Query         psy11331
Match_columns 780
No_of_seqs    95 out of 97
Neff          1.8 
Searched_HMMs 46136
Date          Fri Aug 16 15:39:09 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy11331.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/11331hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF05281 Secretogranin_V:  Neur 100.0 2.6E-64 5.5E-69  486.9   9.2  158  220-396     1-163 (208)
  2 PF05281 Secretogranin_V:  Neur 100.0 1.1E-59 2.4E-64  454.7   7.9  127  647-773    58-206 (208)
  3 KOG4187|consensus              100.0 1.6E-46 3.5E-51  362.2   4.6  130  646-776    67-227 (228)
  4 KOG4187|consensus              100.0 2.3E-44 4.9E-49  347.4   7.6  146  250-409    37-195 (228)
  5 PF09064 Tme5_EGF_like:  Thromb  45.1      14  0.0003   29.0   1.5   20  326-345     7-30  (34)
  6 PF14625 Lustrin_cystein:  Lust  35.6      28  0.0006   26.4   1.9   20  678-697    11-30  (45)
  7 PF14625 Lustrin_cystein:  Lust  35.3      23 0.00051   26.8   1.5   19  324-342    12-30  (45)
  8 KOG4389|consensus               24.3      29 0.00063   40.0   0.5   43  587-629   135-181 (601)
  9 smart00289 WR1 Worm-specific r  20.6      62  0.0013   23.4   1.4   18  325-342    10-27  (38)
 10 KOG4211|consensus               14.8      73  0.0016   36.5   0.9   23  443-465   110-132 (510)

No 1  
>PF05281 Secretogranin_V:  Neuroendocrine protein 7B2 precursor (Secretogranin V);  InterPro: IPR007945 Mature peptide hormones and neuropeptides are typically synthesised from much larger precursors and require several post-translational processing steps--including proteolytic cleavage--for the formation of the bioactive species. The subtilisin-related proteolytic enzymes that accomplish neuroendocrine-specific cleavages are known as prohormone convertases 1 and 2 (PC1 and PC2), which belong to MEROPS peptidase family S8B. The cell biology of these proteases within the regulated secretory pathway of neuroendocrine cells is complex, and they are themselves initially synthesised as inactive precursor molecules. ProPC1 propeptide cleavage occurs rapidly in the endoplasmic reticulum, yet its major site of action on prohormones takes place later in the secretory pathway. PC1 undergoes an interesting carboxyl terminal processing event whose function appears to be to activate the enzyme. ProPC2, on the other hand, exhibits comparatively long initial folding times and exits the endoplasmic reticulum without propeptide cleavage, in association with the neuroendocrine-specific protein 7B2. Once the proPC2/7B2 complex arrives at the trans-Golgi network, 7B2 is internally cleaved into two domains, the 21kDa fragment and a carboxy-terminal 31 residue peptide. PC2 propeptide removal occurs in the maturing secretory granule, most likely through autocatalysis, and 7B2 association does not appear to be directly required for this cleavage event. However, if proPC2 has not encountered 7B2 intracellularly, it cannot generate a catalytically active mature species. The molecular mechanism behind the intriguing intracellular association of 7B2 and proPC2 is still unknown, but may involve conformational rearrangement or stabilisation of a proPC2 conformer mediated by a 36-residue internal segment of 21kDa 7B2. This family represents, 7B2 (secretogranin V), which is the molecular escort protein for PC2. 7B2 is a bifunctional protein with an N-terminal activation domain and a C-terminal inhibitory domain (MEROPS inhibitor family I21, clan I-) separated by a furin cleavage site []. Although 7B2 represents a potent inhibitor of PC2, there is an absolute requirement of 7B2 for the activation of PC2, which is synthesised as a zymogen. Both the full length, 27 kDa, and the C-terminal peptide (CT domain) derived from intramolecular cleavage of 7B2 are potent inhibitors of PC2. Studies have shown that the active peptide in the CT domain to be LLRVHK, active in the nanomolar range not only against PC2 but also PC1 [, ]. Knock-out studies have shown that the PC2 nulls are not phenotypically equivalent to the 7B2 nulls, which suggests that 7B2 may have other activities in addition to being the activator of PC2 [].  7B2 exhibits both structural and functional homology to proSAAS (IPR010832 from INTERPRO), which is the PC1 binding protein. The CT domain of proSAAS contains the same inhibitor hexapeptide as 7B2, consequently both 7B2 and proSAAS are two members of a homologous family of prohormone convertase inhibitor proteins. ; GO: 0007218 neuropeptide signaling pathway, 0030141 stored secretory granule
Probab=100.00  E-value=2.6e-64  Score=486.91  Aligned_cols=158  Identities=56%  Similarity=0.969  Sum_probs=142.4

Q ss_pred             HHHHHHHhhccccc---ccccCCCCCccccCCCcccccccccccCCCCCCCCCCCCCCCCCCCCcccccccccCCCccce
Q psy11331        220 LREVVDKMGRDLAD---AYFDLPDLDSTNQNGRATDVDKDFDAVNPQTGFDYPESNNSPGHSPSLRDQEYLQQSSLWGHQ  296 (780)
Q Consensus       220 LrelvnrMgkDl~d---~YlD~~~~dr~~~~~s~a~v~kdl~~v~eql~~dy~rl~~~~Np~PSlRDqEylqHSsLwGhQ  296 (780)
                      ++|||+||++||+.   +|+.     ++.+.+|+.++.++++++++             +++||+||+|||+|++|||||
T Consensus         1 ~~~l~~~m~~~l~~a~~~~~~-----~~~D~~s~~~~~~~~~~~~e-------------~~~~s~Rd~E~l~hssLwG~q   62 (208)
T PF05281_consen    1 MTELLNRMGNDLAAAADSYLP-----RNVDRVSESEYARLLDGVME-------------NPGPSLRDQEYLQHSSLWGHQ   62 (208)
T ss_pred             ChHHHHHHHhhhhhhhhhcCc-----cccchhhhHHHHHhhccccc-------------cCCCCccccccccccccCCce
Confidence            58999999999988   4444     56777888888999988775             689999999999999999999


Q ss_pred             eecCCCCCCCcccCCCCCCCccccccCCCCCCCCCCCCCCCCCCccCCCCcccCccchHHhhHHHHhcccCCCCcccccc
Q psy11331        297 FVQGGAGEGKQLLKPEGSIKNQNQVKTDATLPAYCNPPNPCPVGYTAEDGCLEDFENSAEYSRVYQAAQECMCDAEHMFA  376 (780)
Q Consensus       297 ~IsGGAGEG~Q~L~P~G~i~N~~~vKTD~~LPAYCnPPNPCPvGYTaeDgCledFENTAeFSReyQa~QdCmCDtEHMF~  376 (780)
                      ||+||||||.|+|+|+|+|+|+++||||++||||||||||||+|||++|||+++|||||+|||+||++||||||+||||+
T Consensus        63 ~isGGagEG~q~L~~~~~i~n~~~~ktd~~lPaYCnPPNPCPvGyt~~dgCle~fEnTAeFSReyQa~QdC~CD~EHMf~  142 (208)
T PF05281_consen   63 YISGGAGEGPQHLGPEGNIPNIKIVKTDNNLPAYCNPPNPCPVGYTAEDGCLENFENTAEFSREYQAAQDCMCDTEHMFD  142 (208)
T ss_pred             eeeCCCCccchhcCccCCcCcccccccccCCCCCCCCCCCCCCCcccccCcccCCccHHHhhHHHHhcCccCCCcccccC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCcchHH--HhhhHHHHHHH
Q psy11331        377 SVPIPYLLK--MELKLGLLLLL  396 (780)
Q Consensus       377 C~P~~s~~~--~~~~l~~~~~~  396 (780)
                      | |......  ++..|+.+|..
T Consensus       143 C-~~~~~~d~~~~~~l~~~~~~  163 (208)
T PF05281_consen  143 C-PSQENSDSGNNSSLEKFMHE  163 (208)
T ss_pred             C-ccccccchhhhhHHHHHhhh
Confidence            9 7544422  67777776544


No 2  
>PF05281 Secretogranin_V:  Neuroendocrine protein 7B2 precursor (Secretogranin V);  InterPro: IPR007945 Mature peptide hormones and neuropeptides are typically synthesised from much larger precursors and require several post-translational processing steps--including proteolytic cleavage--for the formation of the bioactive species. The subtilisin-related proteolytic enzymes that accomplish neuroendocrine-specific cleavages are known as prohormone convertases 1 and 2 (PC1 and PC2), which belong to MEROPS peptidase family S8B. The cell biology of these proteases within the regulated secretory pathway of neuroendocrine cells is complex, and they are themselves initially synthesised as inactive precursor molecules. ProPC1 propeptide cleavage occurs rapidly in the endoplasmic reticulum, yet its major site of action on prohormones takes place later in the secretory pathway. PC1 undergoes an interesting carboxyl terminal processing event whose function appears to be to activate the enzyme. ProPC2, on the other hand, exhibits comparatively long initial folding times and exits the endoplasmic reticulum without propeptide cleavage, in association with the neuroendocrine-specific protein 7B2. Once the proPC2/7B2 complex arrives at the trans-Golgi network, 7B2 is internally cleaved into two domains, the 21kDa fragment and a carboxy-terminal 31 residue peptide. PC2 propeptide removal occurs in the maturing secretory granule, most likely through autocatalysis, and 7B2 association does not appear to be directly required for this cleavage event. However, if proPC2 has not encountered 7B2 intracellularly, it cannot generate a catalytically active mature species. The molecular mechanism behind the intriguing intracellular association of 7B2 and proPC2 is still unknown, but may involve conformational rearrangement or stabilisation of a proPC2 conformer mediated by a 36-residue internal segment of 21kDa 7B2. This family represents, 7B2 (secretogranin V), which is the molecular escort protein for PC2. 7B2 is a bifunctional protein with an N-terminal activation domain and a C-terminal inhibitory domain (MEROPS inhibitor family I21, clan I-) separated by a furin cleavage site []. Although 7B2 represents a potent inhibitor of PC2, there is an absolute requirement of 7B2 for the activation of PC2, which is synthesised as a zymogen. Both the full length, 27 kDa, and the C-terminal peptide (CT domain) derived from intramolecular cleavage of 7B2 are potent inhibitors of PC2. Studies have shown that the active peptide in the CT domain to be LLRVHK, active in the nanomolar range not only against PC2 but also PC1 [, ]. Knock-out studies have shown that the PC2 nulls are not phenotypically equivalent to the 7B2 nulls, which suggests that 7B2 may have other activities in addition to being the activator of PC2 [].  7B2 exhibits both structural and functional homology to proSAAS (IPR010832 from INTERPRO), which is the PC1 binding protein. The CT domain of proSAAS contains the same inhibitor hexapeptide as 7B2, consequently both 7B2 and proSAAS are two members of a homologous family of prohormone convertase inhibitor proteins. ; GO: 0007218 neuropeptide signaling pathway, 0030141 stored secretory granule
Probab=100.00  E-value=1.1e-59  Score=454.74  Aligned_cols=127  Identities=62%  Similarity=1.080  Sum_probs=114.2

Q ss_pred             hcccccccCCCcccccccCCCCCCCccccccCCCCCCCCCCCCCCCCCCCCCCCCcccCCcchHHHHHHHHHhccCCCCC
Q psy11331        647 FWFLMEPSGGAGEGKQLLKPEGSIKNQNQVKTDATLPAYCNPPNPCPVGYTAEDGCLEDFENSAEYSRVYQAAQECMCDA  726 (780)
Q Consensus       647 lWghqyvsGGAGEG~Q~LgP~GnIpN~~~vKTdd~LPAYCNPPNPCPvGYTaeDGCLEnFENTAEFSReYQa~QdCmCD~  726 (780)
                      |||||||+||||||.|+|+|+|+|||+++|||+++||||||||||||+|||++||||++|||||+|||+||++|+|+||+
T Consensus        58 LwG~q~isGGagEG~q~L~~~~~i~n~~~~ktd~~lPaYCnPPNPCPvGyt~~dgCle~fEnTAeFSReyQa~QdC~CD~  137 (208)
T PF05281_consen   58 LWGHQYISGGAGEGPQHLGPEGNIPNIKIVKTDNNLPAYCNPPNPCPVGYTAEDGCLENFENTAEFSREYQAAQDCMCDT  137 (208)
T ss_pred             cCCceeeeCCCCccchhcCccCCcCcccccccccCCCCCCCCCCCCCCCcccccCcccCCccHHHhhHHHHhcCccCCCc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccCCCCCCC----------------CCCCCCccccC------CCCCCCCCCCCCCCccccccccCCCc
Q psy11331        727 EHMFACPQEP----------------PQHNPNEIEYS------PFLNPDKNPYLQGDMLPIAAKKGNNV  773 (780)
Q Consensus       727 EHMF~Cp~~s----------------~~~Nkn~l~~~------p~~krsvNPYLQGErLpIAAKKG~~V  773 (780)
                      ||||+||..+                ++|+++.+.+.      ...++++||||||||||||||||+++
T Consensus       138 EHMf~C~~~~~~d~~~~~~l~~~~~~~~~~k~lvaKK~~~~~~~~~~~~~NPyLqGe~L~iaAKK~~~~  206 (208)
T PF05281_consen  138 EHMFDCPSQENSDSGNNSSLEKFMHEGDKHKNLVAKKFHEKKSSRQSRHVNPYLQGERLPIAAKKGGRL  206 (208)
T ss_pred             ccccCCccccccchhhhhHHHHHhhhccchhhHHHHHhhccccccccccCCccccCCccchhcccCCCC
Confidence            9999999432                34455555433      22346789999999999999999765


No 3  
>KOG4187|consensus
Probab=100.00  E-value=1.6e-46  Score=362.24  Aligned_cols=130  Identities=49%  Similarity=0.849  Sum_probs=108.8

Q ss_pred             hhcccccccCCCcccccccCCCCCCCccc--c-----ccCCCCCCCCCCCCCCCCCCCCCCCCcccCCcchHHHHHHHHH
Q psy11331        646 WFWFLMEPSGGAGEGKQLLKPEGSIKNQN--Q-----VKTDATLPAYCNPPNPCPVGYTAEDGCLEDFENSAEYSRVYQA  718 (780)
Q Consensus       646 ~lWghqyvsGGAGEG~Q~LgP~GnIpN~~--~-----vKTdd~LPAYCNPPNPCPvGYTaeDGCLEnFENTAEFSReYQa  718 (780)
                      +..|-|-|+||||||.|+|.|++|+||++  +     +|.|+.||||||||||||+|||.++|||+||||||||||+||+
T Consensus        67 ~s~g~~~i~ggageg~q~ll~~dnf~~~~a~e~~~~ivK~d~~lpaYc~PPNPCPvG~t~eqGCle~fentAeFSRefQa  146 (228)
T KOG4187|consen   67 NSVGPQSIEGGAGEGLQHLLPFDNFPNIVAEETGDNIVKDDSELPAYCDPPNPCPVGKTDEQGCLENFENTAEFSREFQA  146 (228)
T ss_pred             cccccccccccccccccccCCccchhhhhhhhcCCCccccccCCcCcCCCCCCCCCCcccccchhhcCccHHHHhHHhhh
Confidence            45688899999999999999999999998  3     7788899999999999999999999999999999999999999


Q ss_pred             hccCCCCCcccCCCCCCCC-----CCC---------CCcc----ccCCC------CCCCCCCCCCCCccccccccCCCcc
Q psy11331        719 AQECMCDAEHMFACPQEPP-----QHN---------PNEI----EYSPF------LNPDKNPYLQGDMLPIAAKKGNNVP  774 (780)
Q Consensus       719 ~QdCmCD~EHMF~Cp~~s~-----~~N---------kn~l----~~~p~------~krsvNPYLQGErLpIAAKKG~~Vp  774 (780)
                      +|||+||+||||+|..+.+     +|+         .|++    .|+.|      .++++||||||||||+|+||. .+|
T Consensus       147 ~QdCtCDnEHmFdc~e~~~~dvSa~~qkil~ENslnvNslAKKagy~~m~d~pRrkr~~vNPyLQG~rL~~~~kK~-g~~  225 (228)
T KOG4187|consen  147 HQDCTCDNEHMFDCEEDYPGDVSAKWQKILLENSLNVNSLAKKAGYEKMKDGPRRKRRSVNPYLQGQRLDNVVKKK-GVP  225 (228)
T ss_pred             hcccccchhhccCchhcccchhHHHHHHHHHHcccchhhHHHhcCCccCCCCccccccccCchhcCCcchHHHHhc-CCC
Confidence            9999999999999995432     332         2232    23322      346899999999999777772 355


Q ss_pred             cc
Q psy11331        775 KI  776 (780)
Q Consensus       775 ~~  776 (780)
                      +|
T Consensus       226 ~f  227 (228)
T KOG4187|consen  226 HF  227 (228)
T ss_pred             CC
Confidence            55


No 4  
>KOG4187|consensus
Probab=100.00  E-value=2.3e-44  Score=347.43  Aligned_cols=146  Identities=42%  Similarity=0.684  Sum_probs=118.1

Q ss_pred             cccccccccccCCCCCCCCCCCCCCCCCCCCccccccccc--CCCccceeecCCCCCCCcccCCCCCCCccc--c-----
Q psy11331        250 ATDVDKDFDAVNPQTGFDYPESNNSPGHSPSLRDQEYLQQ--SSLWGHQFVQGGAGEGKQLLKPEGSIKNQN--Q-----  320 (780)
Q Consensus       250 ~a~v~kdl~~v~eql~~dy~rl~~~~Np~PSlRDqEylqH--SsLwGhQ~IsGGAGEG~Q~L~P~G~i~N~~--~-----  320 (780)
                      ++++++++++.||+++.-.+|             .||+.|  .+.+|.|+|+||||||.|+|.|+++++|++  +     
T Consensus        37 ~~di~~~~~~g~~d~~dl~sR-------------~ey~~l~d~~s~g~~~i~ggageg~q~ll~~dnf~~~~a~e~~~~i  103 (228)
T KOG4187|consen   37 EADIQRLLHGGMEDLGDLRSR-------------VEYPALQDMNSVGPQSIEGGAGEGLQHLLPFDNFPNIVAEETGDNI  103 (228)
T ss_pred             hhhhhhHhhhhhhhhhhhhhh-------------ccccccccccccccccccccccccccccCCccchhhhhhhhcCCCc
Confidence            345578889999998777666             677655  788999999999999999999999999998  3     


Q ss_pred             ccCCCCCCCCCCCCCCCCCCccCCCCcccCccchHHhhHHHHhcccCCCCccccccCCCCcchHHHhhhHHHHH-HHHhh
Q psy11331        321 VKTDATLPAYCNPPNPCPVGYTAEDGCLEDFENSAEYSRVYQAAQECMCDAEHMFASVPIPYLLKMELKLGLLL-LLCLH  399 (780)
Q Consensus       321 vKTD~~LPAYCnPPNPCPvGYTaeDgCledFENTAeFSReyQa~QdCmCDtEHMF~C~P~~s~~~~~~~l~~~~-~~~~h  399 (780)
                      ||.|+.||||||||||||+|||.|+|||++|||||||||+||++|||+||+||||+| .....-..-.++...+ --.+|
T Consensus       104 vK~d~~lpaYc~PPNPCPvG~t~eqGCle~fentAeFSRefQa~QdCtCDnEHmFdc-~e~~~~dvSa~~qkil~ENsln  182 (228)
T KOG4187|consen  104 VKDDSELPAYCDPPNPCPVGKTDEQGCLENFENTAEFSREFQAHQDCTCDNEHMFDC-EEDYPGDVSAKWQKILLENSLN  182 (228)
T ss_pred             cccccCCcCcCCCCCCCCCCcccccchhhcCccHHHHhHHhhhhcccccchhhccCc-hhcccchhHHHHHHHHHHcccc
Confidence            899999999999999999999999999999999999999999999999999999999 4333322211222111 12334


Q ss_pred             ---hcCCCCCCCC
Q psy11331        400 ---TALPFGFDDI  409 (780)
Q Consensus       400 ---t~~~f~~~~~  409 (780)
                         -|||||.++.
T Consensus       183 vNslAKKagy~~m  195 (228)
T KOG4187|consen  183 VNSLAKKAGYEKM  195 (228)
T ss_pred             hhhHHHhcCCccC
Confidence               2488887765


No 5  
>PF09064 Tme5_EGF_like:  Thrombomodulin like fifth domain, EGF-like;  InterPro: IPR015149 This domain adopts a fold similar to other EGF domains, with a flat major and a twisted minor beta sheet. Disulphide pairing, however, is not of the usual 1-3, 2-4, 5-6 type; rather 1-2, 3-4, 5-6 pairing is found. Its extended major sheet (strands beta-2 and beta-3 and the connecting loop) projects into thrombin's active site groove. This domain is required for interaction of thrombomodulin with thrombin, and subsequent activation of protein-C []. ; GO: 0004888 transmembrane signaling receptor activity, 0016021 integral to membrane
Probab=45.15  E-value=14  Score=29.03  Aligned_cols=20  Identities=45%  Similarity=1.160  Sum_probs=16.1

Q ss_pred             CCCCCCCCCCC----CCCCccCCC
Q psy11331        326 TLPAYCNPPNP----CPVGYTAED  345 (780)
Q Consensus       326 ~LPAYCnPPNP----CPvGYTaeD  345 (780)
                      .=||-|||.+|    ||.||--+.
T Consensus         7 ~CpA~CDpn~~~~C~CPeGyIlde   30 (34)
T PF09064_consen    7 ECPADCDPNSPGQCFCPEGYILDE   30 (34)
T ss_pred             cCCCccCCCCCCceeCCCceEecC
Confidence            45899999776    999998754


No 6  
>PF14625 Lustrin_cystein:  Lustrin, cysteine-rich repeated domain
Probab=35.55  E-value=28  Score=26.43  Aligned_cols=20  Identities=40%  Similarity=1.012  Sum_probs=17.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCC
Q psy11331        678 TDATLPAYCNPPNPCPVGYT  697 (780)
Q Consensus       678 Tdd~LPAYCNPPNPCPvGYT  697 (780)
                      ..+.-|..|.+-++||.||+
T Consensus        11 ~~~~~~~~C~~~~~CP~~y~   30 (45)
T PF14625_consen   11 DSNGQPVSCSPDNSCPSGYS   30 (45)
T ss_pred             cCCCCeeECcCCCCCCCcCE
Confidence            35667899999999999997


No 7  
>PF14625 Lustrin_cystein:  Lustrin, cysteine-rich repeated domain
Probab=35.31  E-value=23  Score=26.82  Aligned_cols=19  Identities=42%  Similarity=1.066  Sum_probs=16.5

Q ss_pred             CCCCCCCCCCCCCCCCCcc
Q psy11331        324 DATLPAYCNPPNPCPVGYT  342 (780)
Q Consensus       324 D~~LPAYCnPPNPCPvGYT  342 (780)
                      .+.-|..|.+-++||.||+
T Consensus        12 ~~~~~~~C~~~~~CP~~y~   30 (45)
T PF14625_consen   12 SNGQPVSCSPDNSCPSGYS   30 (45)
T ss_pred             CCCCeeECcCCCCCCCcCE
Confidence            4567999999999999996


No 8  
>KOG4389|consensus
Probab=24.31  E-value=29  Score=40.03  Aligned_cols=43  Identities=33%  Similarity=0.515  Sum_probs=39.0

Q ss_pred             chhhhhhhchhhhhhheeeeEE----EEEeeeeeeEeeeeecccccc
Q psy11331        587 DTVRIFMREGIFQTVVKTFNVY----LTIKCREILVSFQYQVGSVGH  629 (780)
Q Consensus       587 ~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~~~~~~~  629 (780)
                      -||-|+.--|=|.+=--+..||    |+.+-+-|+||++|.||..|.
T Consensus       135 ~tVlVWiyGGGF~sGt~SLdvYdGk~la~~envIvVs~NYRvG~FGF  181 (601)
T KOG4389|consen  135 LTVLVWIYGGGFYSGTPSLDVYDGKFLAAVENVIVVSMNYRVGAFGF  181 (601)
T ss_pred             ceEEEEEEcCccccCCcceeeeccceeeeeccEEEEEeeeeeccceE
Confidence            4688899999999999999998    889999999999999999875


No 9  
>smart00289 WR1 Worm-specific repeat type 1. Worm-specific repeat type 1. Cysteine-rich domain apparently unique (so far) to C. elegans. Often appears with KU domains. About 3 dozen worm proteins contain this domain.
Probab=20.58  E-value=62  Score=23.40  Aligned_cols=18  Identities=39%  Similarity=1.056  Sum_probs=15.3

Q ss_pred             CCCCCCCCCCCCCCCCcc
Q psy11331        325 ATLPAYCNPPNPCPVGYT  342 (780)
Q Consensus       325 ~~LPAYCnPPNPCPvGYT  342 (780)
                      ..-|.-|++.++||.||+
T Consensus        10 ~~~~~~C~~~~~CP~g~~   27 (38)
T smart00289       10 GGSPVRCSPNGSCPSGYS   27 (38)
T ss_pred             CCCCeECCCCCCCCCCCE
Confidence            356788999999999996


No 10 
>KOG4211|consensus
Probab=14.83  E-value=73  Score=36.52  Aligned_cols=23  Identities=30%  Similarity=0.524  Sum_probs=21.5

Q ss_pred             cccchhhhhhhhhhhcccceeee
Q psy11331        443 KLPFSKTRRQLIPMFKKFAEVTR  465 (780)
Q Consensus       443 ~lp~s~~r~~~~~~~~~~~~v~~  465 (780)
                      -|||||+.+||..+|++...|+.
T Consensus       110 GLPfscte~dI~~FFaGL~Iv~~  132 (510)
T KOG4211|consen  110 GLPFSCTEEDIVEFFAGLEIVPD  132 (510)
T ss_pred             CCCccCcHHHHHHHhcCCccccc
Confidence            48999999999999999998887


Done!