKCYVFPYHTELLEHL  301 (493)
T ss_pred             ecChHHHHHHHHhhhh----hhhhhhccCccchhhhhCHHHHHHHhhcCc----eEEEEEEEecCcEEEeccHHHHHHHH
Confidence            9999999999987773    46666553       778889999988655    4442211    126799999999999


Q ss_pred             HHhCC
Q psy11318        136 KLHFN  140 (263)
Q Consensus       136 ~~h~~  140 (263)
                      ...++
T Consensus       302 ~~~h~  306 (493)
T COG5236         302 TRFHK  306 (493)
T ss_pred             HHHhh
Confidence            76554


No 51 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.53  E-value=0.00084  Score=33.67  Aligned_cols=22  Identities=45%  Similarity=1.087  Sum_probs=12.8

Q ss_pred             ccccccccccCChHHHHHHHHh
Q psy11318          3 YYCNACSKNFSAKDTLNKHMDI   24 (263)
Q Consensus         3 y~C~~C~~~f~~~~~L~~H~~~   24 (263)
                      |.|..|++.|.+...|..|+++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            5566666666666666665543


No 52 
>KOG2785|consensus
Probab=96.45  E-value=0.0084  Score=49.58  Aligned_cols=49  Identities=27%  Similarity=0.561  Sum_probs=36.2

Q ss_pred             ccccccccccCChHHHHHHHHhh--------------------------------------CCcccccCCCccccCChhH
Q psy11318          3 YYCNACSKNFSAKDTLNKHMDIH--------------------------------------KGVRYQCEECPKDFSTRKY   44 (263)
Q Consensus         3 y~C~~C~~~f~~~~~L~~H~~~h--------------------------------------~~~~~~C~~C~~~f~~~~~   44 (263)
                      |+|.-|...|.+...-+.|+.+.                                      .+.++.|.+|.+.|.....
T Consensus         4 ftC~tC~v~F~~ad~Qr~HyKSdWHRYNLKRkVA~lPPItaE~F~~k~~s~~~~~~~~~e~~~~~~~c~~c~k~~~s~~a   83 (390)
T KOG2785|consen    4 FTCNTCNVEFDDADEQRAHYKSDWHRYNLKRKVASLPPITAEEFNEKVLSDDSEKEENLEEAESVVYCEACNKSFASPKA   83 (390)
T ss_pred             ceeeceeeeeccHHHHHHHhhhhHHHhhHHhHhhcCCCcCHHHHhHHHhhhhhhhhhhhhhcccceehHHhhccccChhh
Confidence            78999999999998899998763                                      0114677777777777777


Q ss_pred             HHHHHHH
Q psy11318         45 LTQHQNA   51 (263)
Q Consensus        45 l~~H~~~   51 (263)
                      ...|+..
T Consensus        84 ~~~hl~S   90 (390)
T KOG2785|consen   84 HENHLKS   90 (390)
T ss_pred             HHHHHHH
Confidence            7777654


No 53 
>PRK04860 hypothetical protein; Provisional
Probab=96.31  E-value=0.0018  Score=47.79  Aligned_cols=39  Identities=18%  Similarity=0.310  Sum_probs=30.4

Q ss_pred             CccCCcchhhhcChHHHHHHHhhccCCCCCcCCCCcccccccc
Q psy11318        143 RYHCTQCSKFYIQESDLMEHMAVHSGVRKLTTGPIKTEQTFGV  185 (263)
Q Consensus       143 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~c~~~~~~~~  185 (263)
                      +|.|. |+.   ....+.+|.++|.+.++|.|..|+..+....
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~~  157 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVFKG  157 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEEec
Confidence            58887 876   6667788888888888888888888776544


No 54 
>KOG2785|consensus
Probab=96.15  E-value=0.0079  Score=49.75  Aligned_cols=51  Identities=14%  Similarity=0.018  Sum_probs=36.8

Q ss_pred             CccCCcchhhhcChHHHHHHHhhccCC-----------------------CCCcCCCCc---ccccccceeeeccCC
Q psy11318        143 RYHCTQCSKFYIQESDLMEHMAVHSGV-----------------------RKLTTGPIK---TEQTFGVRELRHVGF  193 (263)
Q Consensus       143 ~~~C~~C~~~f~~~~~l~~H~~~h~~~-----------------------~~~~c~~c~---~~~~~~~~l~~H~~~  193 (263)
                      |-.|..|++.+.+...-..||..+||.                       ..|.|-.|+   +.|.+.+..+.||..
T Consensus       166 Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~  242 (390)
T KOG2785|consen  166 PTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRD  242 (390)
T ss_pred             CcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhh
Confidence            456777888888777777788777763                       235666677   788888887888764


No 55 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.10  E-value=0.0013  Score=32.93  Aligned_cols=22  Identities=36%  Similarity=0.798  Sum_probs=17.6

Q ss_pred             cccCCCccccCChhHHHHHHHH
Q psy11318         30 YQCEECPKDFSTRKYLTQHQNA   51 (263)
Q Consensus        30 ~~C~~C~~~f~~~~~l~~H~~~   51 (263)
                      |.|..|++.|.+...|..|+++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            6788888888888888888764


No 56 
>PRK04860 hypothetical protein; Provisional
Probab=95.94  E-value=0.0043  Score=45.85  Aligned_cols=34  Identities=18%  Similarity=0.681  Sum_probs=16.0

Q ss_pred             cccCCCccccCChhHHHHHHHHhcCCCceecccccccc
Q psy11318         30 YQCEECPKDFSTRKYLTQHQNAIHRGIRFQCNKCFRAY   67 (263)
Q Consensus        30 ~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f   67 (263)
                      |.|. |+.   ....+.+|.+++.++.+|.|..|+..|
T Consensus       120 Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l  153 (160)
T PRK04860        120 YRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETL  153 (160)
T ss_pred             EEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCcee
Confidence            4444 444   344444454444444445554444444


No 57 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=95.53  E-value=0.0017  Score=56.36  Aligned_cols=60  Identities=20%  Similarity=0.277  Sum_probs=31.6

Q ss_pred             ccccCCCccccCChhHHHHHHH--HhcCC--Cceecc--cccccccchHHHHHHHHHhcCCCcccC
Q psy11318         29 RYQCEECPKDFSTRKYLTQHQN--AIHRG--IRFQCN--KCFRAYKLKKDLLAHTMLEHFGIRHPC   88 (263)
Q Consensus        29 ~~~C~~C~~~f~~~~~l~~H~~--~~~~~--~~~~C~--~C~~~f~~~~~l~~H~~~~~~~~~~~C   88 (263)
                      ++.|..|...|.....|.+|.+  .|.++  +++.|.  .|++.|.+...+..|...+.....+.+
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  354 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKE  354 (467)
T ss_pred             CCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCcccc
Confidence            3555555555555555555555  44555  455555  455555555555555544444443333


No 58 
>KOG2482|consensus
Probab=95.46  E-value=0.033  Score=45.45  Aligned_cols=134  Identities=19%  Similarity=0.310  Sum_probs=82.3

Q ss_pred             ccccccccc-cCChHHHHHHHHhhCCc-----------------------ccccCCCccccCChhHHHHHHHHhc-CCCc
Q psy11318          3 YYCNACSKN-FSAKDTLNKHMDIHKGV-----------------------RYQCEECPKDFSTRKYLTQHQNAIH-RGIR   57 (263)
Q Consensus         3 y~C~~C~~~-f~~~~~L~~H~~~h~~~-----------------------~~~C~~C~~~f~~~~~l~~H~~~~~-~~~~   57 (263)
                      .+|..|... -+.+...-.|+-.-++.                       .+.|-.|.+.|.++..|+.||+... ....
T Consensus       145 lqClFCn~e~lgnRs~~l~Hlf~~H~lniGlpDniVyvnelLehLkekL~r~~CLyCekifrdkntLkeHMrkK~Hrrin  224 (423)
T KOG2482|consen  145 LQCLFCNNEGLGNRSEILEHLFHVHGLNIGLPDNIVYVNELLEHLKEKLERLRCLYCEKIFRDKNTLKEHMRKKRHRRIN  224 (423)
T ss_pred             eEEEEecchhcccHHHHHHHHHHHhhhccCCCcceeeHHHHHHHHHHHHhhheeeeeccccCCcHHHHHHHHhccCcccC
Confidence            468888875 34566666776443331                       4899999999999999999998632 2221


Q ss_pred             eecccccccc--------cchHHHHHHH----HHhcCC-------------Cc--ccCCcCCCcCCCHHHHHHHHHHhcC
Q psy11318         58 FQCNKCFRAY--------KLKKDLLAHT----MLEHFG-------------IR--HPCSECPKTFASRHSLKNHILKIHK  110 (263)
Q Consensus        58 ~~C~~C~~~f--------~~~~~l~~H~----~~~~~~-------------~~--~~C~~C~~~f~~~~~l~~H~~~~~~  110 (263)
                      -+-...++.|        .+......+.    ....++             .+  ..|-.|.....+...|..||+..|.
T Consensus       225 PknreYDkfyiINY~ev~ks~t~~~~e~dret~~d~~E~D~~wsDw~ed~a~a~~v~CLfC~~~~en~~~l~eHmk~vHe  304 (423)
T KOG2482|consen  225 PKNREYDKFYIINYLEVGKSWTIVHSEDDRETNEDINETDDTWSDWNEDDAEALSVVCLFCTNFYENPVFLFEHMKIVHE  304 (423)
T ss_pred             CCccccceEEEEeHhhcCCccchhhhhhhhhhhccccccccchhhhhcCCCCccceEEEeeccchhhHHHHHHHHHHHHH
Confidence            1111111111        0111111111    001111             11  4788899888889999999988773


Q ss_pred             C---------------------------ccccCCCCCCCcccCCHHHHHHHHHHh
Q psy11318        111 A---------------------------VLYQCNECSTSKDYLTKRDLRRHMKLH  138 (263)
Q Consensus       111 ~---------------------------~~~~C~~C~~~~~f~~~~~l~~H~~~h  138 (263)
                      -                           ....|-.|.  ..|-....|..|+..+
T Consensus       305 ~Dl~Ki~sd~~Ln~YqrvrviNyiRkq~~~~~c~~cd--~~F~~e~~l~~hm~e~  357 (423)
T KOG2482|consen  305 FDLLKIQSDYSLNFYQRVRVINYIRKQKKKSRCAECD--LSFWKEPGLLIHMVED  357 (423)
T ss_pred             hhHHhhccccccchhhhhhHHHHHHHHhhcccccccc--ccccCcchhhhhcccc
Confidence            1                           124677787  7899999999999743


No 59 
>KOG2893|consensus
Probab=95.43  E-value=0.003  Score=48.61  Aligned_cols=50  Identities=34%  Similarity=0.548  Sum_probs=37.9

Q ss_pred             cccCCCccccCChhHHHHHHHHhcCCCceecccccccccchHHHHHHHHHhcCC
Q psy11318         30 YQCEECPKDFSTRKYLTQHQNAIHRGIRFQCNKCFRAYKLKKDLLAHTMLEHFG   83 (263)
Q Consensus        30 ~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~   83 (263)
                      -.|=+|++.|.+...|++|++..|    |+|-+|.+...+--.|..|.+..|.+
T Consensus        11 pwcwycnrefddekiliqhqkakh----fkchichkkl~sgpglsihcmqvhke   60 (341)
T KOG2893|consen   11 PWCWYCNREFDDEKILIQHQKAKH----FKCHICHKKLFSGPGLSIHCMQVHKE   60 (341)
T ss_pred             ceeeecccccchhhhhhhhhhhcc----ceeeeehhhhccCCCceeehhhhhhh
Confidence            367789999999999999988866    88888888776666666665444433


No 60 
>KOG2482|consensus
Probab=95.33  E-value=0.042  Score=44.83  Aligned_cols=50  Identities=22%  Similarity=0.203  Sum_probs=41.4

Q ss_pred             ccCCcchhhhcChHHHHHHHhhccC---------------------------CCCCcCCCCcccccccceeeeccCC
Q psy11318        144 YHCTQCSKFYIQESDLMEHMAVHSG---------------------------VRKLTTGPIKTEQTFGVRELRHVGF  193 (263)
Q Consensus       144 ~~C~~C~~~f~~~~~l~~H~~~h~~---------------------------~~~~~c~~c~~~~~~~~~l~~H~~~  193 (263)
                      .+|..|....-+...|..||..-|.                           .....|-.|...|.....|+.||..
T Consensus       280 v~CLfC~~~~en~~~l~eHmk~vHe~Dl~Ki~sd~~Ln~YqrvrviNyiRkq~~~~~c~~cd~~F~~e~~l~~hm~e  356 (423)
T KOG2482|consen  280 VVCLFCTNFYENPVFLFEHMKIVHEFDLLKIQSDYSLNFYQRVRVINYIRKQKKKSRCAECDLSFWKEPGLLIHMVE  356 (423)
T ss_pred             eEEEeeccchhhHHHHHHHHHHHHHhhHHhhccccccchhhhhhHHHHHHHHhhccccccccccccCcchhhhhccc
Confidence            5899999999989999999976542                           1234788999999999999999975


No 61 
>KOG4173|consensus
Probab=95.13  E-value=0.011  Score=44.53  Aligned_cols=105  Identities=23%  Similarity=0.436  Sum_probs=52.5

Q ss_pred             ccCChhHHHHHHHHhc-----CCC-------ceeccc--ccccccchHHHHHHHHHhcCCCcccCCcCCCcCCCHHHHHH
Q psy11318         38 DFSTRKYLTQHQNAIH-----RGI-------RFQCNK--CFRAYKLKKDLLAHTMLEHFGIRHPCSECPKTFASRHSLKN  103 (263)
Q Consensus        38 ~f~~~~~l~~H~~~~~-----~~~-------~~~C~~--C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~  103 (263)
                      .|.-.+++++|+...-     .+.       .|.|++  |-..|........|-..-|+   ..|..|.+.|++...|..
T Consensus        48 pFf~~G~v~r~l~~~~V~~d~~d~~~~~~~~~~~cqvagc~~~~d~lD~~E~hY~~~h~---~sCs~C~r~~Pt~hLLd~  124 (253)
T KOG4173|consen   48 PFFEDGDVQRHLYLQDVIMDVADVPEKPRVPAFACQVAGCCQVFDALDDYEHHYHTLHG---NSCSFCKRAFPTGHLLDA  124 (253)
T ss_pred             cchhcccHHHHHhHhhheeeccccccccccccccccccchHHHHhhhhhHHHhhhhccc---chhHHHHHhCCchhhhhH
Confidence            4556667777765321     000       145544  44555555544444333332   245555555555555555


Q ss_pred             HHHHhcCCccccCCCCCCCcccCCHHHHHHHHHHhCCCCCccCCc--chhhhcChHHHHHHHhh
Q psy11318        104 HILKIHKAVLYQCNECSTSKDYLTKRDLRRHMKLHFNGKRYHCTQ--CSKFYIQESDLMEHMAV  165 (263)
Q Consensus       104 H~~~~~~~~~~~C~~C~~~~~f~~~~~l~~H~~~h~~~~~~~C~~--C~~~f~~~~~l~~H~~~  165 (263)
                      |+...|..            -|.        .....|.-.|.|.+  |+..|.+.-.-++|+-.
T Consensus       125 HI~E~HDs------------~Fq--------a~veRG~dMy~ClvEgCt~KFkT~r~RkdH~I~  168 (253)
T KOG4173|consen  125 HILEWHDS------------LFQ--------ALVERGQDMYQCLVEGCTEKFKTSRDRKDHMIR  168 (253)
T ss_pred             HHHHHHHH------------HHH--------HHHHcCccHHHHHHHhhhhhhhhhhhhhhHHHH
Confidence            55544420            000        00112344567755  77777777777777643


No 62 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=94.97  E-value=0.019  Score=30.57  Aligned_cols=21  Identities=24%  Similarity=0.855  Sum_probs=10.9

Q ss_pred             ccccccccccCChHHHHHHHH
Q psy11318          3 YYCNACSKNFSAKDTLNKHMD   23 (263)
Q Consensus         3 y~C~~C~~~f~~~~~L~~H~~   23 (263)
                      |.|.+|+..|.+...+..|++
T Consensus         4 ~~C~~C~~~~~~~~~~~~H~~   24 (35)
T smart00451        4 FYCKLCNVTFTDEISVEAHLK   24 (35)
T ss_pred             eEccccCCccCCHHHHHHHHC
Confidence            445555555555555555543


No 63 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=94.78  E-value=0.0059  Score=52.90  Aligned_cols=142  Identities=17%  Similarity=0.201  Sum_probs=102.1

Q ss_pred             CceecccccccccchHHHHHHHH--HhcCC--CcccCC--cCCCcCCCHHHHHHHHHHhcCCccccCCCCCCCcccCCHH
Q psy11318         56 IRFQCNKCFRAYKLKKDLLAHTM--LEHFG--IRHPCS--ECPKTFASRHSLKNHILKIHKAVLYQCNECSTSKDYLTKR  129 (263)
Q Consensus        56 ~~~~C~~C~~~f~~~~~l~~H~~--~~~~~--~~~~C~--~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~~~f~~~~  129 (263)
                      ..+.|..|...|.....|..|..  .|..+  +++.|+  .|++.|.+...+..|...|.+..++.+..-.+...+....
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  367 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEKLLNSSSKFSPLL  367 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCccccccccCcccccccc
Confidence            35788999999999999999998  68888  899999  7999999999999999999888777775544334443333


Q ss_pred             HHHHHH-----HHhCCCCCccCCc--chhhhcChHHHHHHHhhccCCC--CCcCCCCcccccccceeeeccCCCccc
Q psy11318        130 DLRRHM-----KLHFNGKRYHCTQ--CSKFYIQESDLMEHMAVHSGVR--KLTTGPIKTEQTFGVRELRHVGFPMKT  197 (263)
Q Consensus       130 ~l~~H~-----~~h~~~~~~~C~~--C~~~f~~~~~l~~H~~~h~~~~--~~~c~~c~~~~~~~~~l~~H~~~~~~~  197 (263)
                      .-..+.     ..-...+.+.+..  |...+.+...+..|...|....  .+.+..|...+.....+..|++.+...
T Consensus       368 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  444 (467)
T COG5048         368 NNEPPQSLQQYKDLKNDKKSETLSNSCIRNFKRDSNLSLHIITHLSFRPYNCKNPPCSKSFNRHYNLIPHKKIHTNH  444 (467)
T ss_pred             CCCCccchhhccCccCCccccccccchhhhhccccccccccccccccCCcCCCCCcchhhccCcccccccccccccC
Confidence            311111     1112233455544  7777778878888877777665  467788889898888888888876543


No 64 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=94.21  E-value=0.024  Score=29.79  Aligned_cols=24  Identities=21%  Similarity=0.761  Sum_probs=14.2

Q ss_pred             ccccccccccCChHHHHHHHHhhCCcccccCCCcc
Q psy11318          3 YYCNACSKNFSAKDTLNKHMDIHKGVRYQCEECPK   37 (263)
Q Consensus         3 y~C~~C~~~f~~~~~L~~H~~~h~~~~~~C~~C~~   37 (263)
                      |.|..||..+.-..           .++.|++||.
T Consensus         2 ~~C~~CGy~y~~~~-----------~~~~CP~Cg~   25 (33)
T cd00350           2 YVCPVCGYIYDGEE-----------APWVCPVCGA   25 (33)
T ss_pred             EECCCCCCEECCCc-----------CCCcCcCCCC
Confidence            56667776655432           4566666654


No 65 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=94.20  E-value=0.045  Score=26.73  Aligned_cols=19  Identities=37%  Similarity=0.795  Sum_probs=11.6

Q ss_pred             cccccccccCChHHHHHHHH
Q psy11318          4 YCNACSKNFSAKDTLNKHMD   23 (263)
Q Consensus         4 ~C~~C~~~f~~~~~L~~H~~   23 (263)
                      .|+.||..| ..+.|..|+.
T Consensus         4 ~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    4 PCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             cCCCCCCEE-CHHHHHHHHH
Confidence            566666666 3566666654


No 66 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=94.19  E-value=0.048  Score=26.65  Aligned_cols=21  Identities=24%  Similarity=0.612  Sum_probs=14.5

Q ss_pred             cccCCCccccCChhHHHHHHHH
Q psy11318         30 YQCEECPKDFSTRKYLTQHQNA   51 (263)
Q Consensus        30 ~~C~~C~~~f~~~~~l~~H~~~   51 (263)
                      ..|+.||+.| ....|..|+..
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~~   23 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEKI   23 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHHh
Confidence            4677888877 56667777653


No 67 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=94.07  E-value=0.035  Score=29.44  Aligned_cols=23  Identities=17%  Similarity=0.483  Sum_probs=18.5

Q ss_pred             ccccCCCccccCChhHHHHHHHH
Q psy11318         29 RYQCEECPKDFSTRKYLTQHQNA   51 (263)
Q Consensus        29 ~~~C~~C~~~f~~~~~l~~H~~~   51 (263)
                      +|.|.+|++.|.+...+..|++.
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            57788888888888888888765


No 68 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=94.04  E-value=0.024  Score=30.88  Aligned_cols=36  Identities=25%  Similarity=0.582  Sum_probs=21.8

Q ss_pred             CCccccccccccCChHHHHHHHHhhCCcccccCCCccccC
Q psy11318          1 MRYYCNACSKNFSAKDTLNKHMDIHKGVRYQCEECPKDFS   40 (263)
Q Consensus         1 ~~y~C~~C~~~f~~~~~L~~H~~~h~~~~~~C~~C~~~f~   40 (263)
                      |.+.|+.|+..|.-......    ..+....|+.|+..|.
T Consensus         1 M~~~CP~C~~~~~v~~~~~~----~~~~~v~C~~C~~~~~   36 (38)
T TIGR02098         1 MRIQCPNCKTSFRVVDSQLG----ANGGKVRCGKCGHVWY   36 (38)
T ss_pred             CEEECCCCCCEEEeCHHHcC----CCCCEEECCCCCCEEE
Confidence            56778888887765544321    1223567777777664


No 69 
>KOG2893|consensus
Probab=94.01  E-value=0.016  Score=44.77  Aligned_cols=51  Identities=24%  Similarity=0.555  Sum_probs=42.1

Q ss_pred             CccccccccccCChHHHHHHHHhhCCcccccCCCccccCChhHHHHHHHHhcCC
Q psy11318          2 RYYCNACSKNFSAKDTLNKHMDIHKGVRYQCEECPKDFSTRKYLTQHQNAIHRG   55 (263)
Q Consensus         2 ~y~C~~C~~~f~~~~~L~~H~~~h~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~   55 (263)
                      +-+|=+|+..|...+.|..|+   ..+-|+|.+|.|...+--.|..|-+..|.+
T Consensus        10 kpwcwycnrefddekiliqhq---kakhfkchichkkl~sgpglsihcmqvhke   60 (341)
T KOG2893|consen   10 KPWCWYCNREFDDEKILIQHQ---KAKHFKCHICHKKLFSGPGLSIHCMQVHKE   60 (341)
T ss_pred             Cceeeecccccchhhhhhhhh---hhccceeeeehhhhccCCCceeehhhhhhh
Confidence            348999999999999999998   445699999998888877788887765644


No 70 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=93.22  E-value=0.11  Score=35.59  Aligned_cols=49  Identities=18%  Similarity=0.415  Sum_probs=29.9

Q ss_pred             cCCCCCCCcccCCHHHHHHHHHHhCCCCCccCCcchhhhcChHHHHHHHhhcc
Q psy11318        115 QCNECSTSKDYLTKRDLRRHMKLHFNGKRYHCTQCSKFYIQESDLMEHMAVHS  167 (263)
Q Consensus       115 ~C~~C~~~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~  167 (263)
                      .|-.|+  ..|........-  .-.....|.|+.|...|-..-+...|...|.
T Consensus        57 ~C~~C~--~~f~~~~~~~~~--~~~~~~~y~C~~C~~~FC~dCD~fiHe~Lh~  105 (112)
T TIGR00622        57 FCFGCQ--GPFPKPPVSPFD--ELKDSHRYVCAVCKNVFCVDCDVFVHESLHC  105 (112)
T ss_pred             cccCcC--CCCCCccccccc--ccccccceeCCCCCCccccccchhhhhhccC
Confidence            477777  666543211100  0122345888888888888888888877775


No 71 
>KOG2186|consensus
Probab=92.78  E-value=0.047  Score=42.65  Aligned_cols=54  Identities=24%  Similarity=0.628  Sum_probs=40.9

Q ss_pred             ccccccccccCChHHHHHHHHhhCCcccccCCCccccCChhHHHHHHHHhcCCCce
Q psy11318          3 YYCNACSKNFSAKDTLNKHMDIHKGVRYQCEECPKDFSTRKYLTQHQNAIHRGIRF   58 (263)
Q Consensus         3 y~C~~C~~~f~~~~~L~~H~~~h~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~   58 (263)
                      |.|..||.... +..|-.|+....+..|.|-.|++.|.. ..++.|..-......|
T Consensus         4 FtCnvCgEsvK-Kp~vekH~srCrn~~fSCIDC~k~F~~-~sYknH~kCITEaQKY   57 (276)
T KOG2186|consen    4 FTCNVCGESVK-KPQVEKHMSRCRNAYFSCIDCGKTFER-VSYKNHTKCITEAQKY   57 (276)
T ss_pred             Eehhhhhhhcc-ccchHHHHHhccCCeeEEeeccccccc-chhhhhhhhcchHHHh
Confidence            67888888765 566777888888888888888888888 6678887655544433


No 72 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=92.73  E-value=0.2  Score=34.54  Aligned_cols=26  Identities=19%  Similarity=0.514  Sum_probs=20.8

Q ss_pred             CccC----CcchhhhcChHHHHHHHhhccC
Q psy11318        143 RYHC----TQCSKFYIQESDLMEHMAVHSG  168 (263)
Q Consensus       143 ~~~C----~~C~~~f~~~~~l~~H~~~h~~  168 (263)
                      .|.|    ..|++.+.+...+.+|++.+||
T Consensus        80 G~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   80 GYRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             CeeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            3788    8888888888888888887764


No 73 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=92.59  E-value=0.06  Score=28.91  Aligned_cols=35  Identities=26%  Similarity=0.582  Sum_probs=21.2

Q ss_pred             CCccccccccccCChHHHHHHHHhhCCcccccCCCcccc
Q psy11318          1 MRYYCNACSKNFSAKDTLNKHMDIHKGVRYQCEECPKDF   39 (263)
Q Consensus         1 ~~y~C~~C~~~f~~~~~L~~H~~~h~~~~~~C~~C~~~f   39 (263)
                      |...|+.|+..|.-.+...    --.+...+|..|+..|
T Consensus         1 M~i~Cp~C~~~y~i~d~~i----p~~g~~v~C~~C~~~f   35 (36)
T PF13717_consen    1 MIITCPNCQAKYEIDDEKI----PPKGRKVRCSKCGHVF   35 (36)
T ss_pred             CEEECCCCCCEEeCCHHHC----CCCCcEEECCCCCCEe
Confidence            4567777777776655432    1234456777777665


No 74 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=92.44  E-value=0.2  Score=34.38  Aligned_cols=24  Identities=29%  Similarity=0.559  Sum_probs=13.3

Q ss_pred             cccCCCCCCCcccCCHHHHHHHHHHh
Q psy11318        113 LYQCNECSTSKDYLTKRDLRRHMKLH  138 (263)
Q Consensus       113 ~~~C~~C~~~~~f~~~~~l~~H~~~h  138 (263)
                      .|+|+.|.  ..|-..-++-.|...|
T Consensus        81 ~y~C~~C~--~~FC~dCD~fiHe~Lh  104 (112)
T TIGR00622        81 RYVCAVCK--NVFCVDCDVFVHESLH  104 (112)
T ss_pred             ceeCCCCC--Cccccccchhhhhhcc
Confidence            45666666  5555555555555444


No 75 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=92.07  E-value=0.022  Score=44.50  Aligned_cols=23  Identities=22%  Similarity=0.540  Sum_probs=16.0

Q ss_pred             CCccccccccccCChHHHHHHHH
Q psy11318          1 MRYYCNACSKNFSAKDTLNKHMD   23 (263)
Q Consensus         1 ~~y~C~~C~~~f~~~~~L~~H~~   23 (263)
                      |.+.||+|++.|.++..+....+
T Consensus         4 k~~~CPvC~~~F~~~~vrs~~~r   26 (214)
T PF09986_consen    4 KKITCPVCGKEFKTKKVRSGKIR   26 (214)
T ss_pred             CceECCCCCCeeeeeEEEcCCce
Confidence            56788888888887765555543


No 76 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=91.92  E-value=0.094  Score=30.61  Aligned_cols=30  Identities=17%  Similarity=0.455  Sum_probs=24.8

Q ss_pred             CCCCCccCCcchhhhcChHHHHHHHhhccC
Q psy11318        139 FNGKRYHCTQCSKFYIQESDLMEHMAVHSG  168 (263)
Q Consensus       139 ~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~  168 (263)
                      .||.-++|+.||..|....++.+|....|+
T Consensus        13 DGE~~lrCPRC~~~FR~~K~Y~RHVNKaH~   42 (65)
T COG4049          13 DGEEFLRCPRCGMVFRRRKDYIRHVNKAHG   42 (65)
T ss_pred             CCceeeeCCchhHHHHHhHHHHHHhhHHhh
Confidence            466778899999999999999999876654


No 77 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=91.69  E-value=0.4  Score=33.05  Aligned_cols=25  Identities=24%  Similarity=0.458  Sum_probs=21.7

Q ss_pred             ccC----CcCCCcCCCHHHHHHHHHHhcC
Q psy11318         86 HPC----SECPKTFASRHSLKNHILKIHK  110 (263)
Q Consensus        86 ~~C----~~C~~~f~~~~~l~~H~~~~~~  110 (263)
                      |.|    ..|+..+.+...|..|++.+||
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            778    8899999999999999988875


No 78 
>KOG4173|consensus
Probab=91.54  E-value=0.1  Score=39.45  Aligned_cols=79  Identities=25%  Similarity=0.501  Sum_probs=59.5

Q ss_pred             ccccCC--CccccCChhHHHHHHHHhcCCCceecccccccccchHHHHHHHHHhc----------CCCcccC--CcCCCc
Q psy11318         29 RYQCEE--CPKDFSTRKYLTQHQNAIHRGIRFQCNKCFRAYKLKKDLLAHTMLEH----------FGIRHPC--SECPKT   94 (263)
Q Consensus        29 ~~~C~~--C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~----------~~~~~~C--~~C~~~   94 (263)
                      .|.|++  |-..|.+...+..|-.+.|+   -.|..|.+.|.+..-|..|+..-|          +...|.|  ..|+..
T Consensus        79 ~~~cqvagc~~~~d~lD~~E~hY~~~h~---~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~K  155 (253)
T KOG4173|consen   79 AFACQVAGCCQVFDALDDYEHHYHTLHG---NSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEK  155 (253)
T ss_pred             cccccccchHHHHhhhhhHHHhhhhccc---chhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhh
Confidence            467776  77788888888888777666   378888888888888888875443          3455788  458888


Q ss_pred             CCCHHHHHHHHHHhcC
Q psy11318         95 FASRHSLKNHILKIHK  110 (263)
Q Consensus        95 f~~~~~l~~H~~~~~~  110 (263)
                      |.+...-..|+-..|.
T Consensus       156 FkT~r~RkdH~I~~Hk  171 (253)
T KOG4173|consen  156 FKTSRDRKDHMIRMHK  171 (253)
T ss_pred             hhhhhhhhhHHHHhcc
Confidence            8888888888766653


No 79 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=90.51  E-value=0.13  Score=27.23  Aligned_cols=25  Identities=16%  Similarity=0.474  Sum_probs=14.5

Q ss_pred             CccccccccccCChHHHHHHHHhhCCcccccCCCcc
Q psy11318          2 RYYCNACSKNFSAKDTLNKHMDIHKGVRYQCEECPK   37 (263)
Q Consensus         2 ~y~C~~C~~~f~~~~~L~~H~~~h~~~~~~C~~C~~   37 (263)
                      .|.|..||..+...           ..|-.|++|+.
T Consensus         2 ~~~C~~CG~i~~g~-----------~~p~~CP~Cg~   26 (34)
T cd00729           2 VWVCPVCGYIHEGE-----------EAPEKCPICGA   26 (34)
T ss_pred             eEECCCCCCEeECC-----------cCCCcCcCCCC
Confidence            46677777665432           13556777764


No 80 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=90.07  E-value=0.15  Score=29.85  Aligned_cols=26  Identities=27%  Similarity=0.473  Sum_probs=14.4

Q ss_pred             CcccCCcCCCcCCCHHHHHHHHHHhc
Q psy11318         84 IRHPCSECPKTFASRHSLKNHILKIH  109 (263)
Q Consensus        84 ~~~~C~~C~~~f~~~~~l~~H~~~~~  109 (263)
                      ..+.|+.|+..|...-.+.+|....|
T Consensus        16 ~~lrCPRC~~~FR~~K~Y~RHVNKaH   41 (65)
T COG4049          16 EFLRCPRCGMVFRRRKDYIRHVNKAH   41 (65)
T ss_pred             eeeeCCchhHHHHHhHHHHHHhhHHh
Confidence            44555555555555555555555544


No 81 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=89.60  E-value=0.19  Score=27.11  Aligned_cols=36  Identities=25%  Similarity=0.523  Sum_probs=19.5

Q ss_pred             CCccccccccccCChHHHHHHHHhhCCcccccCCCccccC
Q psy11318          1 MRYYCNACSKNFSAKDTLNKHMDIHKGVRYQCEECPKDFS   40 (263)
Q Consensus         1 ~~y~C~~C~~~f~~~~~L~~H~~~h~~~~~~C~~C~~~f~   40 (263)
                      |...|+.|+..|.-...-    ..-.+...+|+.|+..|.
T Consensus         1 M~i~CP~C~~~f~v~~~~----l~~~~~~vrC~~C~~~f~   36 (37)
T PF13719_consen    1 MIITCPNCQTRFRVPDDK----LPAGGRKVRCPKCGHVFR   36 (37)
T ss_pred             CEEECCCCCceEEcCHHH----cccCCcEEECCCCCcEee
Confidence            445677777766654431    112334566666666553


No 82 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=87.74  E-value=0.31  Score=27.49  Aligned_cols=28  Identities=29%  Similarity=0.636  Sum_probs=17.9

Q ss_pred             CCccccccccccCChHHHHHHHHhhCCcccccCCCccc
Q psy11318          1 MRYYCNACSKNFSAKDTLNKHMDIHKGVRYQCEECPKD   38 (263)
Q Consensus         1 ~~y~C~~C~~~f~~~~~L~~H~~~h~~~~~~C~~C~~~   38 (263)
                      +.|.|..||..|...          .+.+..|+.||..
T Consensus         1 ~~Y~C~~Cg~~~~~~----------~~~~irC~~CG~r   28 (44)
T smart00659        1 MIYICGECGRENEIK----------SKDVVRCRECGYR   28 (44)
T ss_pred             CEEECCCCCCEeecC----------CCCceECCCCCce
Confidence            357777887776633          3346777777654


No 83 
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=87.71  E-value=0.23  Score=39.14  Aligned_cols=92  Identities=13%  Similarity=0.257  Sum_probs=43.1

Q ss_pred             hcCCCcccCCcCCCcCCCHHHHHHHHHHhc--CCccccCCCCCCCcccCCHHHHHHHHHHhCCCCCccCCcchhhhcChH
Q psy11318         80 EHFGIRHPCSECPKTFASRHSLKNHILKIH--KAVLYQCNECSTSKDYLTKRDLRRHMKLHFNGKRYHCTQCSKFYIQES  157 (263)
Q Consensus        80 ~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~--~~~~~~C~~C~~~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~  157 (263)
                      .|+++.|.|..|...+- ...-..|+.+-.  ....|+|..|+  + +                -.|.|..|...|-.-.
T Consensus       137 ~hGGrif~CsfC~~flC-EDDQFEHQAsCQvLe~E~~KC~SCN--r-l----------------Gq~sCLRCK~cfCddH  196 (314)
T PF06524_consen  137 DHGGRIFKCSFCDNFLC-EDDQFEHQASCQVLESETFKCQSCN--R-L----------------GQYSCLRCKICFCDDH  196 (314)
T ss_pred             cCCCeEEEeecCCCeee-ccchhhhhhhhhhhhcccccccccc--c-c----------------cchhhhheeeeehhhh
Confidence            35777888888775332 222233433221  23457777775  2 1                1244554444443322


Q ss_pred             HHHHHHhhccCCCCCcCCCCcccccccceeeeccC
Q psy11318        158 DLMEHMAVHSGVRKLTTGPIKTEQTFGVRELRHVG  192 (263)
Q Consensus       158 ~l~~H~~~h~~~~~~~c~~c~~~~~~~~~l~~H~~  192 (263)
                      ...+-.. ....+++.|+.|++....-..|--..+
T Consensus       197 vrrKg~k-y~k~k~~PCPKCg~et~eTkdLSmStR  230 (314)
T PF06524_consen  197 VRRKGFK-YEKGKPIPCPKCGYETQETKDLSMSTR  230 (314)
T ss_pred             hhhcccc-cccCCCCCCCCCCCcccccccceeeee
Confidence            1111111 122356677777766654444443333


No 84 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=86.26  E-value=0.56  Score=32.23  Aligned_cols=13  Identities=23%  Similarity=0.662  Sum_probs=6.2

Q ss_pred             cccCCcCCCcCCC
Q psy11318         85 RHPCSECPKTFAS   97 (263)
Q Consensus        85 ~~~C~~C~~~f~~   97 (263)
                      |..|++||..|.-
T Consensus        26 PivCP~CG~~~~~   38 (108)
T PF09538_consen   26 PIVCPKCGTEFPP   38 (108)
T ss_pred             CccCCCCCCccCc
Confidence            4445555554443


No 85 
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=85.73  E-value=0.72  Score=36.44  Aligned_cols=94  Identities=21%  Similarity=0.358  Sum_probs=55.0

Q ss_pred             hcCCCceecccccccccchHHHHHHHHHhc--CCCcccCCcCCCcCCCHHHHHHHHHHhcCCccccCCCCCCCcccCCHH
Q psy11318         52 IHRGIRFQCNKCFRAYKLKKDLLAHTMLEH--FGIRHPCSECPKTFASRHSLKNHILKIHKAVLYQCNECSTSKDYLTKR  129 (263)
Q Consensus        52 ~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~--~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~~~f~~~~  129 (263)
                      .|+++.|.|..|......-..+ .|+.+-.  ....|+|..|++.                 ..|.|..|.  .-|-...
T Consensus       137 ~hGGrif~CsfC~~flCEDDQF-EHQAsCQvLe~E~~KC~SCNrl-----------------Gq~sCLRCK--~cfCddH  196 (314)
T PF06524_consen  137 DHGGRIFKCSFCDNFLCEDDQF-EHQASCQVLESETFKCQSCNRL-----------------GQYSCLRCK--ICFCDDH  196 (314)
T ss_pred             cCCCeEEEeecCCCeeeccchh-hhhhhhhhhhcccccccccccc-----------------cchhhhhee--eeehhhh
Confidence            4677889999999865544443 3443322  2367899999863                 124555554  3332221


Q ss_pred             HHHHHHHHhCCCCCccCCcchhhhcChHHHHHHHhhc
Q psy11318        130 DLRRHMKLHFNGKRYHCTQCSKFYIQESDLMEHMAVH  166 (263)
Q Consensus       130 ~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h  166 (263)
                      ....-... ...+++.|+.|++.......|..-.+.|
T Consensus       197 vrrKg~ky-~k~k~~PCPKCg~et~eTkdLSmStR~h  232 (314)
T PF06524_consen  197 VRRKGFKY-EKGKPIPCPKCGYETQETKDLSMSTRSH  232 (314)
T ss_pred             hhhccccc-ccCCCCCCCCCCCcccccccceeeeecc
Confidence            11111112 2347899999998887777776555555


No 86 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=85.15  E-value=0.17  Score=27.87  Aligned_cols=11  Identities=36%  Similarity=1.159  Sum_probs=6.5

Q ss_pred             ccccccccccC
Q psy11318          3 YYCNACSKNFS   13 (263)
Q Consensus         3 y~C~~C~~~f~   13 (263)
                      |+|+.||..|.
T Consensus         6 y~C~~Cg~~fe   16 (41)
T smart00834        6 YRCEDCGHTFE   16 (41)
T ss_pred             EEcCCCCCEEE
Confidence            55666666554


No 87 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=85.14  E-value=0.44  Score=34.89  Aligned_cols=36  Identities=17%  Similarity=0.438  Sum_probs=24.4

Q ss_pred             cccccCCCccccCChhHHHHHHHHhcCCCceecccccccc
Q psy11318         28 VRYQCEECPKDFSTRKYLTQHQNAIHRGIRFQCNKCFRAY   67 (263)
Q Consensus        28 ~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f   67 (263)
                      .-|.|+.|+..|.....+..-    .....|.|+.||...
T Consensus        98 ~~Y~Cp~C~~~y~~~ea~~~~----d~~~~f~Cp~Cg~~l  133 (147)
T smart00531       98 AYYKCPNCQSKYTFLEANQLL----DMDGTFTCPRCGEEL  133 (147)
T ss_pred             cEEECcCCCCEeeHHHHHHhc----CCCCcEECCCCCCEE
Confidence            379999999888865543320    123449999999765


No 88 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=83.19  E-value=0.67  Score=34.40  Aligned_cols=24  Identities=17%  Similarity=0.257  Sum_probs=14.9

Q ss_pred             CccCCcchhhhcChHHHHHHHhhccCCCCCcCCCCcc
Q psy11318        143 RYHCTQCSKFYIQESDLMEHMAVHSGVRKLTTGPIKT  179 (263)
Q Consensus       143 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~c~~  179 (263)
                      -|+|++||+.             +-|+-|.+|++|+-
T Consensus       134 ~~vC~vCGy~-------------~~ge~P~~CPiCga  157 (166)
T COG1592         134 VWVCPVCGYT-------------HEGEAPEVCPICGA  157 (166)
T ss_pred             EEEcCCCCCc-------------ccCCCCCcCCCCCC
Confidence            4777777654             33566677777763


No 89 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=82.52  E-value=0.27  Score=28.75  Aligned_cols=11  Identities=45%  Similarity=1.222  Sum_probs=5.7

Q ss_pred             ccccccccccC
Q psy11318          3 YYCNACSKNFS   13 (263)
Q Consensus         3 y~C~~C~~~f~   13 (263)
                      |+|..||..|.
T Consensus         6 y~C~~Cg~~fe   16 (52)
T TIGR02605         6 YRCTACGHRFE   16 (52)
T ss_pred             EEeCCCCCEeE
Confidence            45555555444


No 90 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=82.14  E-value=1.1  Score=30.82  Aligned_cols=30  Identities=13%  Similarity=0.170  Sum_probs=23.0

Q ss_pred             ccCCcchhhhcChHHHHHHHhhccCCCCCcCCCCccccccc
Q psy11318        144 YHCTQCSKFYIQESDLMEHMAVHSGVRKLTTGPIKTEQTFG  184 (263)
Q Consensus       144 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~c~~~~~~~  184 (263)
                      ..|+.||..|...           +..|.+|+.||..|.-.
T Consensus        10 R~Cp~CG~kFYDL-----------nk~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   10 RTCPSCGAKFYDL-----------NKDPIVCPKCGTEFPPE   39 (108)
T ss_pred             ccCCCCcchhccC-----------CCCCccCCCCCCccCcc
Confidence            6788888888654           34778888888887665


No 91 
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=82.11  E-value=1  Score=25.06  Aligned_cols=21  Identities=29%  Similarity=0.687  Sum_probs=10.2

Q ss_pred             cccCCCccccCChhHHHHHHH
Q psy11318         30 YQCEECPKDFSTRKYLTQHQN   50 (263)
Q Consensus        30 ~~C~~C~~~f~~~~~l~~H~~   50 (263)
                      |+|-+|..+..-++.|-.||+
T Consensus        21 ykcfqcpftc~~kshl~nhmk   41 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMK   41 (54)
T ss_pred             ceeecCCcccchHHHHHHHHH
Confidence            344444444444555555543


No 92 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=82.00  E-value=0.32  Score=27.67  Aligned_cols=12  Identities=25%  Similarity=0.902  Sum_probs=6.8

Q ss_pred             CccccccccccC
Q psy11318          2 RYYCNACSKNFS   13 (263)
Q Consensus         2 ~y~C~~C~~~f~   13 (263)
                      .|.|+.||..|.
T Consensus         3 ~y~C~~CG~~~~   14 (46)
T PRK00398          3 EYKCARCGREVE   14 (46)
T ss_pred             EEECCCCCCEEE
Confidence            456666666543


No 93 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=81.95  E-value=0.18  Score=37.02  Aligned_cols=16  Identities=31%  Similarity=0.634  Sum_probs=10.9

Q ss_pred             cccCCCccccCChhHH
Q psy11318         30 YQCEECPKDFSTRKYL   45 (263)
Q Consensus        30 ~~C~~C~~~f~~~~~l   45 (263)
                      ++|+-||+.|.+...+
T Consensus        29 ~~c~~c~~~f~~~e~~   44 (154)
T PRK00464         29 RECLACGKRFTTFERV   44 (154)
T ss_pred             eeccccCCcceEeEec
Confidence            6777777777766543


No 94 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=81.66  E-value=1.3  Score=24.90  Aligned_cols=23  Identities=22%  Similarity=0.440  Sum_probs=13.3

Q ss_pred             ccccCCCccccCCh----hHHHHHHHH
Q psy11318         29 RYQCEECPKDFSTR----KYLTQHQNA   51 (263)
Q Consensus        29 ~~~C~~C~~~f~~~----~~l~~H~~~   51 (263)
                      ..+|.+|++.+...    ..|++|++.
T Consensus        16 ~a~C~~C~~~~~~~~~~ts~l~~HL~~   42 (45)
T PF02892_consen   16 KAKCKYCGKVIKYSSGGTSNLKRHLKK   42 (45)
T ss_dssp             -EEETTTTEE-----SSTHHHHHHHHH
T ss_pred             eEEeCCCCeEEeeCCCcHHHHHHhhhh
Confidence            56788888777663    667777754


No 95 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=81.35  E-value=0.24  Score=38.72  Aligned_cols=22  Identities=27%  Similarity=0.585  Sum_probs=14.6

Q ss_pred             ccccCCCccccCChhHHHHHHH
Q psy11318         29 RYQCEECPKDFSTRKYLTQHQN   50 (263)
Q Consensus        29 ~~~C~~C~~~f~~~~~l~~H~~   50 (263)
                      ...||+|+..|.+........+
T Consensus         5 ~~~CPvC~~~F~~~~vrs~~~r   26 (214)
T PF09986_consen    5 KITCPVCGKEFKTKKVRSGKIR   26 (214)
T ss_pred             ceECCCCCCeeeeeEEEcCCce
Confidence            4678888888877765544443


No 96 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=81.24  E-value=1.5  Score=21.52  Aligned_cols=19  Identities=26%  Similarity=0.772  Sum_probs=10.1

Q ss_pred             cccccccccCChHHHHHHHH
Q psy11318          4 YCNACSKNFSAKDTLNKHMD   23 (263)
Q Consensus         4 ~C~~C~~~f~~~~~L~~H~~   23 (263)
                      .||+|++.+ ....++.|+.
T Consensus         3 ~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        3 QCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHHH
Confidence            456666655 3445555553


No 97 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=79.59  E-value=0.75  Score=26.47  Aligned_cols=11  Identities=27%  Similarity=0.978  Sum_probs=7.0

Q ss_pred             Ccccccccccc
Q psy11318          2 RYYCNACSKNF   12 (263)
Q Consensus         2 ~y~C~~C~~~f   12 (263)
                      .|.|..||+.|
T Consensus         6 ~Y~C~~Cg~~~   16 (49)
T COG1996           6 EYKCARCGREV   16 (49)
T ss_pred             EEEhhhcCCee
Confidence            36666666666


No 98 
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=79.55  E-value=1.3  Score=24.62  Aligned_cols=21  Identities=33%  Similarity=0.654  Sum_probs=17.3

Q ss_pred             CccccccccccCChHHHHHHH
Q psy11318          2 RYYCNACSKNFSAKDTLNKHM   22 (263)
Q Consensus         2 ~y~C~~C~~~f~~~~~L~~H~   22 (263)
                      .|+|-+|.++...++.|-.||
T Consensus        20 ~ykcfqcpftc~~kshl~nhm   40 (54)
T PF15269_consen   20 KYKCFQCPFTCNEKSHLFNHM   40 (54)
T ss_pred             cceeecCCcccchHHHHHHHH
Confidence            478888888888888888887


No 99 
>PF14353 CpXC:  CpXC protein
Probab=78.94  E-value=0.19  Score=35.86  Aligned_cols=20  Identities=25%  Similarity=0.580  Sum_probs=9.8

Q ss_pred             ccccCCCccccCChhHHHHH
Q psy11318         29 RYQCEECPKDFSTRKYLTQH   48 (263)
Q Consensus        29 ~~~C~~C~~~f~~~~~l~~H   48 (263)
                      .|.|+.||..|.-...+.-|
T Consensus        38 ~~~CP~Cg~~~~~~~p~lY~   57 (128)
T PF14353_consen   38 SFTCPSCGHKFRLEYPLLYH   57 (128)
T ss_pred             EEECCCCCCceecCCCEEEE
Confidence            45555555555444444444


No 100
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=78.44  E-value=2.3  Score=31.52  Aligned_cols=34  Identities=9%  Similarity=0.054  Sum_probs=20.8

Q ss_pred             CCCCCccCCcchhhhcChHHHHHHHhhccCCCCCcCCCCcccc
Q psy11318        139 FNGKRYHCTQCSKFYIQESDLMEHMAVHSGVRKLTTGPIKTEQ  181 (263)
Q Consensus       139 ~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~c~~~~  181 (263)
                      .+..-|.|+.|+..|+....+.         ..|.|+.||...
T Consensus       105 ~~~~~Y~Cp~c~~r~tf~eA~~---------~~F~Cp~Cg~~L  138 (158)
T TIGR00373       105 TNNMFFICPNMCVRFTFNEAME---------LNFTCPRCGAML  138 (158)
T ss_pred             cCCCeEECCCCCcEeeHHHHHH---------cCCcCCCCCCEe
Confidence            3444567777776666655553         257777777654


No 101
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=77.55  E-value=3  Score=30.89  Aligned_cols=18  Identities=11%  Similarity=0.240  Sum_probs=8.0

Q ss_pred             CcccCCcCCCcCCCHHHH
Q psy11318         84 IRHPCSECPKTFASRHSL  101 (263)
Q Consensus        84 ~~~~C~~C~~~f~~~~~l  101 (263)
                      ..|.|+.|+..|.....+
T Consensus       108 ~~Y~Cp~c~~r~tf~eA~  125 (158)
T TIGR00373       108 MFFICPNMCVRFTFNEAM  125 (158)
T ss_pred             CeEECCCCCcEeeHHHHH
Confidence            344444444444444433


No 102
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=77.53  E-value=2.3  Score=25.40  Aligned_cols=8  Identities=38%  Similarity=1.277  Sum_probs=3.9

Q ss_pred             cccCCCCC
Q psy11318        113 LYQCNECS  120 (263)
Q Consensus       113 ~~~C~~C~  120 (263)
                      +|+|+.||
T Consensus        50 ~Y~Cp~CG   57 (61)
T COG2888          50 PYRCPKCG   57 (61)
T ss_pred             ceECCCcC
Confidence            44454444


No 103
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=77.44  E-value=1.7  Score=26.07  Aligned_cols=21  Identities=24%  Similarity=0.227  Sum_probs=9.6

Q ss_pred             hhHHHHHHHHhcCCCceeccc
Q psy11318         42 RKYLTQHQNAIHRGIRFQCNK   62 (263)
Q Consensus        42 ~~~l~~H~~~~~~~~~~~C~~   62 (263)
                      +..|..|+...-...+..|..
T Consensus        23 r~~l~~H~~~~C~~~~v~C~~   43 (60)
T PF02176_consen   23 RKELDDHLENECPKRPVPCPY   43 (60)
T ss_dssp             CCCHHHHHHTTSTTSEEE-SS
T ss_pred             HHHHHHHHHccCCCCcEECCC
Confidence            334555555334444455555


No 104
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=77.03  E-value=2.5  Score=24.46  Aligned_cols=23  Identities=30%  Similarity=0.573  Sum_probs=16.0

Q ss_pred             ccccCCCccccCCh-----hHHHHHHHH
Q psy11318         29 RYQCEECPKDFSTR-----KYLTQHQNA   51 (263)
Q Consensus        29 ~~~C~~C~~~f~~~-----~~l~~H~~~   51 (263)
                      .-.|.+|++.+...     +.|.+|++.
T Consensus        18 ~a~C~~C~~~l~~~~~~gTs~L~rHl~~   45 (50)
T smart00614       18 RAKCKYCGKKLSRSSKGGTSNLRRHLRR   45 (50)
T ss_pred             EEEecCCCCEeeeCCCCCcHHHHHHHHh
Confidence            35688888777554     577777773


No 105
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=76.07  E-value=1.1  Score=31.94  Aligned_cols=26  Identities=23%  Similarity=0.511  Sum_probs=16.6

Q ss_pred             CccCCcchhhhcChHHHHHHHhhccCCCC
Q psy11318        143 RYHCTQCSKFYIQESDLMEHMAVHSGVRK  171 (263)
Q Consensus       143 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~  171 (263)
                      ...|..||+.|...   ++|++.|+|..+
T Consensus        72 ~i~clecGk~~k~L---krHL~~~~gltp   97 (132)
T PF05443_consen   72 YIICLECGKKFKTL---KRHLRTHHGLTP   97 (132)
T ss_dssp             -EE-TBT--EESBH---HHHHHHTT-S-H
T ss_pred             eeEEccCCcccchH---HHHHHHccCCCH
Confidence            46899999999865   899999988654


No 106
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=75.67  E-value=1.1  Score=22.96  Aligned_cols=24  Identities=25%  Similarity=0.717  Sum_probs=8.8

Q ss_pred             cccccccccCChHHHHHHHHhhCCcccccCCCcc
Q psy11318          4 YCNACSKNFSAKDTLNKHMDIHKGVRYQCEECPK   37 (263)
Q Consensus         4 ~C~~C~~~f~~~~~L~~H~~~h~~~~~~C~~C~~   37 (263)
                      +|+.|+..+..          +.+..|.|+.|+.
T Consensus         4 ~Cp~C~se~~y----------~D~~~~vCp~C~~   27 (30)
T PF08274_consen    4 KCPLCGSEYTY----------EDGELLVCPECGH   27 (30)
T ss_dssp             --TTT-----E----------E-SSSEEETTTTE
T ss_pred             CCCCCCCccee----------ccCCEEeCCcccc
Confidence            56666665543          3444566666654


No 107
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=75.53  E-value=1.9  Score=22.42  Aligned_cols=26  Identities=27%  Similarity=0.755  Sum_probs=14.7

Q ss_pred             ccccccccccCChHHHHHHHHhhCCcccccCCCccc
Q psy11318          3 YYCNACSKNFSAKDTLNKHMDIHKGVRYQCEECPKD   38 (263)
Q Consensus         3 y~C~~C~~~f~~~~~L~~H~~~h~~~~~~C~~C~~~   38 (263)
                      |.|..||..+..          -.+.+.+|+.||..
T Consensus         1 Y~C~~Cg~~~~~----------~~~~~irC~~CG~R   26 (32)
T PF03604_consen    1 YICGECGAEVEL----------KPGDPIRCPECGHR   26 (32)
T ss_dssp             EBESSSSSSE-B----------STSSTSSBSSSS-S
T ss_pred             CCCCcCCCeeEc----------CCCCcEECCcCCCe
Confidence            667777776552          12345677777754


No 108
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=75.11  E-value=2.4  Score=29.81  Aligned_cols=30  Identities=7%  Similarity=0.078  Sum_probs=17.4

Q ss_pred             ccCCcCCCcCCCHHHHHHHHHHhcCCccccCCCCCCCcccCCH
Q psy11318         86 HPCSECPKTFASRHSLKNHILKIHKAVLYQCNECSTSKDYLTK  128 (263)
Q Consensus        86 ~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~~~f~~~  128 (263)
                      ..|+.|++.|...           +..|..|+.||  ..|...
T Consensus        10 r~Cp~cg~kFYDL-----------nk~p~vcP~cg--~~~~~~   39 (129)
T TIGR02300        10 RICPNTGSKFYDL-----------NRRPAVSPYTG--EQFPPE   39 (129)
T ss_pred             ccCCCcCcccccc-----------CCCCccCCCcC--CccCcc
Confidence            4677777666543           23466777777  555443


No 109
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=74.01  E-value=0.53  Score=26.20  Aligned_cols=11  Identities=36%  Similarity=1.180  Sum_probs=5.2

Q ss_pred             ccccccccccC
Q psy11318          3 YYCNACSKNFS   13 (263)
Q Consensus         3 y~C~~C~~~f~   13 (263)
                      |.|..||..|.
T Consensus         6 y~C~~Cg~~fe   16 (42)
T PF09723_consen    6 YRCEECGHEFE   16 (42)
T ss_pred             EEeCCCCCEEE
Confidence            44555554443


No 110
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=73.22  E-value=4.3  Score=30.76  Aligned_cols=13  Identities=23%  Similarity=0.817  Sum_probs=5.9

Q ss_pred             eecccccccccch
Q psy11318         58 FQCNKCFRAYKLK   70 (263)
Q Consensus        58 ~~C~~C~~~f~~~   70 (263)
                      |.|+.|+..|...
T Consensus       118 Y~Cp~C~~rytf~  130 (178)
T PRK06266        118 FFCPNCHIRFTFD  130 (178)
T ss_pred             EECCCCCcEEeHH
Confidence            4444444444443


No 111
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=73.15  E-value=2.1  Score=30.53  Aligned_cols=26  Identities=31%  Similarity=0.420  Sum_probs=16.4

Q ss_pred             ccccCCCccccCChhHHHHHHHHhcCCCc
Q psy11318         29 RYQCEECPKDFSTRKYLTQHQNAIHRGIR   57 (263)
Q Consensus        29 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~   57 (263)
                      -..|-+||+.|+..   ++|++.||+-.+
T Consensus        72 ~i~clecGk~~k~L---krHL~~~~gltp   97 (132)
T PF05443_consen   72 YIICLECGKKFKTL---KRHLRTHHGLTP   97 (132)
T ss_dssp             -EE-TBT--EESBH---HHHHHHTT-S-H
T ss_pred             eeEEccCCcccchH---HHHHHHccCCCH
Confidence            36799999988875   999999877554


No 112
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=73.12  E-value=3.3  Score=31.34  Aligned_cols=35  Identities=9%  Similarity=0.144  Sum_probs=21.3

Q ss_pred             CCCCccCCcchhhhcChHHHHHHHhhccCCCCCcCCCCcccccc
Q psy11318        140 NGKRYHCTQCSKFYIQESDLMEHMAVHSGVRKLTTGPIKTEQTF  183 (263)
Q Consensus       140 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~c~~~~~~  183 (263)
                      +..-|.|+.|+..|+....+.         ..|.|+.||.....
T Consensus       114 ~~~~Y~Cp~C~~rytf~eA~~---------~~F~Cp~Cg~~L~~  148 (178)
T PRK06266        114 NNMFFFCPNCHIRFTFDEAME---------YGFRCPQCGEMLEE  148 (178)
T ss_pred             CCCEEECCCCCcEEeHHHHhh---------cCCcCCCCCCCCee
Confidence            334577777777766555432         35777777765543


No 113
>KOG1280|consensus
Probab=72.88  E-value=1.2  Score=36.71  Aligned_cols=36  Identities=19%  Similarity=0.351  Sum_probs=29.5

Q ss_pred             eecccccccccchHHHHHHHHHhcCCCc--ccCCcCCC
Q psy11318         58 FQCNKCFRAYKLKKDLLAHTMLEHFGIR--HPCSECPK   93 (263)
Q Consensus        58 ~~C~~C~~~f~~~~~l~~H~~~~~~~~~--~~C~~C~~   93 (263)
                      |.|+.|+++-.+...|..|+...|.+..  ..|+.|.-
T Consensus        80 ftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~~  117 (381)
T KOG1280|consen   80 FTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCAA  117 (381)
T ss_pred             ccCCcccccccchhHHHHHhhhcCcccCcceeeecccc
Confidence            8899999998889999999988888744  45777765


No 114
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=72.11  E-value=1.9  Score=30.44  Aligned_cols=25  Identities=24%  Similarity=0.450  Sum_probs=20.9

Q ss_pred             ccCCcchhhhcChHHHHHHHhhccCCCC
Q psy11318        144 YHCTQCSKFYIQESDLMEHMAVHSGVRK  171 (263)
Q Consensus       144 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~  171 (263)
                      ..|..+|+.|.   +|++|+.+|.+..|
T Consensus        77 IicLEDGkkfK---SLKRHL~t~~gmTP  101 (148)
T COG4957          77 IICLEDGKKFK---SLKRHLTTHYGLTP  101 (148)
T ss_pred             EEEeccCcchH---HHHHHHhcccCCCH
Confidence            47999999987   68999999988655


No 115
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=71.70  E-value=1.8  Score=35.20  Aligned_cols=26  Identities=27%  Similarity=0.691  Sum_probs=21.5

Q ss_pred             CCccCCcchhhhcChHHHHHHHhhcc
Q psy11318        142 KRYHCTQCSKFYIQESDLMEHMAVHS  167 (263)
Q Consensus       142 ~~~~C~~C~~~f~~~~~l~~H~~~h~  167 (263)
                      ..|.|+.|...|-.--+...|...|.
T Consensus       387 ~rY~Ce~CK~~FC~dCdvfiHe~Lh~  412 (421)
T COG5151         387 GRYQCELCKSTFCSDCDVFIHETLHF  412 (421)
T ss_pred             cceechhhhhhhhhhhHHHHHHHHhh
Confidence            35899999999988888888877774


No 116
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=71.45  E-value=2.7  Score=20.63  Aligned_cols=6  Identities=33%  Similarity=1.126  Sum_probs=2.8

Q ss_pred             cCCCCC
Q psy11318        115 QCNECS  120 (263)
Q Consensus       115 ~C~~C~  120 (263)
                      .|+.||
T Consensus        16 ~Cp~CG   21 (26)
T PF10571_consen   16 FCPHCG   21 (26)
T ss_pred             cCCCCC
Confidence            344454


No 117
>PRK04023 DNA polymerase II large subunit; Validated
Probab=70.38  E-value=4.5  Score=38.62  Aligned_cols=9  Identities=22%  Similarity=0.936  Sum_probs=5.0

Q ss_pred             ccCCcCCCc
Q psy11318         86 HPCSECPKT   94 (263)
Q Consensus        86 ~~C~~C~~~   94 (263)
                      +.|+.|+..
T Consensus       664 y~CPKCG~E  672 (1121)
T PRK04023        664 DECEKCGRE  672 (1121)
T ss_pred             CcCCCCCCC
Confidence            446666554


No 118
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=70.33  E-value=1.7  Score=20.89  Aligned_cols=9  Identities=22%  Similarity=0.741  Sum_probs=5.3

Q ss_pred             Ccccccccc
Q psy11318          2 RYYCNACSK   10 (263)
Q Consensus         2 ~y~C~~C~~   10 (263)
                      +|.||.||+
T Consensus        16 ~f~CPnCG~   24 (24)
T PF07754_consen   16 PFPCPNCGF   24 (24)
T ss_pred             eEeCCCCCC
Confidence            356666664


No 119
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=69.89  E-value=3.7  Score=22.28  Aligned_cols=12  Identities=50%  Similarity=1.242  Sum_probs=4.2

Q ss_pred             CCcccccccccc
Q psy11318          1 MRYYCNACSKNF   12 (263)
Q Consensus         1 ~~y~C~~C~~~f   12 (263)
                      ++|-|+.|+..+
T Consensus         2 ~ryyCdyC~~~~   13 (38)
T PF06220_consen    2 PRYYCDYCKKYL   13 (38)
T ss_dssp             -S-B-TTT--B-
T ss_pred             cCeeccccccee
Confidence            356777777766


No 120
>KOG2186|consensus
Probab=69.68  E-value=2.8  Score=33.17  Aligned_cols=48  Identities=17%  Similarity=0.440  Sum_probs=30.9

Q ss_pred             cccCCCccccCChhHHHHHHHHhcCCCceecccccccccchHHHHHHHHHh
Q psy11318         30 YQCEECPKDFSTRKYLTQHQNAIHRGIRFQCNKCFRAYKLKKDLLAHTMLE   80 (263)
Q Consensus        30 ~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~   80 (263)
                      |.|.+||....-.. |-+|+...++ .-|.|=.|++.|.. ..+..|..-.
T Consensus         4 FtCnvCgEsvKKp~-vekH~srCrn-~~fSCIDC~k~F~~-~sYknH~kCI   51 (276)
T KOG2186|consen    4 FTCNVCGESVKKPQ-VEKHMSRCRN-AYFSCIDCGKTFER-VSYKNHTKCI   51 (276)
T ss_pred             Eehhhhhhhccccc-hHHHHHhccC-CeeEEeeccccccc-chhhhhhhhc
Confidence            67777877666544 5557766443 56777777777777 5566666433


No 121
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=69.34  E-value=6.1  Score=28.85  Aligned_cols=37  Identities=16%  Similarity=0.177  Sum_probs=18.9

Q ss_pred             CCCccCCcchhhhcChHHHHHHHhhccCCCCCcCCCCcccc
Q psy11318        141 GKRYHCTQCSKFYIQESDLMEHMAVHSGVRKLTTGPIKTEQ  181 (263)
Q Consensus       141 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~c~~~~  181 (263)
                      ..-|.|+.|+..|.....+.. .  . ....|.|+.|+...
T Consensus        97 ~~~Y~Cp~C~~~y~~~ea~~~-~--d-~~~~f~Cp~Cg~~l  133 (147)
T smart00531       97 NAYYKCPNCQSKYTFLEANQL-L--D-MDGTFTCPRCGEEL  133 (147)
T ss_pred             CcEEECcCCCCEeeHHHHHHh-c--C-CCCcEECCCCCCEE
Confidence            345667777766664332221 0  1 12337777776654


No 122
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=69.06  E-value=2.1  Score=25.28  Aligned_cols=11  Identities=18%  Similarity=0.836  Sum_probs=5.9

Q ss_pred             Ccccccccccc
Q psy11318          2 RYYCNACSKNF   12 (263)
Q Consensus         2 ~y~C~~C~~~f   12 (263)
                      .++|+.||..+
T Consensus         2 ~~~CP~CG~~i   12 (54)
T TIGR01206         2 QFECPDCGAEI   12 (54)
T ss_pred             ccCCCCCCCEE
Confidence            34566666544


No 123
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=69.00  E-value=3.3  Score=30.86  Aligned_cols=23  Identities=22%  Similarity=0.406  Sum_probs=14.4

Q ss_pred             cccCCcCCCcCCCHHHHHHHHHHhcCCccccCCCCC
Q psy11318         85 RHPCSECPKTFASRHSLKNHILKIHKAVLYQCNECS  120 (263)
Q Consensus        85 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~  120 (263)
                      .|.|++||..+.             ++.|.+|++||
T Consensus       134 ~~vC~vCGy~~~-------------ge~P~~CPiCg  156 (166)
T COG1592         134 VWVCPVCGYTHE-------------GEAPEVCPICG  156 (166)
T ss_pred             EEEcCCCCCccc-------------CCCCCcCCCCC
Confidence            467777766532             35566777776


No 124
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=68.60  E-value=1.4  Score=27.73  Aligned_cols=12  Identities=25%  Similarity=0.722  Sum_probs=5.7

Q ss_pred             eecc--cccccccc
Q psy11318         58 FQCN--KCFRAYKL   69 (263)
Q Consensus        58 ~~C~--~C~~~f~~   69 (263)
                      +.|.  .|+..|..
T Consensus        28 ~qC~N~eCg~tF~t   41 (72)
T PRK09678         28 HQCQNVNCSATFIT   41 (72)
T ss_pred             eecCCCCCCCEEEE
Confidence            4454  45554443


No 125
>PHA00626 hypothetical protein
Probab=68.18  E-value=2.2  Score=25.10  Aligned_cols=12  Identities=42%  Similarity=0.753  Sum_probs=6.4

Q ss_pred             CccccccccccC
Q psy11318          2 RYYCNACSKNFS   13 (263)
Q Consensus         2 ~y~C~~C~~~f~   13 (263)
                      +|+|+.||+.|+
T Consensus        23 rYkCkdCGY~ft   34 (59)
T PHA00626         23 DYVCCDCGYNDS   34 (59)
T ss_pred             ceEcCCCCCeec
Confidence            355555555544


No 126
>KOG2807|consensus
Probab=67.82  E-value=8.8  Score=31.68  Aligned_cols=25  Identities=28%  Similarity=0.821  Sum_probs=21.6

Q ss_pred             CccCCcchhhhcChHHHHHHHhhcc
Q psy11318        143 RYHCTQCSKFYIQESDLMEHMAVHS  167 (263)
Q Consensus       143 ~~~C~~C~~~f~~~~~l~~H~~~h~  167 (263)
                      .|.|..|.-.|-.--+...|-..|.
T Consensus       345 ~y~C~~Ck~~FCldCDv~iHesLh~  369 (378)
T KOG2807|consen  345 RYRCESCKNVFCLDCDVFIHESLHN  369 (378)
T ss_pred             cEEchhccceeeccchHHHHhhhhc
Confidence            5899999999998888889987775


No 127
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=67.29  E-value=3.4  Score=38.47  Aligned_cols=29  Identities=17%  Similarity=0.235  Sum_probs=19.1

Q ss_pred             HhCCCCCccCCcchhhhcChHHHHHHHhhccCCCCCcCCCCccc
Q psy11318        137 LHFNGKRYHCTQCSKFYIQESDLMEHMAVHSGVRKLTTGPIKTE  180 (263)
Q Consensus       137 ~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~c~~~  180 (263)
                      .|...+...|.+||               +....|..|+.|+..
T Consensus       456 ~H~~~~~L~CH~Cg---------------~~~~~p~~Cp~Cgs~  484 (730)
T COG1198         456 LHKATGQLRCHYCG---------------YQEPIPQSCPECGSE  484 (730)
T ss_pred             EecCCCeeEeCCCC---------------CCCCCCCCCCCCCCC
Confidence            34455567777777               335567788888875


No 128
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=67.12  E-value=8.1  Score=32.18  Aligned_cols=29  Identities=17%  Similarity=0.466  Sum_probs=16.8

Q ss_pred             HhcCCccccCCCCCCCcccCCHHHHHHHHH
Q psy11318        107 KIHKAVLYQCNECSTSKDYLTKRDLRRHMK  136 (263)
Q Consensus       107 ~~~~~~~~~C~~C~~~~~f~~~~~l~~H~~  136 (263)
                      .|.-.+.|.|.+|| ++.+.-...+.+|..
T Consensus       368 lhgLd~ef~CEICg-Nyvy~GR~~FdrHF~  396 (470)
T COG5188         368 LHGLDIEFECEICG-NYVYYGRDRFDRHFE  396 (470)
T ss_pred             hcCCCcceeeeecc-cccccchHHHHhhhh
Confidence            34445667888887 244445555556653


No 129
>KOG4124|consensus
Probab=66.98  E-value=0.66  Score=38.27  Aligned_cols=49  Identities=27%  Similarity=0.540  Sum_probs=31.8

Q ss_pred             CCccc--cccccccCChHHHHHHHHhhCC--------------------cccccCCCccccCChhHHHHHH
Q psy11318          1 MRYYC--NACSKNFSAKDTLNKHMDIHKG--------------------VRYQCEECPKDFSTRKYLTQHQ   49 (263)
Q Consensus         1 ~~y~C--~~C~~~f~~~~~L~~H~~~h~~--------------------~~~~C~~C~~~f~~~~~l~~H~   49 (263)
                      |+|+|  +.|++.+....+|+.|-..-+.                    ++|.|++|.+.++..-.|+-|.
T Consensus       348 ~~~~~~vp~~~~~~~n~ng~~~~~~~~h~s~i~~~s~~~~ph~~~~~~nk~~r~~i~~~~~k~~~~l~~~~  418 (442)
T KOG4124|consen  348 KPYKCPVPNCDKAYKNQNGLKYHKLHGHCSPITTPTPAPIPHQGFVVENKPYRCEVCSKRYKNLNGLKYHR  418 (442)
T ss_pred             CCCCCCCCcchhhcccCcceeeccccCcCCCCCCCCCCCCCcceeeeccCcccChhhhhhhccCCCCCcee
Confidence            46777  5788888888888887543211                    1567777777666665555554


No 130
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=66.55  E-value=3.7  Score=38.24  Aligned_cols=9  Identities=33%  Similarity=0.940  Sum_probs=4.8

Q ss_pred             ccccCCCCC
Q psy11318        112 VLYQCNECS  120 (263)
Q Consensus       112 ~~~~C~~C~  120 (263)
                      .|..|+.||
T Consensus       474 ~p~~Cp~Cg  482 (730)
T COG1198         474 IPQSCPECG  482 (730)
T ss_pred             CCCCCCCCC
Confidence            445555555


No 131
>KOG2593|consensus
Probab=65.86  E-value=5.7  Score=34.08  Aligned_cols=37  Identities=19%  Similarity=0.290  Sum_probs=17.5

Q ss_pred             CCCccCCcchhhhcChHHHHHHHhhccCCCCCcCCCCccc
Q psy11318        141 GKRYHCTQCSKFYIQESDLMEHMAVHSGVRKLTTGPIKTE  180 (263)
Q Consensus       141 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~c~~~  180 (263)
                      ...|.|+.|.+.|+....+..   .-.....|.|..|+-.
T Consensus       126 ~~~Y~Cp~C~kkyt~Lea~~L---~~~~~~~F~C~~C~ge  162 (436)
T KOG2593|consen  126 VAGYVCPNCQKKYTSLEALQL---LDNETGEFHCENCGGE  162 (436)
T ss_pred             cccccCCccccchhhhHHHHh---hcccCceEEEecCCCc
Confidence            344666666666554443321   2222344555555543


No 132
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=65.85  E-value=2.5  Score=32.98  Aligned_cols=27  Identities=22%  Similarity=0.532  Sum_probs=22.0

Q ss_pred             ccccCCCccccCChhHHHHHHHHhcCC
Q psy11318         29 RYQCEECPKDFSTRKYLTQHQNAIHRG   55 (263)
Q Consensus        29 ~~~C~~C~~~f~~~~~l~~H~~~~~~~   55 (263)
                      .|.|+.|+|.|+-...++.|+...|.+
T Consensus        77 K~~C~lc~KlFkg~eFV~KHI~nKH~e  103 (214)
T PF04959_consen   77 KWRCPLCGKLFKGPEFVRKHIFNKHPE  103 (214)
T ss_dssp             EEEE-SSS-EESSHHHHHHHHHHH-HH
T ss_pred             EECCCCCCcccCChHHHHHHHhhcCHH
Confidence            699999999999999999999988754


No 133
>KOG2807|consensus
Probab=65.65  E-value=9.5  Score=31.49  Aligned_cols=31  Identities=29%  Similarity=0.699  Sum_probs=23.0

Q ss_pred             ccccCCCCCCCcccCCHHHHHHHHHHhCCCCCccCCcch
Q psy11318        112 VLYQCNECSTSKDYLTKRDLRRHMKLHFNGKRYHCTQCS  150 (263)
Q Consensus       112 ~~~~C~~C~~~~~f~~~~~l~~H~~~h~~~~~~~C~~C~  150 (263)
                      ..|+|..|.  ..|-.--+.-.|...|      .|+.|.
T Consensus       344 ~~y~C~~Ck--~~FCldCDv~iHesLh------~CpgCe  374 (378)
T KOG2807|consen  344 GRYRCESCK--NVFCLDCDVFIHESLH------NCPGCE  374 (378)
T ss_pred             CcEEchhcc--ceeeccchHHHHhhhh------cCCCcC
Confidence            458899988  7888777777777666      576665


No 134
>KOG1280|consensus
Probab=64.74  E-value=5.7  Score=33.01  Aligned_cols=23  Identities=13%  Similarity=0.265  Sum_probs=11.0

Q ss_pred             ccccccccccCChHHHHHHHHhh
Q psy11318          3 YYCNACSKNFSAKDTLNKHMDIH   25 (263)
Q Consensus         3 y~C~~C~~~f~~~~~L~~H~~~h   25 (263)
                      |.|++|+.+=.+...|..|+...
T Consensus        80 ftCPyC~~~Gfte~~f~~Hv~s~  102 (381)
T KOG1280|consen   80 FTCPYCGIMGFTERQFGTHVLSQ  102 (381)
T ss_pred             ccCCcccccccchhHHHHHhhhc
Confidence            44555555444444455554443


No 135
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=64.46  E-value=9.5  Score=21.02  Aligned_cols=26  Identities=23%  Similarity=0.280  Sum_probs=19.8

Q ss_pred             ccCCCCCCCcccCCHHHHHHHHHHhC
Q psy11318        114 YQCNECSTSKDYLTKRDLRRHMKLHF  139 (263)
Q Consensus       114 ~~C~~C~~~~~f~~~~~l~~H~~~h~  139 (263)
                      .+|+.||..+......+-..|.+.|.
T Consensus        14 ~~C~~CgM~Y~~~~~eD~~~H~~yH~   39 (41)
T PF13878_consen   14 TTCPTCGMLYSPGSPEDEKLHKKYHD   39 (41)
T ss_pred             cCCCCCCCEECCCCHHHHHHHHHHHh
Confidence            57888887777777888888887764


No 136
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=62.33  E-value=7.3  Score=23.36  Aligned_cols=8  Identities=38%  Similarity=1.215  Sum_probs=4.4

Q ss_pred             cccCCCCC
Q psy11318        113 LYQCNECS  120 (263)
Q Consensus       113 ~~~C~~C~  120 (263)
                      +|+|+.||
T Consensus        48 ~Y~CP~CG   55 (59)
T PRK14890         48 PYTCPKCG   55 (59)
T ss_pred             ceECCCCC
Confidence            45555555


No 137
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=61.96  E-value=3.3  Score=26.91  Aligned_cols=11  Identities=18%  Similarity=0.908  Sum_probs=5.5

Q ss_pred             ccCCcchhhhc
Q psy11318        144 YHCTQCSKFYI  154 (263)
Q Consensus       144 ~~C~~C~~~f~  154 (263)
                      |.|..|+..|+
T Consensus        54 W~C~kCg~~fA   64 (89)
T COG1997          54 WKCRKCGAKFA   64 (89)
T ss_pred             EEcCCCCCeec
Confidence            45555554443


No 138
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=59.03  E-value=4.7  Score=26.42  Aligned_cols=27  Identities=19%  Similarity=0.470  Sum_probs=17.4

Q ss_pred             CcccCCcCCCcCCCHHHHHHHHHHhcCCccccCCCCC
Q psy11318         84 IRHPCSECPKTFASRHSLKNHILKIHKAVLYQCNECS  120 (263)
Q Consensus        84 ~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~  120 (263)
                      .|-.|..||..|.+.-          -.+|..|+.|.
T Consensus        57 ~Pa~CkkCGfef~~~~----------ik~pSRCP~CK   83 (97)
T COG3357          57 RPARCKKCGFEFRDDK----------IKKPSRCPKCK   83 (97)
T ss_pred             cChhhcccCccccccc----------cCCcccCCcch
Confidence            4567888888777621          23466777775


No 139
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=58.44  E-value=13  Score=31.08  Aligned_cols=22  Identities=18%  Similarity=0.502  Sum_probs=12.8

Q ss_pred             ccCCcCCCcCCCHHHHHHHHHH
Q psy11318         86 HPCSECPKTFASRHSLKNHILK  107 (263)
Q Consensus        86 ~~C~~C~~~f~~~~~l~~H~~~  107 (263)
                      +.|..|++.|.....+..|+..
T Consensus       239 ~YC~~C~r~f~~~~VFe~Hl~g  260 (470)
T COG5188         239 VYCVKCGREFSRSKVFEYHLEG  260 (470)
T ss_pred             eeeHhhhhHhhhhHHHHHHHhh
Confidence            4466666666666666666543


No 140
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=57.77  E-value=4  Score=24.24  Aligned_cols=37  Identities=27%  Similarity=0.527  Sum_probs=21.2

Q ss_pred             CCccccccccccCChHH--HHHHHHhhCCcccccCCCcc
Q psy11318          1 MRYYCNACSKNFSAKDT--LNKHMDIHKGVRYQCEECPK   37 (263)
Q Consensus         1 ~~y~C~~C~~~f~~~~~--L~~H~~~h~~~~~~C~~C~~   37 (263)
                      |+.+|..|++.+.--..  +..-++...-..|-|..|..
T Consensus         1 m~vkC~lCdk~~~Id~~~~~aKrLrnrPi~tYmC~eC~~   39 (56)
T PF09963_consen    1 MRVKCILCDKKEEIDEDTPEAKRLRNRPIHTYMCDECKE   39 (56)
T ss_pred             CeeEEEecCCEEEeccCCHHHHHhhcCCCcceeChhHHH
Confidence            56788888887543332  33334443334677777744


No 141
>KOG2593|consensus
Probab=56.92  E-value=5.1  Score=34.35  Aligned_cols=35  Identities=23%  Similarity=0.587  Sum_probs=26.8

Q ss_pred             ccccCCCccccCChhHHHHHHHHhcCCCceeccccccc
Q psy11318         29 RYQCEECPKDFSTRKYLTQHQNAIHRGIRFQCNKCFRA   66 (263)
Q Consensus        29 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~   66 (263)
                      .|.|+.|++.|.....++.=-   .....|.|..|+.-
T Consensus       128 ~Y~Cp~C~kkyt~Lea~~L~~---~~~~~F~C~~C~ge  162 (436)
T KOG2593|consen  128 GYVCPNCQKKYTSLEALQLLD---NETGEFHCENCGGE  162 (436)
T ss_pred             cccCCccccchhhhHHHHhhc---ccCceEEEecCCCc
Confidence            799999999999988776542   22345999999853


No 142
>KOG4377|consensus
Probab=56.39  E-value=3.5  Score=34.97  Aligned_cols=25  Identities=24%  Similarity=0.583  Sum_probs=19.2

Q ss_pred             ccCCc--chhhhcChHHHHHHHhhccC
Q psy11318        144 YHCTQ--CSKFYIQESDLMEHMAVHSG  168 (263)
Q Consensus       144 ~~C~~--C~~~f~~~~~l~~H~~~h~~  168 (263)
                      +.|.+  |+..+...+....|.+.|..
T Consensus       402 fhc~r~Gc~~tl~s~sqm~shkrkheR  428 (480)
T KOG4377|consen  402 FHCDRLGCEATLYSVSQMASHKRKHER  428 (480)
T ss_pred             eeecccCCceEEEehhhhhhhhhhhhh
Confidence            45544  88888888888888888864


No 143
>KOG4377|consensus
Probab=55.82  E-value=4.4  Score=34.45  Aligned_cols=22  Identities=5%  Similarity=-0.207  Sum_probs=18.6

Q ss_pred             CCcccccccceeeeccCCCccc
Q psy11318        176 PIKTEQTFGVRELRHVGFPMKT  197 (263)
Q Consensus       176 ~c~~~~~~~~~l~~H~~~~~~~  197 (263)
                      .|+..+.+-+.+..|.+.|-+.
T Consensus       408 Gc~~tl~s~sqm~shkrkheRq  429 (480)
T KOG4377|consen  408 GCEATLYSVSQMASHKRKHERQ  429 (480)
T ss_pred             CCceEEEehhhhhhhhhhhhhh
Confidence            4889999999999999887764


No 144
>KOG4167|consensus
Probab=55.28  E-value=3.2  Score=38.00  Aligned_cols=22  Identities=36%  Similarity=0.647  Sum_probs=11.7

Q ss_pred             cccccccccCChHHHHHHHHhh
Q psy11318          4 YCNACSKNFSAKDTLNKHMDIH   25 (263)
Q Consensus         4 ~C~~C~~~f~~~~~L~~H~~~h   25 (263)
                      -|-+|+|+|.-.++++.||.+|
T Consensus       794 pCreC~kvF~KiKSrNAHMK~H  815 (907)
T KOG4167|consen  794 PCRECGKVFFKIKSRNAHMKTH  815 (907)
T ss_pred             ehHHHHHHHHHHhhhhHHHHHH
Confidence            3555555555555555555554


No 145
>PRK14873 primosome assembly protein PriA; Provisional
Probab=53.07  E-value=8.3  Score=35.78  Aligned_cols=7  Identities=29%  Similarity=1.037  Sum_probs=3.4

Q ss_pred             ecccccc
Q psy11318         59 QCNKCFR   65 (263)
Q Consensus        59 ~C~~C~~   65 (263)
                      .|..|+.
T Consensus       385 ~C~~Cg~  391 (665)
T PRK14873        385 ACARCRT  391 (665)
T ss_pred             EhhhCcC
Confidence            4555544


No 146
>COG1773 Rubredoxin [Energy production and conversion]
Probab=52.91  E-value=6  Score=23.40  Aligned_cols=13  Identities=23%  Similarity=0.846  Sum_probs=8.2

Q ss_pred             CccccccccccCC
Q psy11318          2 RYYCNACSKNFSA   14 (263)
Q Consensus         2 ~y~C~~C~~~f~~   14 (263)
                      +|+|..||..|.-
T Consensus         3 ~~~C~~CG~vYd~   15 (55)
T COG1773           3 RWRCSVCGYVYDP   15 (55)
T ss_pred             ceEecCCceEecc
Confidence            5666666666654


No 147
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=52.32  E-value=9.7  Score=25.93  Aligned_cols=11  Identities=9%  Similarity=0.021  Sum_probs=5.1

Q ss_pred             cccCCcCCCcC
Q psy11318         85 RHPCSECPKTF   95 (263)
Q Consensus        85 ~~~C~~C~~~f   95 (263)
                      |..|++||+.|
T Consensus        26 PiVsPytG~s~   36 (129)
T COG4530          26 PIVSPYTGKSY   36 (129)
T ss_pred             ccccCcccccc
Confidence            44444444444


No 148
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=52.25  E-value=5.4  Score=21.32  Aligned_cols=29  Identities=17%  Similarity=0.282  Sum_probs=13.4

Q ss_pred             cCCcchhhhcChHHHHHHHhhccCCCCCcCCCCcccc
Q psy11318        145 HCTQCSKFYIQESDLMEHMAVHSGVRKLTTGPIKTEQ  181 (263)
Q Consensus       145 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~c~~~~  181 (263)
                      .|+.||..|...        ..-....-.|..|+-.+
T Consensus         3 ~C~~Cg~~Yh~~--------~~pP~~~~~Cd~cg~~L   31 (36)
T PF05191_consen    3 ICPKCGRIYHIE--------FNPPKVEGVCDNCGGEL   31 (36)
T ss_dssp             EETTTTEEEETT--------TB--SSTTBCTTTTEBE
T ss_pred             CcCCCCCccccc--------cCCCCCCCccCCCCCee
Confidence            466666665321        22233345566665533


No 149
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=51.58  E-value=3.3  Score=20.74  Aligned_cols=8  Identities=63%  Similarity=1.593  Sum_probs=3.3

Q ss_pred             cCCCcccc
Q psy11318         32 CEECPKDF   39 (263)
Q Consensus        32 C~~C~~~f   39 (263)
                      |-.|++.|
T Consensus         3 CiDC~~~F   10 (28)
T PF08790_consen    3 CIDCSKDF   10 (28)
T ss_dssp             ETTTTEEE
T ss_pred             eecCCCCc
Confidence            33444444


No 150
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=51.51  E-value=12  Score=22.05  Aligned_cols=10  Identities=40%  Similarity=1.052  Sum_probs=4.6

Q ss_pred             cccccccccC
Q psy11318          4 YCNACSKNFS   13 (263)
Q Consensus         4 ~C~~C~~~f~   13 (263)
                      .|+.||+.|.
T Consensus         7 ~C~~Cg~~~~   16 (54)
T PF14446_consen    7 KCPVCGKKFK   16 (54)
T ss_pred             cChhhCCccc
Confidence            3444444443


No 151
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=50.67  E-value=8.7  Score=34.40  Aligned_cols=13  Identities=23%  Similarity=0.674  Sum_probs=6.4

Q ss_pred             hCCCCCccCCcch
Q psy11318        138 HFNGKRYHCTQCS  150 (263)
Q Consensus       138 h~~~~~~~C~~C~  150 (263)
                      |...+...|.+||
T Consensus       235 h~~~~~l~Ch~Cg  247 (505)
T TIGR00595       235 HKKEGKLRCHYCG  247 (505)
T ss_pred             ecCCCeEEcCCCc
Confidence            3334445555555


No 152
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=50.31  E-value=15  Score=36.36  Aligned_cols=11  Identities=18%  Similarity=0.525  Sum_probs=6.7

Q ss_pred             ceecccccccc
Q psy11318         57 RFQCNKCFRAY   67 (263)
Q Consensus        57 ~~~C~~C~~~f   67 (263)
                      .|.|+.|+...
T Consensus       692 vy~CPsCGaev  702 (1337)
T PRK14714        692 VYVCPDCGAEV  702 (1337)
T ss_pred             ceeCccCCCcc
Confidence            46677776643


No 153
>KOG4167|consensus
Probab=50.08  E-value=5.6  Score=36.50  Aligned_cols=26  Identities=23%  Similarity=0.354  Sum_probs=23.0

Q ss_pred             eecccccccccchHHHHHHHHHhcCC
Q psy11318         58 FQCNKCFRAYKLKKDLLAHTMLEHFG   83 (263)
Q Consensus        58 ~~C~~C~~~f~~~~~l~~H~~~~~~~   83 (263)
                      |.|.+|++.|.....+..||+.|...
T Consensus       793 FpCreC~kvF~KiKSrNAHMK~Hr~q  818 (907)
T KOG4167|consen  793 FPCRECGKVFFKIKSRNAHMKTHRQQ  818 (907)
T ss_pred             eehHHHHHHHHHHhhhhHHHHHHHHH
Confidence            99999999999999999999887643


No 154
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=49.66  E-value=8.1  Score=30.17  Aligned_cols=29  Identities=24%  Similarity=0.478  Sum_probs=21.4

Q ss_pred             CcccCCcCCCcCCCHHHHHHHHHHhcCCc
Q psy11318         84 IRHPCSECPKTFASRHSLKNHILKIHKAV  112 (263)
Q Consensus        84 ~~~~C~~C~~~f~~~~~l~~H~~~~~~~~  112 (263)
                      ..|.|+.|+|.|....-...|+...|.++
T Consensus        76 ~K~~C~lc~KlFkg~eFV~KHI~nKH~e~  104 (214)
T PF04959_consen   76 DKWRCPLCGKLFKGPEFVRKHIFNKHPEK  104 (214)
T ss_dssp             EEEEE-SSS-EESSHHHHHHHHHHH-HHH
T ss_pred             CEECCCCCCcccCChHHHHHHHhhcCHHH
Confidence            34789999999999999999998887654


No 155
>PF14445 Prok-RING_2:  Prokaryotic RING finger family 2
Probab=49.30  E-value=5.3  Score=22.92  Aligned_cols=20  Identities=25%  Similarity=0.687  Sum_probs=13.9

Q ss_pred             CccccccccccCChHHHHHHH
Q psy11318          2 RYYCNACSKNFSAKDTLNKHM   22 (263)
Q Consensus         2 ~y~C~~C~~~f~~~~~L~~H~   22 (263)
                      +|.|+.|+..|. ...|++-+
T Consensus         7 ry~CDLCn~~~p-~~~LRQCv   26 (57)
T PF14445_consen    7 RYSCDLCNSSHP-ISELRQCV   26 (57)
T ss_pred             hHhHHhhcccCc-HHHHHHHh
Confidence            578888887765 56676654


No 156
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=48.40  E-value=14  Score=29.21  Aligned_cols=26  Identities=27%  Similarity=0.475  Sum_probs=13.0

Q ss_pred             ChhHHHHHHHHhcCCC-----ceeccccccc
Q psy11318         41 TRKYLTQHQNAIHRGI-----RFQCNKCFRA   66 (263)
Q Consensus        41 ~~~~l~~H~~~~~~~~-----~~~C~~C~~~   66 (263)
                      +..+|+..-+.+...+     .|.|..|+..
T Consensus        91 Te~Nlrm~d~a~~~~ip~~drqFaC~~Cd~~  121 (278)
T PF15135_consen   91 TEENLRMFDDAQENLIPSVDRQFACSSCDHM  121 (278)
T ss_pred             hHHHHHHhhhhhhccccccceeeeccccchH
Confidence            3444555555444332     2666666553


No 157
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=48.26  E-value=11  Score=33.71  Aligned_cols=8  Identities=25%  Similarity=0.825  Sum_probs=4.5

Q ss_pred             cccCCCCC
Q psy11318        113 LYQCNECS  120 (263)
Q Consensus       113 ~~~C~~C~  120 (263)
                      +..|+.|+
T Consensus       253 ~~~Cp~C~  260 (505)
T TIGR00595       253 PKTCPQCG  260 (505)
T ss_pred             CCCCCCCC
Confidence            44566665


No 158
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=47.73  E-value=3.4  Score=32.25  Aligned_cols=27  Identities=19%  Similarity=0.346  Sum_probs=15.8

Q ss_pred             ccccCCCccccCChhHHHHHHHHhcCC
Q psy11318         29 RYQCEECPKDFSTRKYLTQHQNAIHRG   55 (263)
Q Consensus        29 ~~~C~~C~~~f~~~~~l~~H~~~~~~~   55 (263)
                      .+.||+|+-.|.....+..-.++..++
T Consensus        19 ~ieCPvC~tkFkkeev~tgsiRiiagD   45 (267)
T COG1655          19 TIECPVCNTKFKKEEVKTGSIRIIAGD   45 (267)
T ss_pred             eeccCcccchhhhhheeccceeEeccc
Confidence            567777777776665554444443333


No 159
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=47.12  E-value=3.8  Score=29.00  Aligned_cols=54  Identities=24%  Similarity=0.576  Sum_probs=28.8

Q ss_pred             cccccCCCccccCChhHHHHHHHHhcCCCceec---ccccccccchHHHHHHHHHhcCCCcccCCcCCCcCCCHH
Q psy11318         28 VRYQCEECPKDFSTRKYLTQHQNAIHRGIRFQC---NKCFRAYKLKKDLLAHTMLEHFGIRHPCSECPKTFASRH   99 (263)
Q Consensus        28 ~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C---~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~   99 (263)
                      .-|+|.+|..+.....-|+          |=+|   .+|+.-+   .+|+.|-..+     -.||.|...|.+..
T Consensus        79 ~lYeCnIC~etS~ee~FLK----------PneCCgY~iCn~Cy---a~LWK~~~~y-----pvCPvCkTSFKss~  135 (140)
T PF05290_consen   79 KLYECNICKETSAEERFLK----------PNECCGYSICNACY---ANLWKFCNLY-----PVCPVCKTSFKSSS  135 (140)
T ss_pred             CceeccCcccccchhhcCC----------cccccchHHHHHHH---HHHHHHcccC-----CCCCcccccccccc
Confidence            4688999877665544332          2222   2333333   2344444322     27888877777653


No 160
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=46.52  E-value=6.9  Score=22.37  Aligned_cols=15  Identities=20%  Similarity=0.771  Sum_probs=9.0

Q ss_pred             CccccccccccCChH
Q psy11318          2 RYYCNACSKNFSAKD   16 (263)
Q Consensus         2 ~y~C~~C~~~f~~~~   16 (263)
                      +|+|..|+..|.-..
T Consensus         1 ky~C~~CgyvYd~~~   15 (47)
T PF00301_consen    1 KYQCPVCGYVYDPEK   15 (47)
T ss_dssp             EEEETTTSBEEETTT
T ss_pred             CcCCCCCCEEEcCCc
Confidence            466666666665433


No 161
>KOG1044|consensus
Probab=45.18  E-value=2.7  Score=37.33  Aligned_cols=28  Identities=4%  Similarity=-0.185  Sum_probs=19.6

Q ss_pred             CcCCCCcccccccceeeeccC-C-Cccccc
Q psy11318        172 LTTGPIKTEQTFGVRELRHVG-F-PMKTDH  199 (263)
Q Consensus       172 ~~c~~c~~~~~~~~~l~~H~~-~-~~~~~~  199 (263)
                      -+|..|+..|...+++-.--. + |..++.
T Consensus       219 ARCsRCgqmF~eGEEMYlQGs~iWHP~C~q  248 (670)
T KOG1044|consen  219 ARCSRCGQMFGEGEEMYLQGSEIWHPDCKQ  248 (670)
T ss_pred             hhhhhhccccccchheeeccccccCCcccc
Confidence            479999999999988875432 2 444443


No 162
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=44.84  E-value=11  Score=20.68  Aligned_cols=19  Identities=16%  Similarity=0.200  Sum_probs=10.0

Q ss_pred             ccccCCCccccCChhHHHH
Q psy11318         29 RYQCEECPKDFSTRKYLTQ   47 (263)
Q Consensus        29 ~~~C~~C~~~f~~~~~l~~   47 (263)
                      .+.|+.|+-.+.+...|.+
T Consensus        19 id~C~~C~G~W~d~~el~~   37 (41)
T PF13453_consen   19 IDVCPSCGGIWFDAGELEK   37 (41)
T ss_pred             EEECCCCCeEEccHHHHHH
Confidence            3455555555555555443


No 163
>KOG0717|consensus
Probab=44.72  E-value=12  Score=32.48  Aligned_cols=22  Identities=32%  Similarity=0.812  Sum_probs=16.1

Q ss_pred             ccccccccccCChHHHHHHHHh
Q psy11318          3 YYCNACSKNFSAKDTLNKHMDI   24 (263)
Q Consensus         3 y~C~~C~~~f~~~~~L~~H~~~   24 (263)
                      +-|+.|+|+|.+...|..|..+
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            4577777777777777777654


No 164
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=44.52  E-value=9.5  Score=24.09  Aligned_cols=31  Identities=26%  Similarity=0.570  Sum_probs=15.9

Q ss_pred             cccCCCccccCChhHHHHHHHHhcCCCceecccccccc
Q psy11318         30 YQCEECPKDFSTRKYLTQHQNAIHRGIRFQCNKCFRAY   67 (263)
Q Consensus        30 ~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f   67 (263)
                      |.|..|+..|    .+.+||   .++-...|..|+..+
T Consensus        13 Y~c~~cg~~~----dvvq~~---~ddplt~ce~c~a~~   43 (82)
T COG2331          13 YECTECGNRF----DVVQAM---TDDPLTTCEECGARL   43 (82)
T ss_pred             EeecccchHH----HHHHhc---ccCccccChhhChHH
Confidence            6666665533    344443   233345666666543


No 165
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=44.48  E-value=8.9  Score=26.60  Aligned_cols=25  Identities=20%  Similarity=0.512  Sum_probs=15.0

Q ss_pred             ccccCCCccccCChhHHHHHHHHhcCCCceecccccc
Q psy11318         29 RYQCEECPKDFSTRKYLTQHQNAIHRGIRFQCNKCFR   65 (263)
Q Consensus        29 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~   65 (263)
                      .+.|..|+..|....            ..+.|+.|+.
T Consensus        70 ~~~C~~Cg~~~~~~~------------~~~~CP~Cgs   94 (113)
T PRK12380         70 QAWCWDCSQVVEIHQ------------HDAQCPHCHG   94 (113)
T ss_pred             EEEcccCCCEEecCC------------cCccCcCCCC
Confidence            467777776665432            2255777774


No 166
>PF03833 PolC_DP2:  DNA polymerase II large subunit DP2;  InterPro: IPR016033 DP2 is the large subunit of a two-subunit novel archaebacterial replicative DNA polymerase first characterised for Pyrococcus furiosus. The structure of DP2 appears to be organised as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit. This entry represents the N-terminal ~950 residue component of DP2.; GO: 0003887 DNA-directed DNA polymerase activity; PDB: 3O59_X.
Probab=44.35  E-value=7.4  Score=36.53  Aligned_cols=8  Identities=38%  Similarity=1.040  Sum_probs=0.0

Q ss_pred             cccCCCcc
Q psy11318         30 YQCEECPK   37 (263)
Q Consensus        30 ~~C~~C~~   37 (263)
                      +.|+.||.
T Consensus       656 r~Cp~Cg~  663 (900)
T PF03833_consen  656 RRCPKCGK  663 (900)
T ss_dssp             --------
T ss_pred             ccCcccCC
Confidence            45555544


No 167
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=44.04  E-value=17  Score=20.52  Aligned_cols=7  Identities=29%  Similarity=1.322  Sum_probs=3.5

Q ss_pred             ccCCcch
Q psy11318        144 YHCTQCS  150 (263)
Q Consensus       144 ~~C~~C~  150 (263)
                      +.|+.||
T Consensus        19 ~~CP~Cg   25 (46)
T PF12760_consen   19 FVCPHCG   25 (46)
T ss_pred             CCCCCCC
Confidence            4455555


No 168
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=43.85  E-value=28  Score=20.66  Aligned_cols=14  Identities=14%  Similarity=0.591  Sum_probs=7.4

Q ss_pred             ccccCCCccccCCh
Q psy11318         29 RYQCEECPKDFSTR   42 (263)
Q Consensus        29 ~~~C~~C~~~f~~~   42 (263)
                      .|.|+.||..+...
T Consensus        14 ~~~Cp~cGipthcS   27 (55)
T PF13824_consen   14 NFECPDCGIPTHCS   27 (55)
T ss_pred             CCcCCCCCCcCccC
Confidence            45566665554443


No 169
>PF09416 UPF1_Zn_bind:  RNA helicase (UPF2 interacting domain);  InterPro: IPR018999 UPF1 (or regulator of nonsense transcripts 1 homologue) is an essential RNA helicase that detects mRNAs containing premature stop codons and triggers their degradation. This domain contains 3 zinc binding motifs and forms interactions with another protein (UPF2) that is also involved nonsense-mediated mRNA decay (NMD) []. ; GO: 0003677 DNA binding, 0004386 helicase activity, 0005524 ATP binding, 0008270 zinc ion binding, 0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay, 0005737 cytoplasm; PDB: 2IYK_B 2WJY_A 2WJV_A 2XZL_A.
Probab=43.82  E-value=33  Score=25.15  Aligned_cols=17  Identities=18%  Similarity=0.405  Sum_probs=11.2

Q ss_pred             cCCCceecccccccccc
Q psy11318         53 HRGIRFQCNKCFRAYKL   69 (263)
Q Consensus        53 ~~~~~~~C~~C~~~f~~   69 (263)
                      ...-..+|..|+++|..
T Consensus        10 ~p~~vv~C~~c~kWFCN   26 (152)
T PF09416_consen   10 DPSCVVKCNTCNKWFCN   26 (152)
T ss_dssp             -CCCEEEETTTTEEEES
T ss_pred             CcccEeEcCCCCcEeec
Confidence            34445788888888854


No 170
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=43.79  E-value=7.6  Score=21.54  Aligned_cols=9  Identities=22%  Similarity=0.770  Sum_probs=4.3

Q ss_pred             ccccccccc
Q psy11318          3 YYCNACSKN   11 (263)
Q Consensus         3 y~C~~C~~~   11 (263)
                      |.|+.||..
T Consensus         1 m~Cp~Cg~~    9 (43)
T PF08271_consen    1 MKCPNCGSK    9 (43)
T ss_dssp             ESBTTTSSS
T ss_pred             CCCcCCcCC
Confidence            345555543


No 171
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=43.78  E-value=17  Score=22.45  Aligned_cols=29  Identities=21%  Similarity=0.443  Sum_probs=18.4

Q ss_pred             ccCCCccccCChhHHHHHHHHhcCCCceecccccccccc
Q psy11318         31 QCEECPKDFSTRKYLTQHQNAIHRGIRFQCNKCFRAYKL   69 (263)
Q Consensus        31 ~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~   69 (263)
                      .|+.||..-..          -.....|.|+.||..+..
T Consensus        30 ~C~~CG~~~~~----------~~~~r~~~C~~Cg~~~~r   58 (69)
T PF07282_consen   30 TCPRCGHRNKK----------RRSGRVFTCPNCGFEMDR   58 (69)
T ss_pred             CccCccccccc----------ccccceEEcCCCCCEECc
Confidence            57777765554          133345888888877654


No 172
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=43.05  E-value=14  Score=22.82  Aligned_cols=9  Identities=44%  Similarity=1.040  Sum_probs=2.6

Q ss_pred             ccCCCcccc
Q psy11318         31 QCEECPKDF   39 (263)
Q Consensus        31 ~C~~C~~~f   39 (263)
                      .|.+|++.|
T Consensus        11 ~C~~C~~~F   19 (69)
T PF01363_consen   11 NCMICGKKF   19 (69)
T ss_dssp             B-TTT--B-
T ss_pred             cCcCcCCcC
Confidence            455555555


No 173
>KOG4124|consensus
Probab=43.03  E-value=9.4  Score=31.80  Aligned_cols=51  Identities=18%  Similarity=0.144  Sum_probs=38.2

Q ss_pred             CCccCCc--chhhhcChHHHHHHHhhcc-------------------CCCCCcCCCCcccccccceeeeccC
Q psy11318        142 KRYHCTQ--CSKFYIQESDLMEHMAVHS-------------------GVRKLTTGPIKTEQTFGVRELRHVG  192 (263)
Q Consensus       142 ~~~~C~~--C~~~f~~~~~l~~H~~~h~-------------------~~~~~~c~~c~~~~~~~~~l~~H~~  192 (263)
                      ++|+|++  |++.+.....|+.|...-|                   ..|+|+|++|.+.++-...|..|..
T Consensus       348 ~~~~~~vp~~~~~~~n~ng~~~~~~~~h~s~i~~~s~~~~ph~~~~~~nk~~r~~i~~~~~k~~~~l~~~~~  419 (442)
T KOG4124|consen  348 KPYKCPVPNCDKAYKNQNGLKYHKLHGHCSPITTPTPAPIPHQGFVVENKPYRCEVCSKRYKNLNGLKYHRT  419 (442)
T ss_pred             CCCCCCCCcchhhcccCcceeeccccCcCCCCCCCCCCCCCcceeeeccCcccChhhhhhhccCCCCCceee
Confidence            5788877  9999888888887754322                   2478999999999887777666654


No 174
>PF03884 DUF329:  Domain of unknown function (DUF329);  InterPro: IPR005584 The biological function of these short proteins is unknown, but they contain four conserved cysteines, suggesting that they all bind zinc. YacG (Q5X8H6 from SWISSPROT) from Escherichia coli has been shown to bind zinc and contains the structural motifs typical of zinc-binding proteins []. The conserved four cysteine motif in these proteins (-C-X(2)-C-X(15)-C-X(3)-C-) is not found in other zinc-binding proteins with known structures.; GO: 0008270 zinc ion binding; PDB: 1LV3_A.
Probab=42.83  E-value=7.9  Score=23.14  Aligned_cols=13  Identities=31%  Similarity=0.646  Sum_probs=4.5

Q ss_pred             CCccccccccccC
Q psy11318          1 MRYYCNACSKNFS   13 (263)
Q Consensus         1 ~~y~C~~C~~~f~   13 (263)
                      |...|++|++.+.
T Consensus         1 m~v~CP~C~k~~~   13 (57)
T PF03884_consen    1 MTVKCPICGKPVE   13 (57)
T ss_dssp             -EEE-TTT--EEE
T ss_pred             CcccCCCCCCeec
Confidence            3445566655433


No 175
>KOG3408|consensus
Probab=42.53  E-value=13  Score=25.89  Aligned_cols=23  Identities=30%  Similarity=0.631  Sum_probs=21.3

Q ss_pred             ccccCCCccccCChhHHHHHHHH
Q psy11318         29 RYQCEECPKDFSTRKYLTQHQNA   51 (263)
Q Consensus        29 ~~~C~~C~~~f~~~~~l~~H~~~   51 (263)
                      .|-|-.|.+.|.+...|+.|.++
T Consensus        57 qfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   57 QFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             eeehhhhhhhhcchHHHHHHHhc
Confidence            48999999999999999999886


No 176
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=40.35  E-value=10  Score=27.26  Aligned_cols=12  Identities=25%  Similarity=0.858  Sum_probs=7.1

Q ss_pred             eecccccccccc
Q psy11318         58 FQCNKCFRAYKL   69 (263)
Q Consensus        58 ~~C~~C~~~f~~   69 (263)
                      +.|..|+..|..
T Consensus        71 ~~C~~CG~~~~~   82 (135)
T PRK03824         71 LKCRNCGNEWSL   82 (135)
T ss_pred             EECCCCCCEEec
Confidence            566666655544


No 177
>KOG2907|consensus
Probab=39.58  E-value=10  Score=26.05  Aligned_cols=11  Identities=27%  Similarity=0.948  Sum_probs=5.2

Q ss_pred             ccCCcchhhhc
Q psy11318        144 YHCTQCSKFYI  154 (263)
Q Consensus       144 ~~C~~C~~~f~  154 (263)
                      |.|+.|++.|+
T Consensus       103 YTC~kC~~k~~  113 (116)
T KOG2907|consen  103 YTCPKCKYKFT  113 (116)
T ss_pred             EEcCccceeee
Confidence            44554544443


No 178
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=39.22  E-value=11  Score=26.24  Aligned_cols=26  Identities=27%  Similarity=0.781  Sum_probs=17.0

Q ss_pred             ccccCCCccccCChhHHHHHHHHhcCCCceeccccccc
Q psy11318         29 RYQCEECPKDFSTRKYLTQHQNAIHRGIRFQCNKCFRA   66 (263)
Q Consensus        29 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~   66 (263)
                      ...|..|+..|.....            .+.|+.|+..
T Consensus        70 ~~~C~~Cg~~~~~~~~------------~~~CP~Cgs~   95 (115)
T TIGR00100        70 ECECEDCSEEVSPEID------------LYRCPKCHGI   95 (115)
T ss_pred             EEEcccCCCEEecCCc------------CccCcCCcCC
Confidence            4778888876665432            3678888753


No 179
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=38.14  E-value=14  Score=21.37  Aligned_cols=11  Identities=36%  Similarity=0.818  Sum_probs=6.5

Q ss_pred             ceecccccccc
Q psy11318         57 RFQCNKCFRAY   67 (263)
Q Consensus        57 ~~~C~~C~~~f   67 (263)
                      .+.|..|+..+
T Consensus        37 r~~C~~Cgyt~   47 (50)
T PRK00432         37 RWHCGKCGYTE   47 (50)
T ss_pred             cEECCCcCCEE
Confidence            46666666543


No 180
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=37.83  E-value=15  Score=21.29  Aligned_cols=12  Identities=25%  Similarity=0.805  Sum_probs=6.6

Q ss_pred             ccccccccccCC
Q psy11318          3 YYCNACSKNFSA   14 (263)
Q Consensus         3 y~C~~C~~~f~~   14 (263)
                      |.|..||..|.-
T Consensus         2 y~C~~CgyiYd~   13 (50)
T cd00730           2 YECRICGYIYDP   13 (50)
T ss_pred             cCCCCCCeEECC
Confidence            555555555553


No 181
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=37.51  E-value=15  Score=20.00  Aligned_cols=13  Identities=23%  Similarity=0.777  Sum_probs=8.0

Q ss_pred             CccccccccccCC
Q psy11318          2 RYYCNACSKNFSA   14 (263)
Q Consensus         2 ~y~C~~C~~~f~~   14 (263)
                      ++.|..|++.|-.
T Consensus        12 ~f~C~~C~~~FC~   24 (39)
T smart00154       12 GFKCRHCGNLFCG   24 (39)
T ss_pred             CeECCccCCcccc
Confidence            4566666666654


No 182
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=36.80  E-value=13  Score=21.38  Aligned_cols=11  Identities=27%  Similarity=0.848  Sum_probs=5.6

Q ss_pred             ccccCCCcccc
Q psy11318         29 RYQCEECPKDF   39 (263)
Q Consensus        29 ~~~C~~C~~~f   39 (263)
                      .+.|+.||+.+
T Consensus        20 ~~vC~~Cg~~~   30 (52)
T smart00661       20 RFVCRKCGYEE   30 (52)
T ss_pred             EEECCcCCCeE
Confidence            45555555443


No 183
>KOG2636|consensus
Probab=36.34  E-value=23  Score=30.72  Aligned_cols=23  Identities=35%  Similarity=0.677  Sum_probs=15.1

Q ss_pred             ccccCCCc-cccCChhHHHHHHHH
Q psy11318         29 RYQCEECP-KDFSTRKYLTQHQNA   51 (263)
Q Consensus        29 ~~~C~~C~-~~f~~~~~l~~H~~~   51 (263)
                      .|.|.+|| +++.-...+.+|...
T Consensus       401 ey~CEICGNy~Y~GrkaF~RHF~E  424 (497)
T KOG2636|consen  401 EYNCEICGNYVYKGRKAFDRHFNE  424 (497)
T ss_pred             ccceeeccCccccCcHHHHHHhHH
Confidence            46777776 666666666666654


No 184
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=36.07  E-value=22  Score=20.51  Aligned_cols=12  Identities=17%  Similarity=0.719  Sum_probs=5.5

Q ss_pred             eecccccccccc
Q psy11318         58 FQCNKCFRAYKL   69 (263)
Q Consensus        58 ~~C~~C~~~f~~   69 (263)
                      +.|..||..|..
T Consensus         5 l~C~dCg~~Fvf   16 (49)
T PF13451_consen    5 LTCKDCGAEFVF   16 (49)
T ss_pred             EEcccCCCeEEE
Confidence            444455544433


No 185
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=35.76  E-value=22  Score=30.77  Aligned_cols=32  Identities=13%  Similarity=0.168  Sum_probs=21.1

Q ss_pred             cCCcchhhhcChHHHHHHHhhccCCCCCcCCCCccccccccee
Q psy11318        145 HCTQCSKFYIQESDLMEHMAVHSGVRKLTTGPIKTEQTFGVRE  187 (263)
Q Consensus       145 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~c~~~~~~~~~l  187 (263)
                      +|+.||....+.           |.+.|+|..|++.+......
T Consensus       352 ~Cp~Cg~~m~S~-----------G~~g~rC~kCg~~~~~~~~~  383 (421)
T COG1571         352 VCPRCGGRMKSA-----------GRNGFRCKKCGTRARETLIK  383 (421)
T ss_pred             CCCccCCchhhc-----------CCCCcccccccccCCccccc
Confidence            688888654322           44488888888877665443


No 186
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=35.51  E-value=13  Score=19.83  Aligned_cols=9  Identities=33%  Similarity=1.006  Sum_probs=3.8

Q ss_pred             ccccccccc
Q psy11318          3 YYCNACSKN   11 (263)
Q Consensus         3 y~C~~C~~~   11 (263)
                      |+|..||..
T Consensus         7 YkC~~CGni   15 (36)
T PF06397_consen    7 YKCEHCGNI   15 (36)
T ss_dssp             EE-TTT--E
T ss_pred             EEccCCCCE
Confidence            666666664


No 187
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=35.27  E-value=22  Score=31.29  Aligned_cols=25  Identities=24%  Similarity=0.545  Sum_probs=21.5

Q ss_pred             CccCCcchhhhcChHHHHHHHhhcc
Q psy11318        143 RYHCTQCSKFYIQESDLMEHMAVHS  167 (263)
Q Consensus       143 ~~~C~~C~~~f~~~~~l~~H~~~h~  167 (263)
                      -|.|+.|.+.|.....+..|+...|
T Consensus        57 FWiCp~CskkF~d~~~~~~H~~~eH   81 (466)
T PF04780_consen   57 FWICPRCSKKFSDAESCLSHMEQEH   81 (466)
T ss_pred             EeeCCcccceeCCHHHHHHHHHHhh
Confidence            3689999999999999999998544


No 188
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=35.10  E-value=11  Score=24.88  Aligned_cols=10  Identities=30%  Similarity=0.893  Sum_probs=4.1

Q ss_pred             ccCCcchhhh
Q psy11318        144 YHCTQCSKFY  153 (263)
Q Consensus       144 ~~C~~C~~~f  153 (263)
                      |.|..|++.|
T Consensus        55 W~C~~C~~~~   64 (90)
T PTZ00255         55 WRCKGCKKTV   64 (90)
T ss_pred             EEcCCCCCEE
Confidence            4444444333


No 189
>KOG0782|consensus
Probab=34.86  E-value=9.9  Score=33.95  Aligned_cols=55  Identities=22%  Similarity=0.504  Sum_probs=31.3

Q ss_pred             HHHHHHHhhCC-cccccCCCccccCChhHHHHHHHHhcCCCceecccccccccchH-HHHHH
Q psy11318         17 TLNKHMDIHKG-VRYQCEECPKDFSTRKYLTQHQNAIHRGIRFQCNKCFRAYKLKK-DLLAH   76 (263)
Q Consensus        17 ~L~~H~~~h~~-~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~-~l~~H   76 (263)
                      .|.+|-=.|.. ..-+|..|+|.|..+..+..-     ......|+.|...|-.+. .+..+
T Consensus       240 ~fvrHHWVHrrRqeGkC~~CgKgFQQKf~FhsK-----EivAisCSWCKqayH~KvtCFml~  296 (1004)
T KOG0782|consen  240 GFVRHHWVHRRRQEGKCNTCGKGFQQKFFFHSK-----EIVAISCSWCKQAYHLKVTCFMLD  296 (1004)
T ss_pred             cchHHhHhhHhhhccccchhhhhhhhheeeccc-----cEEEEEehHHHHHhhcchhhhhhh
Confidence            34444333322 134888999888776644221     123478888888876653 44333


No 190
>KOG3408|consensus
Probab=34.62  E-value=28  Score=24.28  Aligned_cols=27  Identities=22%  Similarity=0.783  Sum_probs=22.8

Q ss_pred             CCCCccCCcchhhhcChHHHHHHHhhc
Q psy11318        140 NGKRYHCTQCSKFYIQESDLMEHMAVH  166 (263)
Q Consensus       140 ~~~~~~C~~C~~~f~~~~~l~~H~~~h  166 (263)
                      |.-.|-|..|.+-|.+...|..|.++.
T Consensus        54 G~GqfyCi~CaRyFi~~~~l~~H~ktK   80 (129)
T KOG3408|consen   54 GGGQFYCIECARYFIDAKALKTHFKTK   80 (129)
T ss_pred             CCceeehhhhhhhhcchHHHHHHHhcc
Confidence            445688999999999999999998654


No 191
>PRK05978 hypothetical protein; Provisional
Probab=34.10  E-value=13  Score=27.21  Aligned_cols=32  Identities=22%  Similarity=0.473  Sum_probs=19.0

Q ss_pred             ccccCCCccccCChhHHHHHHHHhcCCCceecccccccccc
Q psy11318         29 RYQCEECPKDFSTRKYLTQHQNAIHRGIRFQCNKCFRAYKL   69 (263)
Q Consensus        29 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~   69 (263)
                      .-+|+.||+.=-....|+.+         -.|+.|+..|..
T Consensus        33 ~grCP~CG~G~LF~g~Lkv~---------~~C~~CG~~~~~   64 (148)
T PRK05978         33 RGRCPACGEGKLFRAFLKPV---------DHCAACGEDFTH   64 (148)
T ss_pred             cCcCCCCCCCcccccccccC---------CCccccCCcccc
Confidence            46788887654434433322         468888876644


No 192
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=34.08  E-value=3.6  Score=22.55  Aligned_cols=9  Identities=0%  Similarity=-0.156  Sum_probs=4.1

Q ss_pred             CcCCCCccc
Q psy11318        172 LTTGPIKTE  180 (263)
Q Consensus       172 ~~c~~c~~~  180 (263)
                      |.|..|++.
T Consensus        29 y~C~~C~~~   37 (40)
T smart00440       29 YVCTKCGHR   37 (40)
T ss_pred             EEeCCCCCE
Confidence            444444443


No 193
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=34.06  E-value=21  Score=24.95  Aligned_cols=14  Identities=21%  Similarity=0.823  Sum_probs=9.2

Q ss_pred             ccccCCCccccCCh
Q psy11318         29 RYQCEECPKDFSTR   42 (263)
Q Consensus        29 ~~~C~~C~~~f~~~   42 (263)
                      .+.|..||..|...
T Consensus        71 ~~~C~~Cg~~~~~~   84 (117)
T PRK00564         71 ELECKDCSHVFKPN   84 (117)
T ss_pred             EEEhhhCCCccccC
Confidence            46777887666543


No 194
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=34.01  E-value=16  Score=24.81  Aligned_cols=10  Identities=20%  Similarity=0.517  Sum_probs=5.5

Q ss_pred             CCcccccccc
Q psy11318          1 MRYYCNACSK   10 (263)
Q Consensus         1 ~~y~C~~C~~   10 (263)
                      ||-.|++||.
T Consensus         1 ~p~~CpYCg~   10 (102)
T PF11672_consen    1 KPIICPYCGG   10 (102)
T ss_pred             CCcccCCCCC
Confidence            4455555555


No 195
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=33.71  E-value=22  Score=30.79  Aligned_cols=30  Identities=13%  Similarity=0.451  Sum_probs=20.9

Q ss_pred             cCCCCCCCcccCCHHHHHHHHHHhCCCCCccCCcchhhhcChH
Q psy11318        115 QCNECSTSKDYLTKRDLRRHMKLHFNGKRYHCTQCSKFYIQES  157 (263)
Q Consensus       115 ~C~~C~~~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~  157 (263)
                      .|+.||  .+..+.           |.+-|+|+.||+.+....
T Consensus       352 ~Cp~Cg--~~m~S~-----------G~~g~rC~kCg~~~~~~~  381 (421)
T COG1571         352 VCPRCG--GRMKSA-----------GRNGFRCKKCGTRARETL  381 (421)
T ss_pred             CCCccC--Cchhhc-----------CCCCcccccccccCCccc
Confidence            689998  433222           434899999998887654


No 196
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=32.88  E-value=22  Score=24.74  Aligned_cols=13  Identities=23%  Similarity=0.577  Sum_probs=8.5

Q ss_pred             ccccCCCccccCC
Q psy11318         29 RYQCEECPKDFST   41 (263)
Q Consensus        29 ~~~C~~C~~~f~~   41 (263)
                      .+.|..|+..|..
T Consensus        70 ~~~C~~Cg~~~~~   82 (114)
T PRK03681         70 ECWCETCQQYVTL   82 (114)
T ss_pred             EEEcccCCCeeec
Confidence            4777888765543


No 197
>KOG2071|consensus
Probab=32.56  E-value=27  Score=31.49  Aligned_cols=23  Identities=22%  Similarity=0.472  Sum_probs=15.6

Q ss_pred             cccCCCccccCChhHHHHHHHHh
Q psy11318         30 YQCEECPKDFSTRKYLTQHQNAI   52 (263)
Q Consensus        30 ~~C~~C~~~f~~~~~l~~H~~~~   52 (263)
                      .+|..||..|.+......||..|
T Consensus       419 nqC~~CG~R~~~~ee~sk~md~H  441 (579)
T KOG2071|consen  419 NQCKSCGLRFDDSEERSKHMDIH  441 (579)
T ss_pred             chhcccccccccchhhhhHhhhh
Confidence            46777777777777777666664


No 198
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=32.09  E-value=34  Score=30.20  Aligned_cols=27  Identities=26%  Similarity=0.477  Sum_probs=23.5

Q ss_pred             cccCCCccccCChhHHHHHHHHhcCCC
Q psy11318         30 YQCEECPKDFSTRKYLTQHQNAIHRGI   56 (263)
Q Consensus        30 ~~C~~C~~~f~~~~~l~~H~~~~~~~~   56 (263)
                      +.|+.|.+.|.+...++.|+...|...
T Consensus        58 WiCp~CskkF~d~~~~~~H~~~eH~~~   84 (466)
T PF04780_consen   58 WICPRCSKKFSDAESCLSHMEQEHPAG   84 (466)
T ss_pred             eeCCcccceeCCHHHHHHHHHHhhhhh
Confidence            689999999999999999999766543


No 199
>COG4896 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=32.08  E-value=33  Score=20.71  Aligned_cols=9  Identities=22%  Similarity=0.730  Sum_probs=4.4

Q ss_pred             Ccccccccc
Q psy11318          2 RYYCNACSK   10 (263)
Q Consensus         2 ~y~C~~C~~   10 (263)
                      ..+|.+|+.
T Consensus         2 ~vkCiiCd~   10 (68)
T COG4896           2 NVKCIICDR   10 (68)
T ss_pred             CceEEEecc
Confidence            344555554


No 200
>PF14369 zf-RING_3:  zinc-finger
Probab=31.93  E-value=30  Score=18.29  Aligned_cols=11  Identities=36%  Similarity=1.247  Sum_probs=5.8

Q ss_pred             Ccccccccccc
Q psy11318          2 RYYCNACSKNF   12 (263)
Q Consensus         2 ~y~C~~C~~~f   12 (263)
                      +|.|-.|...+
T Consensus         2 ~ywCh~C~~~V   12 (35)
T PF14369_consen    2 RYWCHQCNRFV   12 (35)
T ss_pred             CEeCccCCCEe
Confidence            35555555543


No 201
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=31.48  E-value=15  Score=20.43  Aligned_cols=13  Identities=31%  Similarity=0.910  Sum_probs=5.8

Q ss_pred             CccccccccccCC
Q psy11318          2 RYYCNACSKNFSA   14 (263)
Q Consensus         2 ~y~C~~C~~~f~~   14 (263)
                      ++.|..|++.|=.
T Consensus        13 ~~~C~~C~~~FC~   25 (43)
T PF01428_consen   13 PFKCKHCGKSFCL   25 (43)
T ss_dssp             HEE-TTTS-EE-T
T ss_pred             CeECCCCCcccCc
Confidence            4566666666544


No 202
>KOG0717|consensus
Probab=31.37  E-value=26  Score=30.61  Aligned_cols=22  Identities=36%  Similarity=0.730  Sum_probs=20.8

Q ss_pred             cccCCCccccCChhHHHHHHHH
Q psy11318         30 YQCEECPKDFSTRKYLTQHQNA   51 (263)
Q Consensus        30 ~~C~~C~~~f~~~~~l~~H~~~   51 (263)
                      +-|.+|++.|.+...|+.|..+
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            8899999999999999999876


No 203
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=31.22  E-value=31  Score=28.44  Aligned_cols=34  Identities=24%  Similarity=0.328  Sum_probs=20.8

Q ss_pred             ccccCCCccccCChhHHHHHHHHhcCCCceecccccccccchH
Q psy11318         29 RYQCEECPKDFSTRKYLTQHQNAIHRGIRFQCNKCFRAYKLKK   71 (263)
Q Consensus        29 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~   71 (263)
                      =.+|+.|+.....+. |.        +..+.|+.|+..|.-..
T Consensus        38 w~kc~~C~~~~~~~~-l~--------~~~~vcp~c~~h~rltA   71 (296)
T CHL00174         38 WVQCENCYGLNYKKF-LK--------SKMNICEQCGYHLKMSS   71 (296)
T ss_pred             eeECCCccchhhHHH-HH--------HcCCCCCCCCCCcCCCH
Confidence            367888877554433 11        12368888888777543


No 204
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=30.94  E-value=48  Score=24.64  Aligned_cols=18  Identities=33%  Similarity=0.765  Sum_probs=12.8

Q ss_pred             CccCCcchhhhcChHHHH
Q psy11318        143 RYHCTQCSKFYIQESDLM  160 (263)
Q Consensus       143 ~~~C~~C~~~f~~~~~l~  160 (263)
                      -|.|+.||+.|..-+.+.
T Consensus       130 f~~C~~CgkiYW~GsHw~  147 (165)
T COG1656         130 FYRCPKCGKIYWKGSHWR  147 (165)
T ss_pred             eeECCCCcccccCchHHH
Confidence            467888888887666544


No 205
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=30.80  E-value=33  Score=28.20  Aligned_cols=34  Identities=21%  Similarity=0.454  Sum_probs=21.4

Q ss_pred             ccccCCCccccCChhHHHHHHHHhcCCCceecccccccccchH
Q psy11318         29 RYQCEECPKDFSTRKYLTQHQNAIHRGIRFQCNKCFRAYKLKK   71 (263)
Q Consensus        29 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~   71 (263)
                      =.+|+.|+.....+. |..        ..+.|+.|+..|.-..
T Consensus        26 ~~~c~~c~~~~~~~~-l~~--------~~~vc~~c~~h~rl~a   59 (285)
T TIGR00515        26 WTKCPKCGQVLYTKE-LER--------NLEVCPKCDHHMRMDA   59 (285)
T ss_pred             eeECCCCcchhhHHH-HHh--------hCCCCCCCCCcCcCCH
Confidence            367888887654443 111        1268899998877543


No 206
>KOG1940|consensus
Probab=30.68  E-value=38  Score=27.60  Aligned_cols=46  Identities=15%  Similarity=0.265  Sum_probs=30.6

Q ss_pred             eecccccccccchHHHHHHHHHhcCCCc-----------ccCCcCCCcCCCHHHHHHH
Q psy11318         58 FQCNKCFRAYKLKKDLLAHTMLEHFGIR-----------HPCSECPKTFASRHSLKNH  104 (263)
Q Consensus        58 ~~C~~C~~~f~~~~~l~~H~~~~~~~~~-----------~~C~~C~~~f~~~~~l~~H  104 (263)
                      |.|++|.+ -.....+..+......+.+           ..|+.|+..-..+.....|
T Consensus       197 y~CP~C~~-~~d~~~~~~~~d~~l~~~~~p~~y~~~~~~i~cndC~~~~~~k~~~l~~  253 (276)
T KOG1940|consen  197 YTCPICSK-PGDMSHYFRKLDKELAGSPMPEEYKNKTQDILCNDCGSGTNVKYHILYH  253 (276)
T ss_pred             CCCCcccc-hHHHHHHHHHHHHHHhcCCCCchhhchhheeeccCCCCCCccceehhhh
Confidence            99999998 6666666666655444322           4688898877666555444


No 207
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=29.87  E-value=18  Score=25.12  Aligned_cols=15  Identities=27%  Similarity=0.888  Sum_probs=9.0

Q ss_pred             ccccCCCccccCChh
Q psy11318         29 RYQCEECPKDFSTRK   43 (263)
Q Consensus        29 ~~~C~~C~~~f~~~~   43 (263)
                      .+.|..||+.|.-..
T Consensus        70 ~~~C~~Cg~~~~~~~   84 (113)
T PF01155_consen   70 RARCRDCGHEFEPDE   84 (113)
T ss_dssp             EEEETTTS-EEECHH
T ss_pred             cEECCCCCCEEecCC
Confidence            467777777766544


No 208
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=29.80  E-value=37  Score=19.81  Aligned_cols=9  Identities=44%  Similarity=1.095  Sum_probs=4.0

Q ss_pred             cCCCccccC
Q psy11318         32 CEECPKDFS   40 (263)
Q Consensus        32 C~~C~~~f~   40 (263)
                      |..|++.|.
T Consensus         5 C~~C~~~F~   13 (57)
T cd00065           5 CMGCGKPFT   13 (57)
T ss_pred             CcccCcccc
Confidence            444444444


No 209
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=29.69  E-value=18  Score=25.79  Aligned_cols=11  Identities=36%  Similarity=1.213  Sum_probs=5.4

Q ss_pred             ccccccccccC
Q psy11318          3 YYCNACSKNFS   13 (263)
Q Consensus         3 y~C~~C~~~f~   13 (263)
                      |.|..|+++|.
T Consensus        54 yrC~~C~~tf~   64 (129)
T COG3677          54 YKCKSCGSTFT   64 (129)
T ss_pred             cccCCcCccee
Confidence            44555555444


No 210
>KOG1842|consensus
Probab=29.58  E-value=30  Score=30.01  Aligned_cols=28  Identities=21%  Similarity=0.357  Sum_probs=24.1

Q ss_pred             ccccCCCccccCChhHHHHHHHHhcCCC
Q psy11318         29 RYQCEECPKDFSTRKYLTQHQNAIHRGI   56 (263)
Q Consensus        29 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~   56 (263)
                      .|.|++|..-|.+...|..|+...|.+.
T Consensus        15 gflCPiC~~dl~~~~~L~~H~d~eH~~e   42 (505)
T KOG1842|consen   15 GFLCPICLLDLPNLSALNDHLDVEHFEE   42 (505)
T ss_pred             cccCchHhhhhhhHHHHHHHHhhhcccc
Confidence            6899999999999999999998777654


No 211
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=29.49  E-value=21  Score=18.13  Aligned_cols=11  Identities=27%  Similarity=1.077  Sum_probs=4.4

Q ss_pred             Ccccccccccc
Q psy11318          2 RYYCNACSKNF   12 (263)
Q Consensus         2 ~y~C~~C~~~f   12 (263)
                      +|.|+.|+..|
T Consensus        13 kY~Cp~C~~~~   23 (30)
T PF04438_consen   13 KYRCPRCGARY   23 (30)
T ss_dssp             SEE-TTT--EE
T ss_pred             EEECCCcCCce
Confidence            45666666554


No 212
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=29.36  E-value=33  Score=23.11  Aligned_cols=14  Identities=29%  Similarity=0.622  Sum_probs=7.0

Q ss_pred             ccccCCCccccCCh
Q psy11318         29 RYQCEECPKDFSTR   42 (263)
Q Consensus        29 ~~~C~~C~~~f~~~   42 (263)
                      |+.|.-||..|.+-
T Consensus         2 pH~CtrCG~vf~~g   15 (112)
T COG3364           2 PHQCTRCGEVFDDG   15 (112)
T ss_pred             Cceecccccccccc
Confidence            34455555555543


No 213
>PF14690 zf-ISL3:  zinc-finger of transposase IS204/IS1001/IS1096/IS1165
Probab=29.36  E-value=5.4  Score=22.45  Aligned_cols=10  Identities=20%  Similarity=0.504  Sum_probs=6.2

Q ss_pred             Cccccccccc
Q psy11318          2 RYYCNACSKN   11 (263)
Q Consensus         2 ~y~C~~C~~~   11 (263)
                      +..|+.||..
T Consensus         2 ~~~Cp~Cg~~   11 (47)
T PF14690_consen    2 PPRCPHCGSP   11 (47)
T ss_pred             CccCCCcCCC
Confidence            5567777743


No 214
>PF12907 zf-met2:  Zinc-binding
Probab=28.78  E-value=57  Score=17.90  Aligned_cols=26  Identities=23%  Similarity=0.475  Sum_probs=15.2

Q ss_pred             ccCCcchhhhc---ChHHHHHHHhhccCC
Q psy11318        144 YHCTQCSKFYI---QESDLMEHMAVHSGV  169 (263)
Q Consensus       144 ~~C~~C~~~f~---~~~~l~~H~~~h~~~  169 (263)
                      +.|.+|-.+|.   +...|..|....|..
T Consensus         2 i~C~iC~qtF~~t~~~~~L~eH~enKHpK   30 (40)
T PF12907_consen    2 IICKICRQTFMQTTNEPQLKEHAENKHPK   30 (40)
T ss_pred             cCcHHhhHHHHhcCCHHHHHHHHHccCCC
Confidence            46777774443   445677776654443


No 215
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=28.54  E-value=36  Score=19.90  Aligned_cols=19  Identities=11%  Similarity=0.461  Sum_probs=13.3

Q ss_pred             ccccCCCccccCChhHHHH
Q psy11318         29 RYQCEECPKDFSTRKYLTQ   47 (263)
Q Consensus        29 ~~~C~~C~~~f~~~~~l~~   47 (263)
                      -++|+.||..|...-..+.
T Consensus        28 ~W~C~~Cgh~w~~~v~~R~   46 (55)
T PF14311_consen   28 WWKCPKCGHEWKASVNDRT   46 (55)
T ss_pred             EEECCCCCCeeEccHhhhc
Confidence            5788888887776654443


No 216
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=28.36  E-value=6.5  Score=26.33  Aligned_cols=36  Identities=11%  Similarity=0.320  Sum_probs=17.1

Q ss_pred             ccccCCCccccCChhHHHHHHHHhcCCCceeccccccccc
Q psy11318         29 RYQCEECPKDFSTRKYLTQHQNAIHRGIRFQCNKCFRAYK   68 (263)
Q Consensus        29 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~   68 (263)
                      .|.|+.||..-...-.++.-    .......|..||..|-
T Consensus        22 ~FtCp~Cghe~vs~ctvkk~----~~~g~~~Cg~CGls~e   57 (104)
T COG4888          22 TFTCPRCGHEKVSSCTVKKT----VNIGTAVCGNCGLSFE   57 (104)
T ss_pred             eEecCccCCeeeeEEEEEec----CceeEEEcccCcceEE
Confidence            47777776544332222111    1112256666666553


No 217
>TIGR00310 ZPR1_znf ZPR1 zinc finger domain.
Probab=28.01  E-value=8.3  Score=29.58  Aligned_cols=10  Identities=30%  Similarity=0.547  Sum_probs=4.9

Q ss_pred             cccCCCcccc
Q psy11318         30 YQCEECPKDF   39 (263)
Q Consensus        30 ~~C~~C~~~f   39 (263)
                      |.|+.||+..
T Consensus        31 f~C~~CGyr~   40 (192)
T TIGR00310        31 TICEHCGYRS   40 (192)
T ss_pred             EECCCCCCcc
Confidence            4555555443


No 218
>cd02341 ZZ_ZZZ3 Zinc finger, ZZ type. Zinc finger present in ZZZ3 (ZZ finger containing 3) and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=27.71  E-value=40  Score=19.29  Aligned_cols=10  Identities=60%  Similarity=1.544  Sum_probs=6.4

Q ss_pred             CcccccCCCc
Q psy11318         27 GVRYQCEECP   36 (263)
Q Consensus        27 ~~~~~C~~C~   36 (263)
                      |.+|+|..|.
T Consensus        13 G~R~~C~~C~   22 (48)
T cd02341          13 GTRYHCSECD   22 (48)
T ss_pred             cceEECCCCC
Confidence            4567777765


No 219
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=27.45  E-value=13  Score=21.60  Aligned_cols=26  Identities=27%  Similarity=0.797  Sum_probs=11.6

Q ss_pred             CCccCCcchhhhcChHHHHHHHhhcc
Q psy11318        142 KRYHCTQCSKFYIQESDLMEHMAVHS  167 (263)
Q Consensus       142 ~~~~C~~C~~~f~~~~~l~~H~~~h~  167 (263)
                      ..|+|+.|...|=.--++..|...|.
T Consensus        20 ~~y~C~~C~~~FC~dCD~fiHE~LH~   45 (51)
T PF07975_consen   20 SRYRCPKCKNHFCIDCDVFIHETLHN   45 (51)
T ss_dssp             EEE--TTTT--B-HHHHHTTTTTS-S
T ss_pred             CeEECCCCCCccccCcChhhhccccC
Confidence            34666666666666555666655543


No 220
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated
Probab=26.97  E-value=38  Score=27.98  Aligned_cols=33  Identities=18%  Similarity=0.414  Sum_probs=20.7

Q ss_pred             ccccCCCccccCChhHHHHHHHHhcCCCceecccccccccch
Q psy11318         29 RYQCEECPKDFSTRKYLTQHQNAIHRGIRFQCNKCFRAYKLK   70 (263)
Q Consensus        29 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~   70 (263)
                      -.+|+.|+.....+. |..        ..+.|+.|+..|.-.
T Consensus        27 ~~~c~~c~~~~~~~~-l~~--------~~~vc~~c~~h~rl~   59 (292)
T PRK05654         27 WTKCPSCGQVLYRKE-LEA--------NLNVCPKCGHHMRIS   59 (292)
T ss_pred             eeECCCccchhhHHH-HHh--------cCCCCCCCCCCeeCC
Confidence            467888877544433 111        126889999888654


No 221
>PF03145 Sina:  Seven in absentia protein family;  InterPro: IPR018121 The seven in absentia (sina) gene was first identified in Drosophila. The Drosophila Sina protein is essential for the determination of the R7 pathway in photoreceptor cell development: the loss of functional Sina results in the transformation of the R7 precursor cell to a non-neuronal cell type. The Sina protein contains an N-terminal RING finger domain C3HC4-type. Through this domain, Sina binds E2 ubiquitin-conjugating enzymes (UbcD1) Sina also interacts with Tramtrack (TTK88) via PHYL. Tramtrack is a transcriptional repressor that blocks photoreceptor determination, while PHYL down-regulates the activity of TTK88. In turn, the activity of PHYL requires the activation of the Sevenless receptor tyrosine kinase, a process essential for R7 determination. It is thought that Sina targets TTK88 for degradation, therefore promoting the R7 pathway. Murine and human homologues of Sina have also been identified. The human homologue Siah-1 [] also binds E2 enzymes (UbcH5) and through a series of physical interactions, targets beta-catenin for ubiquitin degradation. Siah-1 expression is enhanced by p53, itself promoted by DNA damage. Thus this pathway links DNA damage to beta-catenin degradation [, ]. Sina proteins, therefore, physically interact with a variety of proteins. The N-terminal RING finger domain that binds ubiquitin conjugating enzymes is a C3HC4-type, and does not form part of the alignment for this family. The remainder C-terminal part is involved in interactions with other proteins, and is included in this alignment. In addition to the Drosophila protein and mammalian homologues, whose similarity was noted previously, this family also includes putative homologues from Caenorhabditis elegans, Arabidopsis thaliana.; GO: 0006511 ubiquitin-dependent protein catabolic process, 0007275 multicellular organismal development, 0005634 nucleus; PDB: 2A25_A 1K2F_B 2AN6_C.
Probab=26.96  E-value=59  Score=24.93  Aligned_cols=19  Identities=11%  Similarity=0.013  Sum_probs=8.4

Q ss_pred             HHHHHHHHhhCCcccccCC
Q psy11318         16 DTLNKHMDIHKGVRYQCEE   34 (263)
Q Consensus        16 ~~L~~H~~~h~~~~~~C~~   34 (263)
                      .....|.....-.|+.|+.
T Consensus        31 ~~~~~HE~~C~~~p~~CP~   49 (198)
T PF03145_consen   31 SEKREHEEECPFRPCSCPF   49 (198)
T ss_dssp             GGHHHHHHT-TTSEEE-SS
T ss_pred             cChhhHhccCCCcCCcCCC
Confidence            3444555554445555544


No 222
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=26.12  E-value=29  Score=20.34  Aligned_cols=8  Identities=25%  Similarity=0.787  Sum_probs=3.7

Q ss_pred             cccccccc
Q psy11318          4 YCNACSKN   11 (263)
Q Consensus         4 ~C~~C~~~   11 (263)
                      .||+||..
T Consensus         2 ~CPyCge~    9 (52)
T PF14255_consen    2 QCPYCGEP    9 (52)
T ss_pred             CCCCCCCe
Confidence            34444443


No 223
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=25.63  E-value=25  Score=25.70  Aligned_cols=32  Identities=9%  Similarity=0.043  Sum_probs=15.8

Q ss_pred             CccCCcchhhhcChHHHHHHHhhccCCCCCcCCCCccccccc
Q psy11318        143 RYHCTQCSKFYIQESDLMEHMAVHSGVRKLTTGPIKTEQTFG  184 (263)
Q Consensus       143 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~c~~~~~~~  184 (263)
                      .|+|..||....          ..+...--.|+.|+.....+
T Consensus       112 ~l~C~~Cg~~~~----------~~~~~~l~~Cp~C~~~~F~R  143 (146)
T PF07295_consen  112 TLVCENCGHEVE----------LTHPERLPPCPKCGHTEFTR  143 (146)
T ss_pred             eEecccCCCEEE----------ecCCCcCCCCCCCCCCeeee
Confidence            367777774422          11122345566676654433


No 224
>PF11789 zf-Nse:  Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C.
Probab=25.53  E-value=50  Score=19.69  Aligned_cols=14  Identities=14%  Similarity=0.422  Sum_probs=6.0

Q ss_pred             ceecccccccccch
Q psy11318         57 RFQCNKCFRAYKLK   70 (263)
Q Consensus        57 ~~~C~~C~~~f~~~   70 (263)
                      |+....|+-.|...
T Consensus        24 PV~s~~C~H~fek~   37 (57)
T PF11789_consen   24 PVKSKKCGHTFEKE   37 (57)
T ss_dssp             EEEESSS--EEEHH
T ss_pred             CcCcCCCCCeecHH
Confidence            44555555555443


No 225
>KOG1842|consensus
Probab=25.49  E-value=43  Score=29.15  Aligned_cols=26  Identities=31%  Similarity=0.501  Sum_probs=24.2

Q ss_pred             eecccccccccchHHHHHHHHHhcCC
Q psy11318         58 FQCNKCFRAYKLKKDLLAHTMLEHFG   83 (263)
Q Consensus        58 ~~C~~C~~~f~~~~~l~~H~~~~~~~   83 (263)
                      |.|++|...|.+...|..|....|.+
T Consensus        16 flCPiC~~dl~~~~~L~~H~d~eH~~   41 (505)
T KOG1842|consen   16 FLCPICLLDLPNLSALNDHLDVEHFE   41 (505)
T ss_pred             ccCchHhhhhhhHHHHHHHHhhhccc
Confidence            99999999999999999999887765


No 226
>COG1779 C4-type Zn-finger protein [General function prediction only]
Probab=24.90  E-value=10  Score=28.93  Aligned_cols=12  Identities=17%  Similarity=0.182  Sum_probs=8.5

Q ss_pred             eecccccccccc
Q psy11318         58 FQCNKCFRAYKL   69 (263)
Q Consensus        58 ~~C~~C~~~f~~   69 (263)
                      +.|..||+.+..
T Consensus        44 ~~C~~CgYR~~D   55 (201)
T COG1779          44 GVCERCGYRSTD   55 (201)
T ss_pred             EEccccCCcccc
Confidence            568888876655


No 227
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=24.67  E-value=23  Score=25.83  Aligned_cols=32  Identities=25%  Similarity=0.557  Sum_probs=13.9

Q ss_pred             CccCCcchhhhcChHHHHHHHhhccCCCCCcCCCCcc
Q psy11318        143 RYHCTQCSKFYIQESDLMEHMAVHSGVRKLTTGPIKT  179 (263)
Q Consensus       143 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~c~~  179 (263)
                      +|.|. |+..|-+.   .+|-..-.|+ .|.|..|+-
T Consensus       117 ~Y~C~-C~q~~l~~---RRhn~~~~g~-~YrC~~C~g  148 (156)
T COG3091         117 PYRCQ-CQQHYLRI---RRHNTVRRGE-VYRCGKCGG  148 (156)
T ss_pred             eEEee-cCCccchh---hhcccccccc-eEEeccCCc
Confidence            35555 55444332   2333333333 455555543


No 228
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=24.25  E-value=12  Score=20.50  Aligned_cols=13  Identities=31%  Similarity=0.769  Sum_probs=6.0

Q ss_pred             CCCCccCCcchhh
Q psy11318        140 NGKRYHCTQCSKF  152 (263)
Q Consensus       140 ~~~~~~C~~C~~~  152 (263)
                      +.+.|.|..|+..
T Consensus        21 ~~~~w~C~~C~~~   33 (40)
T PF04810_consen   21 GGKTWICNFCGTK   33 (40)
T ss_dssp             TTTEEEETTT--E
T ss_pred             CCCEEECcCCCCc
Confidence            3445666666543


No 229
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=24.14  E-value=33  Score=22.70  Aligned_cols=10  Identities=40%  Similarity=1.082  Sum_probs=6.0

Q ss_pred             Cccccccccc
Q psy11318          2 RYYCNACSKN   11 (263)
Q Consensus         2 ~y~C~~C~~~   11 (263)
                      +|.|+.||+.
T Consensus        35 ky~Cp~Cgk~   44 (90)
T PF01780_consen   35 KYTCPFCGKT   44 (90)
T ss_dssp             -BEESSSSSS
T ss_pred             CCcCCCCCCc
Confidence            5667777664


No 230
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Probab=24.10  E-value=16  Score=30.23  Aligned_cols=11  Identities=27%  Similarity=0.516  Sum_probs=6.0

Q ss_pred             CcccCCcCCCc
Q psy11318         84 IRHPCSECPKT   94 (263)
Q Consensus        84 ~~~~C~~C~~~   94 (263)
                      +...|..|+..
T Consensus       209 RyL~CslC~te  219 (305)
T TIGR01562       209 RYLSCSLCATE  219 (305)
T ss_pred             eEEEcCCCCCc
Confidence            44556666554


No 231
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=24.07  E-value=13  Score=21.05  Aligned_cols=8  Identities=25%  Similarity=0.845  Sum_probs=4.0

Q ss_pred             cccccccc
Q psy11318          5 CNACSKNF   12 (263)
Q Consensus         5 C~~C~~~f   12 (263)
                      ||+||..-
T Consensus         2 CP~Cg~~a    9 (47)
T PF04606_consen    2 CPHCGSKA    9 (47)
T ss_pred             cCCCCCee
Confidence            55555543


No 232
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=24.01  E-value=74  Score=24.36  Aligned_cols=11  Identities=27%  Similarity=0.609  Sum_probs=5.8

Q ss_pred             cccCCcCCCcC
Q psy11318         85 RHPCSECPKTF   95 (263)
Q Consensus        85 ~~~C~~C~~~f   95 (263)
                      .+.|..||..+
T Consensus        30 lvrC~eCG~V~   40 (201)
T COG1326          30 LVRCEECGTVH   40 (201)
T ss_pred             EEEccCCCcEe
Confidence            44555555554


No 233
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=23.86  E-value=54  Score=17.15  Aligned_cols=21  Identities=14%  Similarity=0.505  Sum_probs=11.8

Q ss_pred             ccccccccccCChHHHHHHHHh
Q psy11318          3 YYCNACSKNFSAKDTLNKHMDI   24 (263)
Q Consensus         3 y~C~~C~~~f~~~~~L~~H~~~   24 (263)
                      +.|+.|+..+. ...+..|+..
T Consensus         5 ~~C~nC~R~v~-a~RfA~HLek   25 (33)
T PF08209_consen    5 VECPNCGRPVA-ASRFAPHLEK   25 (33)
T ss_dssp             EE-TTTSSEEE-GGGHHHHHHH
T ss_pred             EECCCCcCCcc-hhhhHHHHHH
Confidence            46777776544 4566666544


No 234
>PRK12860 transcriptional activator FlhC; Provisional
Probab=23.65  E-value=45  Score=25.51  Aligned_cols=47  Identities=15%  Similarity=0.241  Sum_probs=33.5

Q ss_pred             cccCCHHHHHHHHHHhCCCCCccCCcchhhhcChHHHHHHHhhccCCCCCcCCCCc
Q psy11318        123 KDYLTKRDLRRHMKLHFNGKRYHCTQCSKFYIQESDLMEHMAVHSGVRKLTTGPIK  178 (263)
Q Consensus       123 ~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~c~  178 (263)
                      ..|...+.|.+..... -.....|..||-.|....        |.....|+|+.|.
T Consensus       115 Ls~tRAw~LvRf~~s~-~L~l~~C~~Cgg~fv~~~--------~e~~~~f~CplC~  161 (189)
T PRK12860        115 LDLTRAWTLVRFFDAG-MLQLARCCRCGGKFVTHA--------HDLRHNFVCGLCQ  161 (189)
T ss_pred             ecHHHHHHHHHHhcCC-CeeeccCCCCCCCeeccc--------cccCCCCcCCCCC
Confidence            6677788888877654 345578999998887442        2344579999998


No 235
>TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family. This model describes a family of predicted regulatory proteins with a conserved zinc finger/HTH architecture. The amino-terminal region contains a novel domain, featuring two CXXC motifs and occuring in a number of small bacterial proteins as well as in the present family. The carboxyl-terminal region consists of a helix-turn-helix domain, modeled by pfam01381. The predicted function is DNA binding and transcriptional regulation.
Probab=23.52  E-value=32  Score=24.01  Aligned_cols=18  Identities=11%  Similarity=0.449  Sum_probs=9.1

Q ss_pred             cccCCCccccCChhHHHH
Q psy11318         30 YQCEECPKDFSTRKYLTQ   47 (263)
Q Consensus        30 ~~C~~C~~~f~~~~~l~~   47 (263)
                      +.|+.||..+.+......
T Consensus        32 ~~C~~CGe~~~~~e~~~~   49 (127)
T TIGR03830        32 WYCPACGEELLDPEESKR   49 (127)
T ss_pred             eECCCCCCEEEcHHHHHH
Confidence            455555555555544333


No 236
>KOG4727|consensus
Probab=23.50  E-value=40  Score=25.14  Aligned_cols=23  Identities=22%  Similarity=0.421  Sum_probs=21.2

Q ss_pred             ccccCCCccccCChhHHHHHHHH
Q psy11318         29 RYQCEECPKDFSTRKYLTQHQNA   51 (263)
Q Consensus        29 ~~~C~~C~~~f~~~~~l~~H~~~   51 (263)
                      .|-|.+|+-++.+..++..|++.
T Consensus        75 GyyCdVCdcvvKDSinflDHiNg   97 (193)
T KOG4727|consen   75 GYYCDVCDCVVKDSINFLDHING   97 (193)
T ss_pred             ceeeeecceeehhhHHHHHHhcc
Confidence            59999999999999999999864


No 237
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the KOG2636|consensus
Probab=22.99  E-value=67  Score=28.02  Aligned_cols=18  Identities=28%  Similarity=0.285  Sum_probs=9.6

Q ss_pred             cCCCccccCChhHHHHHH
Q psy11318         32 CEECPKDFSTRKYLTQHQ   49 (263)
Q Consensus        32 C~~C~~~f~~~~~l~~H~   49 (263)
                      |+-|++.|.+++....|+
T Consensus       274 ~~ra~rlf~Tk~~~l~~L  291 (497)
T KOG2636|consen  274 HERAQRLFSTKSKSLSHL  291 (497)
T ss_pred             cHHHHhhhhhcCcchhhh
Confidence            444556666665554444


No 239
>PTZ00448 hypothetical protein; Provisional
Probab=22.47  E-value=58  Score=27.68  Aligned_cols=23  Identities=17%  Similarity=0.429  Sum_probs=21.3

Q ss_pred             ccccCCCccccCChhHHHHHHHH
Q psy11318         29 RYQCEECPKDFSTRKYLTQHQNA   51 (263)
Q Consensus        29 ~~~C~~C~~~f~~~~~l~~H~~~   51 (263)
                      .|.|..|+..|.+....+.|+++
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             CccccccccccCCHHHHHHHhhh
Confidence            58899999999999999999987


No 240
>KOG4118|consensus
Probab=22.11  E-value=68  Score=19.67  Aligned_cols=29  Identities=17%  Similarity=0.266  Sum_probs=20.0

Q ss_pred             ccCCcchhhhcChHHHHHHHhhccCCCCC
Q psy11318        144 YHCTQCSKFYIQESDLMEHMAVHSGVRKL  172 (263)
Q Consensus       144 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~  172 (263)
                      |+|.+|-......-.++.|....|...++
T Consensus        39 ~kCtVC~~~mpdpktfkqhfe~kHpk~~~   67 (74)
T KOG4118|consen   39 HKCTVCMVQMPDPKTFKQHFENKHPKEPL   67 (74)
T ss_pred             hhhHhhHhhCCCCchHHHHHhhcCCCCCC
Confidence            67777777777777777777666655543


No 241
>KOG3214|consensus
Probab=22.11  E-value=40  Score=22.62  Aligned_cols=38  Identities=18%  Similarity=0.384  Sum_probs=19.5

Q ss_pred             ccccCCCccccCChhHHHHHHHHhcCCCceecccccccccch
Q psy11318         29 RYQCEECPKDFSTRKYLTQHQNAIHRGIRFQCNKCFRAYKLK   70 (263)
Q Consensus        29 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~   70 (263)
                      .|.|+.|+..-...-.|.    ..+......|.+|+..|.+.
T Consensus        23 ~FnClfcnHek~v~~~~D----k~~~iG~~sC~iC~esFqt~   60 (109)
T KOG3214|consen   23 QFNCLFCNHEKSVSCTLD----KKHNIGKASCRICEESFQTT   60 (109)
T ss_pred             eeccCccccccceeeeeh----hhcCcceeeeeehhhhhccc
Confidence            477887754322222221    12333346777777777654


No 242
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=22.03  E-value=43  Score=16.16  Aligned_cols=9  Identities=22%  Similarity=1.003  Sum_probs=4.8

Q ss_pred             Ccccccccc
Q psy11318          2 RYYCNACSK   10 (263)
Q Consensus         2 ~y~C~~C~~   10 (263)
                      ...|+.||.
T Consensus         2 ~~~Cp~Cg~   10 (26)
T PF13248_consen    2 EMFCPNCGA   10 (26)
T ss_pred             cCCCcccCC
Confidence            345555555


No 243
>PRK10220 hypothetical protein; Provisional
Probab=22.00  E-value=45  Score=22.87  Aligned_cols=30  Identities=20%  Similarity=0.255  Sum_probs=19.3

Q ss_pred             cCCcchhhhcChHHHHHHHhhccCCCCCcCCCCcccccccc
Q psy11318        145 HCTQCSKFYIQESDLMEHMAVHSGVRKLTTGPIKTEQTFGV  185 (263)
Q Consensus       145 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~c~~~~~~~~  185 (263)
                      .|+.|+..|++.           ...-|.|+.|++.++..+
T Consensus         5 ~CP~C~seytY~-----------d~~~~vCpeC~hEW~~~~   34 (111)
T PRK10220          5 HCPKCNSEYTYE-----------DNGMYICPECAHEWNDAE   34 (111)
T ss_pred             cCCCCCCcceEc-----------CCCeEECCcccCcCCccc
Confidence            477777666543           233477888888776654


No 244
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=21.70  E-value=1.5e+02  Score=22.45  Aligned_cols=16  Identities=13%  Similarity=0.345  Sum_probs=8.0

Q ss_pred             CCcccCCcCCCcCCCH
Q psy11318         83 GIRHPCSECPKTFASR   98 (263)
Q Consensus        83 ~~~~~C~~C~~~f~~~   98 (263)
                      ...|.|+.|...+...
T Consensus       111 ~~~y~C~~~~~r~sfd  126 (176)
T COG1675         111 NNYYVCPNCHVKYSFD  126 (176)
T ss_pred             CCceeCCCCCCcccHH
Confidence            3445565555544433


No 245
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=21.28  E-value=12  Score=20.07  Aligned_cols=7  Identities=57%  Similarity=1.763  Sum_probs=3.0

Q ss_pred             CccCCcc
Q psy11318        143 RYHCTQC  149 (263)
Q Consensus       143 ~~~C~~C  149 (263)
                      .|.|..|
T Consensus        29 ryrC~~C   35 (36)
T PF03811_consen   29 RYRCKDC   35 (36)
T ss_pred             eEecCcC
Confidence            3444443


No 246
>PLN02294 cytochrome c oxidase subunit Vb
Probab=21.24  E-value=31  Score=25.76  Aligned_cols=15  Identities=33%  Similarity=0.917  Sum_probs=8.1

Q ss_pred             CCcccccCCCccccC
Q psy11318         26 KGVRYQCEECPKDFS   40 (263)
Q Consensus        26 ~~~~~~C~~C~~~f~   40 (263)
                      .|++..|+.||..|.
T Consensus       138 kGkp~RCpeCG~~fk  152 (174)
T PLN02294        138 KGKSFECPVCTQYFE  152 (174)
T ss_pred             CCCceeCCCCCCEEE
Confidence            344555666665553


No 247
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=21.15  E-value=38  Score=23.17  Aligned_cols=30  Identities=17%  Similarity=0.193  Sum_probs=18.0

Q ss_pred             cCCcchhhhcChHHHHHHHhhccCCCCCcCCCCcccccccc
Q psy11318        145 HCTQCSKFYIQESDLMEHMAVHSGVRKLTTGPIKTEQTFGV  185 (263)
Q Consensus       145 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~c~~~~~~~~  185 (263)
                      .|+.|+..|++.           ...-|.|+.|++.+....
T Consensus         4 ~CP~C~seytY~-----------dg~~~iCpeC~~EW~~~~   33 (109)
T TIGR00686         4 PCPKCNSEYTYH-----------DGTQLICPSCLYEWNENE   33 (109)
T ss_pred             cCCcCCCcceEe-----------cCCeeECccccccccccc
Confidence            466776665543           223477777777776543


No 248
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=21.08  E-value=29  Score=23.38  Aligned_cols=16  Identities=38%  Similarity=0.756  Sum_probs=9.2

Q ss_pred             hCCcccccCCCccccC
Q psy11318         25 HKGVRYQCEECPKDFS   40 (263)
Q Consensus        25 h~~~~~~C~~C~~~f~   40 (263)
                      +.+.++.|+.||..|.
T Consensus        75 ~~g~~~rC~eCG~~fk   90 (97)
T cd00924          75 EKGKPKRCPECGHVFK   90 (97)
T ss_pred             eCCCceeCCCCCcEEE
Confidence            3445666666666554


No 249
>KOG2857|consensus
Probab=20.91  E-value=48  Score=23.86  Aligned_cols=21  Identities=24%  Similarity=0.603  Sum_probs=11.1

Q ss_pred             CccccccccccCChHHHHHHH
Q psy11318          2 RYYCNACSKNFSAKDTLNKHM   22 (263)
Q Consensus         2 ~y~C~~C~~~f~~~~~L~~H~   22 (263)
                      +|+|+.|..-|-+...+++|.
T Consensus        17 KYKCpkC~vPYCSl~CfKiHk   37 (157)
T KOG2857|consen   17 KYKCPKCSVPYCSLPCFKIHK   37 (157)
T ss_pred             hccCCCCCCccccchhhhhcc
Confidence            455555555555555555554


No 250
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=20.55  E-value=60  Score=18.01  Aligned_cols=16  Identities=19%  Similarity=0.644  Sum_probs=10.9

Q ss_pred             cccccccccCChHHHH
Q psy11318          4 YCNACSKNFSAKDTLN   19 (263)
Q Consensus         4 ~C~~C~~~f~~~~~L~   19 (263)
                      .|+.||..|..+....
T Consensus        10 ~C~~C~rpf~WRKKW~   25 (42)
T PF10013_consen   10 ICPVCGRPFTWRKKWA   25 (42)
T ss_pred             cCcccCCcchHHHHHH
Confidence            4777777777666554


No 251
>PF05495 zf-CHY:  CHY zinc finger;  InterPro: IPR008913 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Pirh2 is an eukaryotic ubiquitin protein ligase, which has been shown to promote p53 degradation in mammals. Pirh2 physically interacts with p53 and promotes ubiquitination of p53 independently of MDM2. Like MDM2, Pirh2 is thought to participate in an autoregulatory feedback loop that controls p53 function. Pirh2 proteins contain three distinct zinc fingers, the CHY-type, the CTCHY-type which is C-terminal to the CHY-type zinc finger and a RING finger. The CHY-type zinc finger has no currently known function []. As well as Pirh2, the CHY-type zinc finger is also found in the following proteins:   Yeast helper of Tim protein 13. Hot13 may have a role in the assembly and recycling of the small Tims, a complex of the mitochondrial intermembrane space that participates in the TIM22 import pathway for assembly of the inner membrane [] Several plant hypothetical proteins that also contain haemerythrin cation binding domains Several protozoan hypothetical proteins that also contain a Myb domain   The solution structure of this zinc finger has been solved and binds 3 zinc atoms as shown in the following schematic representation:   ++---------+-----+ || | | CXHYxxxxxxxxxCCxxxxxCxxCHxxxxxHxxxxxxxxxxxCxxCxxxxxxxxxCxxC | | | | | | | | +-+-----------------+--+ +--+---------+--+ 'C': conserved cysteine involved in the binding of one zinc atom. 'H': conserved histidine involved in the binding of one zinc atom.  More information about these proteins can be found at Protein of the Month: Zinc Fingers []; GO: 0008270 zinc ion binding; PDB: 2DKT_A 2K2C_A.
Probab=20.44  E-value=8.8  Score=24.09  Aligned_cols=8  Identities=38%  Similarity=0.891  Sum_probs=2.7

Q ss_pred             eecccccc
Q psy11318         58 FQCNKCFR   65 (263)
Q Consensus        58 ~~C~~C~~   65 (263)
                      ..|..|+.
T Consensus        42 v~Cg~C~~   49 (71)
T PF05495_consen   42 VICGKCRT   49 (71)
T ss_dssp             EEETTT--
T ss_pred             eECCCCCC
Confidence            44444443


No 252
>KOG3990|consensus
Probab=20.05  E-value=1.5e+02  Score=23.81  Aligned_cols=37  Identities=19%  Similarity=0.476  Sum_probs=18.2

Q ss_pred             eecccccccccchHHHH-----HHHHHhcCCCcccCCcCCCc
Q psy11318         58 FQCNKCFRAYKLKKDLL-----AHTMLEHFGIRHPCSECPKT   94 (263)
Q Consensus        58 ~~C~~C~~~f~~~~~l~-----~H~~~~~~~~~~~C~~C~~~   94 (263)
                      -+|..|..-|-....-.     --......+.|+.|..|...
T Consensus        38 gKctyCrse~q~askt~t~CkkCah~~~kfG~P~pC~~Ckii   79 (305)
T KOG3990|consen   38 GKCTYCRSEFQQASKTNTICKKCAHNVRKFGTPKPCQYCKII   79 (305)
T ss_pred             cccchhHHHhhhhhhhhhHHHHHHHHHHhcCCCCcchhhhhh
Confidence            46777766554322111     11113334567777777654


Done!