Diaphorina citri psyllid: psy11328


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410
MFAQDLSSKLRSLKPTSVIFYNADVAAIRQVEVYQCAQSEVKVKVFFMQYGESVEEQAYLSDLRREKKAFEYLIQEKTNMAVPTEQDGVSTEPEESCGRVIVDMREFRSELPVLLHKRGLYIEPVTISVGDYILSPDICVERKSISDLIGSLQSGRLYTQVQQMCRHYAKPLLLIEFDHNKPFELQGNYYLSRDIAAKFLIEFDHNKPFELQGNYYLSRDIAAKSSDITAKLQLLTLHFPKLRLIWSSGPYNTAQLFFELKQGRDEPSAEVASSIGQTPNEDYTDRYNAAIEDFISKLPGMAEWSRARTLNLEVLGLNPGQGGNFLTELFRASSFFLLLFRIKPAPGRESNPRPRVTSKNKAAVLNRGSSLPALCKLSEQELCSLVENTTLGNALYKALHTRPEVSSGSL
cccHHHHHHHHHHcccEEEEEEccccEEEEEHHHHHcccccccEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHcccEEEEEECccCEEEECccEEEEEccHHHHHHHHccccHHHHHHHHHHHcccEEEEEEEcccccccccccccccHHHHHHHHHHcccccccccccccccccHHccccHHHHHHHHHHHHccccCEEEEcccHHHHHHHHHHHHcccccccHHHHHHcccccccccHHHHcHHHHHHHHccccccHHHHHHHHcHHHHHccccccHHHHHHHHHHcHHHHHHHHccccccccccccccccccHHHHHHccccccHHHHHHcHHHHHHHHccccHHHHHHHHHccccccccccc
****DLSSKLRSLKPTSVIFYNADVAAIRQVEVYQCAQSEVKVKVFFMQYGESVEEQAYLSDLRREKKAFEYLIQEK*******************CGRVIVDMREFRSELPVLLHKRGLYIEPVTISVGDYILSPDICVERKSISDLIGSLQSGRLYTQVQQMCRHYAKPLLLIEFDHNKPFELQGNYYLSRDIAAKFLIEFDHNKPFELQGNYYL******KSSDITAKLQLLTLHFPKLRLIWSSGPYNTAQLFFELKQ********************YTDRYNAAIEDFISKLPGMAEWSRARTLNLEVLGLNPGQGGNFLTELFRASSFFLLLFRIKP***************************PALCKLSEQELCSLVENTTLGNALYKALH**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFAQDLSSKLRSLKPTSVIFYNADVAAIRQVEVYQCAQSEVKVKVFFMQYGESVEEQAYLSDLRREKKAFEYLIQEKTNMAVPTEQDGVSTEPEESCGRVIVDMREFRSELPVLLHKRGLYIEPVTISVGDYILSPDICVERKSISDLIGSLQSGRLYTQVQQMCRHYAKPLLLIEFDHNKPFELQGNYYLSRDIAAKFLIEFDHNKPFELQGNYYLSRDIAAKSSDITAKLQLLTLHFPKLRLIWSSGPYNTAQLFFELKQGRDEPSAEVASSIGQTPNEDYTDRYNAAIEDFISKLPGMAEWSRARTLNLEVLGLNPGQGGNFLTELFRASSFFLLLFRIKPAPGRESNPRPRVTSKNKAAVLNRGSSLPALCKLSEQELCSLVENTTLGNALYKALHTRPEVSSGSL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0005488 [MF]bindingprobableGO:0003674

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2BGW, chain A
Confidence level:very confident
Coverage over the Query: 95-196,225-300,356-403
View the alignment between query and template
View the model in PyMOL
Template: 2ZIX, chain A
Confidence level:very confident
Coverage over the Query: 94-196,225-279,303-311,325-403
View the alignment between query and template
View the model in PyMOL
Template: 2ZIU, chain B
Confidence level:probable
Coverage over the Query: 96-180,224-262
View the alignment between query and template
View the model in PyMOL
Template: 4A2Q, chain A
Confidence level:probable
Coverage over the Query: 12-78
View the alignment between query and template
View the model in PyMOL