Query         psy11336
Match_columns 194
No_of_seqs    69 out of 71
Neff          3.0 
Searched_HMMs 46136
Date          Fri Aug 16 15:46:19 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy11336.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/11336hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3107|consensus              100.0 9.3E-69   2E-73  490.3  10.7  163   26-193   169-331 (468)
  2 TIGR01658 EYA-cons_domain eyes 100.0 1.4E-59   3E-64  410.6   9.2  115   54-186     1-117 (274)
  3 PLN02779 haloacid dehalogenase  75.9    0.87 1.9E-05   39.4   0.0   28   56-83     41-72  (286)
  4 COG0546 Gph Predicted phosphat  72.4     2.1 4.6E-05   35.2   1.4   48   55-102     4-58  (220)
  5 PRK13707 conjugal transfer pil  71.1     2.3   5E-05   32.9   1.3   27   53-79     17-43  (101)
  6 TIGR02250 FCP1_euk FCP1-like p  70.9     2.2 4.7E-05   34.4   1.2   19   54-72      5-23  (156)
  7 TIGR01681 HAD-SF-IIIC HAD-supe  67.7     2.5 5.4E-05   32.3   0.9   12   56-67      1-12  (128)
  8 PF07178 TraL:  TraL protein;    65.5       3 6.6E-05   31.3   0.9   26   53-78     11-36  (95)
  9 TIGR02137 HSK-PSP phosphoserin  64.4     3.5 7.6E-05   34.3   1.2   27   55-84      1-27  (203)
 10 PHA02597 30.2 hypothetical pro  63.8     7.4 0.00016   30.7   2.9   29   56-85      3-31  (197)
 11 TIGR01491 HAD-SF-IB-PSPlk HAD-  62.5     3.8 8.2E-05   31.8   1.0   16   55-70      4-19  (201)
 12 TIGR01686 FkbH FkbH-like domai  60.3     4.4 9.5E-05   35.5   1.1   14   54-67      2-15  (320)
 13 PRK10725 fructose-1-P/6-phosph  56.1     5.3 0.00011   30.9   0.8   29   56-84      6-37  (188)
 14 PF03031 NIF:  NLI interacting   56.0     4.4 9.6E-05   31.2   0.4   14   57-70      2-15  (159)
 15 PF05152 DUF705:  Protein of un  55.4     5.8 0.00013   36.6   1.1   15   53-67    120-134 (297)
 16 TIGR02253 CTE7 HAD superfamily  55.0       6 0.00013   31.4   1.0   20   56-75      3-22  (221)
 17 TIGR01549 HAD-SF-IA-v1 haloaci  51.7     5.8 0.00012   29.8   0.4   31   57-87      1-34  (154)
 18 TIGR02009 PGMB-YQAB-SF beta-ph  51.6     6.7 0.00015   30.1   0.8   30   56-85      2-34  (185)
 19 PRK13288 pyrophosphatase PpaX;  51.0     7.2 0.00016   31.2   0.9   20   56-75      4-23  (214)
 20 PRK14988 GMP/IMP nucleotidase;  50.1     7.3 0.00016   32.2   0.8   14   55-68     10-23  (224)
 21 TIGR01993 Pyr-5-nucltdase pyri  49.7      15 0.00033   28.6   2.5   13   57-69      2-14  (184)
 22 TIGR02762 TraL_TIGR type IV co  48.8      10 0.00023   28.7   1.4   26   53-78     11-36  (95)
 23 TIGR01422 phosphonatase phosph  48.3     8.2 0.00018   31.9   0.8   15   56-70      3-17  (253)
 24 PRK11590 hypothetical protein;  48.0      11 0.00025   30.7   1.6   29   55-84      6-37  (211)
 25 PF15366 DUF4597:  Domain of un  47.1      12 0.00027   27.4   1.5   32   29-65     19-50  (62)
 26 PF08360 TetR_C_5:  QacR-like p  46.9      23  0.0005   28.1   3.1   40   61-100    87-126 (131)
 27 PLN02575 haloacid dehalogenase  46.2      14  0.0003   34.6   2.0   48   56-103   132-187 (381)
 28 PRK10563 6-phosphogluconate ph  45.7     8.2 0.00018   30.9   0.4   29   56-84      5-36  (221)
 29 PLN02954 phosphoserine phospha  42.0      29 0.00063   27.7   3.1   18   55-72     12-29  (224)
 30 TIGR01493 HAD-SF-IA-v2 Haloaci  41.1      11 0.00023   28.9   0.5   21   57-77      1-21  (175)
 31 TIGR01454 AHBA_synth_RP 3-amin  39.9      11 0.00024   29.9   0.3   15   58-72      1-15  (205)
 32 TIGR02254 YjjG/YfnB HAD superf  39.8      12 0.00026   29.5   0.6   30   56-85      2-34  (224)
 33 PRK11587 putative phosphatase;  39.7      22 0.00047   28.8   2.1   30   56-85      4-36  (218)
 34 PF04068 RLI:  Possible Fer4-li  39.6      17 0.00037   23.4   1.1   10   55-64      1-10  (35)
 35 TIGR01990 bPGM beta-phosphoglu  38.7      12 0.00026   28.6   0.4   28   58-85      2-32  (185)
 36 PF12710 HAD:  haloacid dehalog  37.9      15 0.00034   28.0   0.9   14   58-71      1-14  (192)
 37 TIGR02252 DREG-2 REG-2-like, H  37.5      14  0.0003   29.1   0.6   29   56-84      1-32  (203)
 38 TIGR01428 HAD_type_II 2-haloal  35.8      17 0.00038   28.6   0.9   26   56-82      2-27  (198)
 39 PRK13222 phosphoglycolate phos  35.7      26 0.00057   27.7   1.9   29   56-84      7-38  (226)
 40 TIGR01548 HAD-SF-IA-hyp1 haloa  35.5      13 0.00029   29.4   0.2   11   57-67      2-12  (197)
 41 PRK09449 dUMP phosphatase; Pro  35.4      19 0.00041   28.8   1.0   12   56-67      4-15  (224)
 42 PRK06698 bifunctional 5'-methy  35.3      13 0.00028   34.1   0.1   22   45-67    232-253 (459)
 43 TIGR01509 HAD-SF-IA-v3 haloaci  34.9      14  0.0003   28.0   0.2   16   57-72      1-16  (183)
 44 PRK13226 phosphoglycolate phos  34.2      18  0.0004   29.7   0.8   45   56-100    13-64  (229)
 45 TIGR02251 HIF-SF_euk Dullard-l  33.7      16 0.00034   29.3   0.3   13   57-69      3-15  (162)
 46 TIGR01488 HAD-SF-IB Haloacid D  33.7      16 0.00036   27.7   0.4   15   57-71      1-15  (177)
 47 PRK13478 phosphonoacetaldehyde  33.6      19  0.0004   30.3   0.7   16   56-71      5-20  (267)
 48 PRK10826 2-deoxyglucose-6-phos  33.4      25 0.00055   28.3   1.5   30   56-85      8-40  (222)
 49 PRK10748 flavin mononucleotide  33.2      17 0.00038   30.1   0.5   20   56-75     11-30  (238)
 50 TIGR03351 PhnX-like phosphonat  32.3      20 0.00042   28.7   0.7   20   56-75      2-21  (220)
 51 TIGR01449 PGP_bact 2-phosphogl  32.3      17 0.00037   28.5   0.3   11   58-68      1-11  (213)
 52 TIGR00338 serB phosphoserine p  32.2      20 0.00044   28.5   0.7   28   55-84     14-41  (219)
 53 TIGR01489 DKMTPPase-SF 2,3-dik  32.1      22 0.00047   27.1   0.9   17   56-72      2-18  (188)
 54 PF06941 NT5C:  5' nucleotidase  31.6      30 0.00064   27.8   1.6   26   59-84      6-31  (191)
 55 PRK13223 phosphoglycolate phos  30.0      24 0.00053   30.2   0.9   32   54-85     12-46  (272)
 56 cd01427 HAD_like Haloacid deha  29.5      19 0.00042   24.8   0.2   18   57-74      1-18  (139)
 57 TIGR01490 HAD-SF-IB-hyp1 HAD-s  28.7      19 0.00042   28.2   0.1   14   58-71      2-15  (202)
 58 PLN02770 haloacid dehalogenase  28.5      24 0.00051   29.5   0.6   19   56-74     23-41  (248)
 59 TIGR01672 AphA HAD superfamily  28.4      26 0.00057   30.4   0.8   16   56-71     64-79  (237)
 60 PRK13225 phosphoglycolate phos  26.7      29 0.00062   30.2   0.8   30   55-84     62-94  (273)
 61 cd02188 gamma_tubulin Gamma-tu  25.7      84  0.0018   29.6   3.7   63   50-119    55-131 (431)
 62 PF03767 Acid_phosphat_B:  HAD   25.4      34 0.00073   29.2   1.0   13   55-67     72-84  (229)
 63 PLN02940 riboflavin kinase      24.2      56  0.0012   29.8   2.2   32   53-84      9-43  (382)
 64 PF13041 PPR_2:  PPR repeat fam  24.2      90   0.002   19.6   2.6   29   66-97      3-31  (50)
 65 PF13645 YkuD_2:  L,D-transpept  23.8      24 0.00053   30.1  -0.2   34   53-86     47-86  (176)
 66 COG0637 Predicted phosphatase/  23.0      37  0.0008   28.3   0.7   29   56-84      3-34  (221)
 67 PF15152 Kisspeptin:  Kisspepti  22.7      40 0.00086   25.8   0.8   13  130-142    63-75  (78)
 68 PRK13582 thrH phosphoserine ph  22.6      44 0.00095   26.3   1.1   12   56-67      2-13  (205)
 69 KOG0729|consensus               22.1      94   0.002   29.7   3.2   40   89-128   252-295 (435)
 70 PLN03243 haloacid dehalogenase  22.0      41 0.00088   29.0   0.8   47   56-102    25-79  (260)
 71 TIGR02247 HAD-1A3-hyp Epoxide   21.8      41 0.00089   26.7   0.8   14   56-69      3-16  (211)
 72 KOG4217|consensus               20.4 1.4E+02  0.0031   30.0   4.2   20   57-76    399-420 (605)
 73 PF13419 HAD_2:  Haloacid dehal  20.1      48   0.001   24.2   0.8   14   58-71      1-14  (176)
 74 cd02189 delta_tubulin The tubu  20.0      86  0.0019   29.5   2.6   62   50-118    50-126 (446)

No 1  
>KOG3107|consensus
Probab=100.00  E-value=9.3e-69  Score=490.31  Aligned_cols=163  Identities=60%  Similarity=1.007  Sum_probs=155.8

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCccccceeEEeecchhhhHHhhhccchhhhhcCCChHHHhHHHHHHHHHHHHhhhh
Q psy11336         26 NASSAGTPTPIIPNPCPSPGSPAGDSRILDRVFIWDLDETIIIFHSLLTGSYATKHGKCPQTVIQLGYKMEEMIFGVADN  105 (194)
Q Consensus        26 ~~~~~~~~~~~~~~~~~s~~s~p~d~~~~eRVFIWDLDETiIIfhSLLtGsyA~~~~KD~~~~v~lG~rmEemIf~laD~  105 (194)
                      ...|--++++|..++|++++|||+|+ +||||||||||||||||||||+|+||++|+||+..+|++|++|||||||+||+
T Consensus       169 t~~s~k~~~~K~rgkk~~~psp~~ds-~~eRVFiWDlDEtiIifhslL~gsya~~y~kd~~~~v~ig~~mE~mifn~aDt  247 (468)
T KOG3107|consen  169 TDRSLKESKGKGRGKKKTGPSPPGDS-TLERVFIWDLDETIIIFHSLLTGSYATRYGKDPRAAVSIGLMMEEMIFNLADT  247 (468)
T ss_pred             cccccccCCCcccccccCCCCCCCCC-cceeEEEeeccchHHHHHHHhhhhhhhhccCCchhhhHHHHHHHHHHHHhhhH
Confidence            35666778899999999999999999 99999999999999999999999999999999999999999999999999999


Q ss_pred             ccccccccccCcccccccccCCCCCCCCCCCCCCCCCccccCCCCCCCCCccccccccCchhhHHHHHHHHHHHHHHHHh
Q psy11336        106 HFFFNEVEDCDQVHIDDISTDDNGQDLNGYNFSADGFRASVLNVPSGPPGLCVASGVRGGVDWMRKLAFRYRKIKDIYNN  185 (194)
Q Consensus       106 hfFfndlEecDqvhIdDvs~dDnGqDLS~y~F~~Dgf~~p~~~~~~~~~~lc~~~~vrgGVDWMRKLAfRYR~Ike~Yn~  185 (194)
                      ||||||||||||||||||++||||||||.|+|.+|||+++...  +  +++|+.++||||||||||||||||++||+||+
T Consensus       248 h~F~ndleecdq~~vDdvs~dDngqdLs~y~f~~d~fsa~~~~--~--~~l~~~~~v~g~vd~mr~laFr~re~~e~~~~  323 (468)
T KOG3107|consen  248 HLFFNDLEECDQVHVDDVSSDDNGQDLSTYNFVTDGFSAFTAF--S--ANLCLKTGVRGGVDWMRKLAFRYREVKEIYNT  323 (468)
T ss_pred             HHHHHHHhhhcccccccccccCCcccccceeeccCCCcCcCcc--c--cccccccccchhhhhhhccchhhHHHHHHHHH
Confidence            9999999999999999999999999999999999999997754  2  69999999999999999999999999999999


Q ss_pred             cccccccC
Q psy11336        186 YRNSVYLM  193 (194)
Q Consensus       186 yknnv~~~  193 (194)
                      ||||||+.
T Consensus       324 y~nnv~~l  331 (468)
T KOG3107|consen  324 YKNNVGGL  331 (468)
T ss_pred             HHhhhhcc
Confidence            99999974


No 2  
>TIGR01658 EYA-cons_domain eyes absent protein conserved domain. This domain is common to all eyes absent (EYA) homologs. Metazoan EYA's also contain a variable N-terminal domain consisting largely of low-complexity sequences.
Probab=100.00  E-value=1.4e-59  Score=410.64  Aligned_cols=115  Identities=42%  Similarity=0.853  Sum_probs=111.4

Q ss_pred             cceeEEeecchhhhHHhhhccchhhhhcC--CChHHHhHHHHHHHHHHHHhhhhccccccccccCcccccccccCCCCCC
Q psy11336         54 LDRVFIWDLDETIIIFHSLLTGSYATKHG--KCPQTVIQLGYKMEEMIFGVADNHFFFNEVEDCDQVHIDDISTDDNGQD  131 (194)
Q Consensus        54 ~eRVFIWDLDETiIIfhSLLtGsyA~~~~--KD~~~~v~lG~rmEemIf~laD~hfFfndlEecDqvhIdDvs~dDnGqD  131 (194)
                      ++||||||||||||||||||||+||++|+  ||++++|+||+|||||||+|||+||||||||||||||||||++||||||
T Consensus         1 ~e~VfvWDlDETlIif~SLL~GsyA~~f~g~KD~~~~v~lG~r~E~lIl~l~D~~fFf~~lEe~dq~~lddv~~~DdG~D   80 (274)
T TIGR01658         1 PENVYVWDMDETLILLHSLLNGSYAESFNGSKDHKRGVEIGRRWEEMILEICDTHFFYEEIEECNEPFLDDVRSYDDGKD   80 (274)
T ss_pred             CceeEEEeccchHHHHHHhhcchHHHHcCCCcCcHHHHHHHHHHHHHHHHHHHhhhhhhhHHhcCccchhhhhhcccccC
Confidence            58999999999999999999999999999  9999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCCCCCccccCCCCCCCCCccccccccCchhhHHHHHHHHHHHHHHHHhc
Q psy11336        132 LNGYNFSADGFRASVLNVPSGPPGLCVASGVRGGVDWMRKLAFRYRKIKDIYNNY  186 (194)
Q Consensus       132 LS~y~F~~Dgf~~p~~~~~~~~~~lc~~~~vrgGVDWMRKLAfRYR~Ike~Yn~y  186 (194)
                      ||+|+|.+|||++|.++       +|           +||||||||+|||+|++|
T Consensus        81 Ls~Y~F~~D~f~~p~~~-------~~-----------~rKLAyR~R~I~e~Y~~~  117 (274)
T TIGR01658        81 LSRYEFKTDGFSTPTDD-------LN-----------KRKLAYRHRAVAEIYEKG  117 (274)
T ss_pred             ccccccccccCCCCccc-------hh-----------hhHHHHHHHHHHHHHHhh
Confidence            99999999999999866       44           599999999999999999


No 3  
>PLN02779 haloacid dehalogenase-like hydrolase family protein
Probab=75.90  E-value=0.87  Score=39.43  Aligned_cols=28  Identities=11%  Similarity=0.212  Sum_probs=19.3

Q ss_pred             eeEEeecchhhhHHh-hhccchh---hhhcCC
Q psy11336         56 RVFIWDLDETIIIFH-SLLTGSY---ATKHGK   83 (194)
Q Consensus        56 RVFIWDLDETiIIfh-SLLtGsy---A~~~~K   83 (194)
                      +..|||||-||+=.. .+..-.+   ...||.
T Consensus        41 k~VIFDlDGTLvDS~~~~~~~a~~~~l~~~G~   72 (286)
T PLN02779         41 EALLFDCDGVLVETERDGHRVAFNDAFKEFGL   72 (286)
T ss_pred             cEEEEeCceeEEccccHHHHHHHHHHHHHcCC
Confidence            688999999998766 5554433   345554


No 4  
>COG0546 Gph Predicted phosphatases [General function prediction only]
Probab=72.39  E-value=2.1  Score=35.16  Aligned_cols=48  Identities=19%  Similarity=0.279  Sum_probs=31.6

Q ss_pred             ceeEEeecchhhhHHhhhccc---hhhhhcCCChHHHhH----HHHHHHHHHHHh
Q psy11336         55 DRVFIWDLDETIIIFHSLLTG---SYATKHGKCPQTVIQ----LGYKMEEMIFGV  102 (194)
Q Consensus        55 eRVFIWDLDETiIIfhSLLtG---syA~~~~KD~~~~v~----lG~rmEemIf~l  102 (194)
                      .++.|||||-||+=..-.+..   ..++++|.++.....    +|.-+.++|..+
T Consensus         4 ~~~iiFDlDGTL~Ds~~~~~~~~~~~~~~~~~~~~~~~~~~~~ig~~~~~~~~~~   58 (220)
T COG0546           4 IKAILFDLDGTLVDSAEDILRAFNAALAELGLPPLDEEEIRQLIGLGLDELIERL   58 (220)
T ss_pred             CCEEEEeCCCccccChHHHHHHHHHHHHHcCCCCCCHHHHHHHhcCCHHHHHHHH
Confidence            368999999999987776666   445777766432222    445555565543


No 5  
>PRK13707 conjugal transfer pilus assembly protein TraL; Provisional
Probab=71.13  E-value=2.3  Score=32.95  Aligned_cols=27  Identities=26%  Similarity=0.081  Sum_probs=21.2

Q ss_pred             ccceeEEeecchhhhHHhhhccchhhh
Q psy11336         53 ILDRVFIWDLDETIIIFHSLLTGSYAT   79 (194)
Q Consensus        53 ~~eRVFIWDLDETiIIfhSLLtGsyA~   79 (194)
                      +.+|+|.|++||.++++=.+.=|-.++
T Consensus        17 ~~~ri~~~~~DE~~~~~~~~~~Gi~~~   43 (101)
T PRK13707         17 NQSRWFGLPLDELIPAAICIGWGITTS   43 (101)
T ss_pred             CCCeEEeeeHHHHHHHHHHHHHHHHHc
Confidence            578999999999998876666664443


No 6  
>TIGR02250 FCP1_euk FCP1-like phosphatase, phosphatase domain. This domain is related to domains found in the human NLI interacting factor-like phosphatases, and together both are detected by the Pfam model pfam03031.
Probab=70.92  E-value=2.2  Score=34.43  Aligned_cols=19  Identities=26%  Similarity=0.254  Sum_probs=14.4

Q ss_pred             cceeEEeecchhhhHHhhh
Q psy11336         54 LDRVFIWDLDETIIIFHSL   72 (194)
Q Consensus        54 ~eRVFIWDLDETiIIfhSL   72 (194)
                      -+.+-|+|||||+|=....
T Consensus         5 ~kl~LVLDLDeTLihs~~~   23 (156)
T TIGR02250         5 KKLHLVLDLDQTLIHTTKD   23 (156)
T ss_pred             CceEEEEeCCCCccccccc
Confidence            3567899999999965443


No 7  
>TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC. No member of this subfamily is characterized with respect to function, however the MDP-1 protein is a characterized phosphatase. All of the characterized enzymes within subfamily III are phosphatases, and all of the active site residues characteristic of HAD-superfamily phosphatases are present in subfamily IIIC.
Probab=67.71  E-value=2.5  Score=32.29  Aligned_cols=12  Identities=42%  Similarity=0.877  Sum_probs=10.9

Q ss_pred             eeEEeecchhhh
Q psy11336         56 RVFIWDLDETII   67 (194)
Q Consensus        56 RVFIWDLDETiI   67 (194)
                      +++|||||.|+.
T Consensus         1 kli~~DlD~Tl~   12 (128)
T TIGR01681         1 KVIVFDLDNTLW   12 (128)
T ss_pred             CEEEEeCCCCCC
Confidence            589999999987


No 8  
>PF07178 TraL:  TraL protein;  InterPro: IPR009838 This entry represents bacterial TraL proteins. TraL is a predicted peripheral membrane protein involved in bacterial sex pilus assembly []. TraL is part of the type IV secretion system for conjugative plasmid transfer []. The exact function of TraL is unknown.; GO: 0000746 conjugation, 0019867 outer membrane
Probab=65.49  E-value=3  Score=31.28  Aligned_cols=26  Identities=23%  Similarity=0.434  Sum_probs=21.5

Q ss_pred             ccceeEEeecchhhhHHhhhccchhh
Q psy11336         53 ILDRVFIWDLDETIIIFHSLLTGSYA   78 (194)
Q Consensus        53 ~~eRVFIWDLDETiIIfhSLLtGsyA   78 (194)
                      +..|++.||+||.++.+-.+.-|-..
T Consensus        11 ~p~~il~~~~De~~~~~~~~~~gi~~   36 (95)
T PF07178_consen   11 DPPRILFWPMDEFIPALILFVIGILS   36 (95)
T ss_pred             CcceeeeecHHHHHHHHHHHHHHHHH
Confidence            57899999999999988877777444


No 9  
>TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein. This enzyme is a member of the haloacid dehalogenase (HAD) superfamily, specifically part of subfamily IB by virtue of the presence of an alpha helical domain in between motifs I and II of the HAD domain . The closest homologs to this family are monofunctional phosphoserine phosphatases (TIGR00338).
Probab=64.37  E-value=3.5  Score=34.28  Aligned_cols=27  Identities=19%  Similarity=0.174  Sum_probs=18.2

Q ss_pred             ceeEEeecchhhhHHhhhccchhhhhcCCC
Q psy11336         55 DRVFIWDLDETIIIFHSLLTGSYATKHGKC   84 (194)
Q Consensus        55 eRVFIWDLDETiIIfhSLLtGsyA~~~~KD   84 (194)
                      .|+.++|||+|||=-  + -.-++.+.|.+
T Consensus         1 ~~la~FDlD~TLi~~--~-w~~~~~~~g~~   27 (203)
T TIGR02137         1 MEIACLDLEGVLVPE--I-WIAFAEKTGID   27 (203)
T ss_pred             CeEEEEeCCcccHHH--H-HHHHHHHcCCc
Confidence            378999999999942  2 23555555543


No 10 
>PHA02597 30.2 hypothetical protein; Provisional
Probab=63.82  E-value=7.4  Score=30.73  Aligned_cols=29  Identities=21%  Similarity=0.257  Sum_probs=20.4

Q ss_pred             eeEEeecchhhhHHhhhccchhhhhcCCCh
Q psy11336         56 RVFIWDLDETIIIFHSLLTGSYATKHGKCP   85 (194)
Q Consensus        56 RVFIWDLDETiIIfhSLLtGsyA~~~~KD~   85 (194)
                      +.+|||||.|||=++.-+. ...++||.+.
T Consensus         3 k~viFDlDGTLiD~~~~~~-~~~~~~g~~~   31 (197)
T PHA02597          3 PTILTDVDGVLLSWQSGLP-YFAQKYNIPT   31 (197)
T ss_pred             cEEEEecCCceEchhhccH-HHHHhcCCCH
Confidence            5799999999998776444 2334677654


No 11 
>TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal. This hypothetical equivalog is a member of the IB subfamily (TIGR01488) of the haloacid dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases. The sequences modelled by this alignment are all from archaeal species. The phylogenetically closest group of sequences to these are phosphoserine phosphatases (TIGR00338). There are no known archaeal phosphoserine phosphatases, and no archaea fall within TIGR00338. It is likely, then, that This model represents the archaeal branch of the PSPase equivalog.
Probab=62.48  E-value=3.8  Score=31.77  Aligned_cols=16  Identities=31%  Similarity=0.451  Sum_probs=12.8

Q ss_pred             ceeEEeecchhhhHHh
Q psy11336         55 DRVFIWDLDETIIIFH   70 (194)
Q Consensus        55 eRVFIWDLDETiIIfh   70 (194)
                      .+..|||||.|||=..
T Consensus         4 ~k~viFD~DGTLid~~   19 (201)
T TIGR01491         4 IKLIIFDLDGTLTDVM   19 (201)
T ss_pred             ceEEEEeCCCCCcCCc
Confidence            3579999999999643


No 12 
>TIGR01686 FkbH FkbH-like domain. The C-terminal portion of this domain is unique to this family (by BLAST).
Probab=60.26  E-value=4.4  Score=35.50  Aligned_cols=14  Identities=36%  Similarity=0.551  Sum_probs=12.0

Q ss_pred             cceeEEeecchhhh
Q psy11336         54 LDRVFIWDLDETII   67 (194)
Q Consensus        54 ~eRVFIWDLDETiI   67 (194)
                      ..+++|||||+|+.
T Consensus         2 ~~k~~v~DlDnTlw   15 (320)
T TIGR01686         2 ALKVLVLDLDNTLW   15 (320)
T ss_pred             CeEEEEEcCCCCCC
Confidence            45899999999984


No 13 
>PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional
Probab=56.11  E-value=5.3  Score=30.92  Aligned_cols=29  Identities=21%  Similarity=0.187  Sum_probs=17.7

Q ss_pred             eeEEeecchhhhHHhhhccc---hhhhhcCCC
Q psy11336         56 RVFIWDLDETIIIFHSLLTG---SYATKHGKC   84 (194)
Q Consensus        56 RVFIWDLDETiIIfhSLLtG---syA~~~~KD   84 (194)
                      .+.|||||-|||=+.....-   ..++.||.+
T Consensus         6 ~~viFD~DGTLiDs~~~~~~a~~~~~~~~g~~   37 (188)
T PRK10725          6 AGLIFDMDGTILDTEPTHRKAWREVLGRYGLQ   37 (188)
T ss_pred             eEEEEcCCCcCccCHHHHHHHHHHHHHHcCCC
Confidence            46799999999964333222   223346654


No 14 
>PF03031 NIF:  NLI interacting factor-like phosphatase;  InterPro: IPR004274 The function of this domain is unclear. It is found in proteins of diverse function including phosphatases some of which may be active in active in ternary elongation complexes and a number of NLI interacting factors. In the phospatases this domain is often present N-terminal to the BRCT domain (IPR001357 from INTERPRO).; GO: 0005515 protein binding; PDB: 3L0Y_A 2GHQ_A 3PGL_A 3L0C_B 1TA0_A 2GHT_A 3L0B_B 1T9Z_A 3QLE_A 2Q5E_E ....
Probab=55.97  E-value=4.4  Score=31.17  Aligned_cols=14  Identities=29%  Similarity=0.482  Sum_probs=9.9

Q ss_pred             eEEeecchhhhHHh
Q psy11336         57 VFIWDLDETIIIFH   70 (194)
Q Consensus        57 VFIWDLDETiIIfh   70 (194)
                      .-|+|||||||-..
T Consensus         2 ~LVlDLD~TLv~~~   15 (159)
T PF03031_consen    2 TLVLDLDGTLVHSS   15 (159)
T ss_dssp             EEEEE-CTTTEEEE
T ss_pred             EEEEeCCCcEEEEe
Confidence            45899999988644


No 15 
>PF05152 DUF705:  Protein of unknown function (DUF705);  InterPro: IPR007827 This family contains uncharacterised baculoviral proteins.
Probab=55.38  E-value=5.8  Score=36.56  Aligned_cols=15  Identities=40%  Similarity=0.643  Sum_probs=13.2

Q ss_pred             ccceeEEeecchhhh
Q psy11336         53 ILDRVFIWDLDETII   67 (194)
Q Consensus        53 ~~eRVFIWDLDETiI   67 (194)
                      ....|-|||||+|+|
T Consensus       120 ~~phVIVfDlD~TLI  134 (297)
T PF05152_consen  120 EPPHVIVFDLDSTLI  134 (297)
T ss_pred             CCCcEEEEECCCccc
Confidence            456799999999999


No 16 
>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253. This family is a member of the haloacid dehalogenase (HAD) superfamily of hydrolases which are characterized by three conserved sequence motifs. By virtue of an alpha helical domain in-between the first and second conserved motif, this family is a member of subfamily IA (TIGR01549).
Probab=55.01  E-value=6  Score=31.43  Aligned_cols=20  Identities=30%  Similarity=0.494  Sum_probs=15.8

Q ss_pred             eeEEeecchhhhHHhhhccc
Q psy11336         56 RVFIWDLDETIIIFHSLLTG   75 (194)
Q Consensus        56 RVFIWDLDETiIIfhSLLtG   75 (194)
                      ++.|||||.||+=.+....-
T Consensus         3 ~~viFDlDGTL~ds~~~~~~   22 (221)
T TIGR02253         3 KAIFFDLDDTLIDTSGLAEK   22 (221)
T ss_pred             eEEEEeCCCCCcCCCCccCH
Confidence            57899999999987765443


No 17 
>TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E. HAD subfamilies caused by an overly broad single model.
Probab=51.65  E-value=5.8  Score=29.81  Aligned_cols=31  Identities=16%  Similarity=0.267  Sum_probs=19.6

Q ss_pred             eEEeecchhhhHHh-hhccc--hhhhhcCCChHH
Q psy11336         57 VFIWDLDETIIIFH-SLLTG--SYATKHGKCPQT   87 (194)
Q Consensus        57 VFIWDLDETiIIfh-SLLtG--syA~~~~KD~~~   87 (194)
                      ++|||+|-||+=.. ..+..  ..+.+|+.|++.
T Consensus         1 ~iifD~DGTL~d~~~~~~~~~~~~~~~~~~~~~~   34 (154)
T TIGR01549         1 AILFDIDGTLVDSSFAIRRAFEETLEEFGEDFQA   34 (154)
T ss_pred             CeEecCCCcccccHHHHHHHHHHHHHHhcccHHH
Confidence            47999999998764 33333  334456666554


No 18 
>TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase. All of these are members of the larger Haloacid dehalogenase (HAD) subfamily IA and include the "variant 3" glu-asp version of the third conserved HAD domain (TIGR01509).
Probab=51.58  E-value=6.7  Score=30.07  Aligned_cols=30  Identities=27%  Similarity=0.282  Sum_probs=20.3

Q ss_pred             eeEEeecchhhhHHhhhccc---hhhhhcCCCh
Q psy11336         56 RVFIWDLDETIIIFHSLLTG---SYATKHGKCP   85 (194)
Q Consensus        56 RVFIWDLDETiIIfhSLLtG---syA~~~~KD~   85 (194)
                      ++.|||||-||+=...+..-   ..++.||.+.
T Consensus         2 ~~iiFD~DGTL~ds~~~~~~~~~~~~~~~g~~~   34 (185)
T TIGR02009         2 KAVIFDMDGVIVDTAPLHAQAWKHLADKYGIEF   34 (185)
T ss_pred             CeEEEcCCCcccCChHHHHHHHHHHHHHcCCCC
Confidence            57899999999976655433   2345667653


No 19 
>PRK13288 pyrophosphatase PpaX; Provisional
Probab=51.00  E-value=7.2  Score=31.17  Aligned_cols=20  Identities=30%  Similarity=0.529  Sum_probs=15.2

Q ss_pred             eeEEeecchhhhHHhhhccc
Q psy11336         56 RVFIWDLDETIIIFHSLLTG   75 (194)
Q Consensus        56 RVFIWDLDETiIIfhSLLtG   75 (194)
                      +..|||||-|||=......-
T Consensus         4 ~~viFD~DGTL~ds~~~~~~   23 (214)
T PRK13288          4 NTVLFDLDGTLINTNELIIS   23 (214)
T ss_pred             cEEEEeCCCcCccCHHHHHH
Confidence            57899999999976554444


No 20 
>PRK14988 GMP/IMP nucleotidase; Provisional
Probab=50.12  E-value=7.3  Score=32.25  Aligned_cols=14  Identities=21%  Similarity=0.351  Sum_probs=12.4

Q ss_pred             ceeEEeecchhhhH
Q psy11336         55 DRVFIWDLDETIII   68 (194)
Q Consensus        55 eRVFIWDLDETiII   68 (194)
                      -+++|||||.||+=
T Consensus        10 ~k~vIFDlDGTL~d   23 (224)
T PRK14988         10 VDTVLLDMDGTLLD   23 (224)
T ss_pred             CCEEEEcCCCCccc
Confidence            46899999999987


No 21 
>TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These enzymes are members of the haloacid dehalogenase (HAD) superfamily of hydrolases, specifically the IA subfamily (variant 3, TIGR01509).
Probab=49.72  E-value=15  Score=28.61  Aligned_cols=13  Identities=38%  Similarity=0.713  Sum_probs=11.2

Q ss_pred             eEEeecchhhhHH
Q psy11336         57 VFIWDLDETIIIF   69 (194)
Q Consensus        57 VFIWDLDETiIIf   69 (194)
                      ++|||||-||+=.
T Consensus         2 ~viFDlDGTL~ds   14 (184)
T TIGR01993         2 VWFFDLDNTLYPH   14 (184)
T ss_pred             eEEEeCCCCCCCC
Confidence            6899999999954


No 22 
>TIGR02762 TraL_TIGR type IV conjugative transfer system protein TraL. This protein is part of the type IV secretion system for conjugative plasmid transfer. The function of the TraL protein is unknown.
Probab=48.82  E-value=10  Score=28.70  Aligned_cols=26  Identities=19%  Similarity=0.040  Sum_probs=20.6

Q ss_pred             ccceeEEeecchhhhHHhhhccchhh
Q psy11336         53 ILDRVFIWDLDETIIIFHSLLTGSYA   78 (194)
Q Consensus        53 ~~eRVFIWDLDETiIIfhSLLtGsyA   78 (194)
                      +-.|||.|++||-++++=.+.-|-.+
T Consensus        11 ~~~~i~g~t~DE~i~~~~~~~~Gi~~   36 (95)
T TIGR02762        11 EQPRILGLPLDEFLPGATLFGIGILS   36 (95)
T ss_pred             CCCeEEEeeHHHHHHHHHHHHHHHHH
Confidence            46799999999998887777666444


No 23 
>TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase. This enzyme is a member of the Haloacid Dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases (pfam00702), and contains a modified version of the conserved catalytic motifs of that superfamily: the first motif is usually DxDx(T/V), here it is DxAxT, and in the third motif the normal conserved lysine is instead an arginine. Additionally, the enzyme contains a unique conserved catalytic lysine (B. cereus pos. 53) which is involved in the binding and activation of the substrate through the formation of a Schiff base. The substrate of this enzyme is the product of 2-aminoethylphosphonate (AEP) transaminase, phosphonoacetaldehyde. This degradation pathway for AEP may be related to its toxic properties which are utilized by microorganisms as a chemical warfare agent.
Probab=48.27  E-value=8.2  Score=31.87  Aligned_cols=15  Identities=27%  Similarity=0.399  Sum_probs=12.6

Q ss_pred             eeEEeecchhhhHHh
Q psy11336         56 RVFIWDLDETIIIFH   70 (194)
Q Consensus        56 RVFIWDLDETiIIfh   70 (194)
                      +.+|||||-|||=+.
T Consensus         3 k~viFD~DGTLiDs~   17 (253)
T TIGR01422         3 EAVIFDWAGTTVDFG   17 (253)
T ss_pred             eEEEEeCCCCeecCC
Confidence            468999999999753


No 24 
>PRK11590 hypothetical protein; Provisional
Probab=48.00  E-value=11  Score=30.66  Aligned_cols=29  Identities=24%  Similarity=0.415  Sum_probs=18.4

Q ss_pred             ceeEEeecchhhhHHhhhccc--hhh-hhcCCC
Q psy11336         55 DRVFIWDLDETIIIFHSLLTG--SYA-TKHGKC   84 (194)
Q Consensus        55 eRVFIWDLDETiIIfhSLLtG--syA-~~~~KD   84 (194)
                      .++.|+|||.||+ ....++.  .++ ++++..
T Consensus         6 ~k~~iFD~DGTL~-~~d~~~~~~~~~~~~~g~~   37 (211)
T PRK11590          6 RRVVFFDLDGTLH-QQDMFGSFLRYLLRRQPLN   37 (211)
T ss_pred             ceEEEEecCCCCc-ccchHHHHHHHHHHhcchh
Confidence            5789999999999 2222222  344 566633


No 25 
>PF15366 DUF4597:  Domain of unknown function (DUF4597)
Probab=47.12  E-value=12  Score=27.39  Aligned_cols=32  Identities=41%  Similarity=0.601  Sum_probs=25.3

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCccccceeEEeecchh
Q psy11336         29 SAGTPTPIIPNPCPSPGSPAGDSRILDRVFIWDLDET   65 (194)
Q Consensus        29 ~~~~~~~~~~~~~~s~~s~p~d~~~~eRVFIWDLDET   65 (194)
                      -.+-|.-+|+.|+++++--|-|+    |--+| ||||
T Consensus        19 hLdVPnIIiTPPTPTg~~lpRDs----~~~vw-lDe~   50 (62)
T PF15366_consen   19 HLDVPNIIITPPTPTGMMLPRDS----RRTVW-LDET   50 (62)
T ss_pred             ccCCCceEecCCCCCceeccccc----Cccee-cccc
Confidence            45667778889999999988888    55677 7886


No 26 
>PF08360 TetR_C_5:  QacR-like protein, C-terminal region;  InterPro: IPR013571 This entry represents the C-terminal domain found in the multidrug-binding transcription regulator QacR (P23217 from SWISSPROT) from Staphylococcus aureus, which is a member of the TetR (tetracycline-resistance) transcriptional regulator family of proteins. QacR is able to bind various environmental agents, which include a number of cationic lipophilic compounds, and thus regulate the transcription of QacA (P23215 from SWISSPROT), a multidrug efflux pump []. The C-terminal region of QacR contains a multifaceted, expansive drug-binding pocket, which is composed of several separate, but linked, binding sites []. The C-terminal domains of QacR and TetR share a multi-helical, interlocking structure.; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0045892 negative regulation of transcription, DNA-dependent; PDB: 2G0E_E 1JUM_A 1RPW_D 1QVT_B 2HQ5_D 1JT0_B 2DTZ_E 1JUP_D 1JT6_D 1JUS_E ....
Probab=46.85  E-value=23  Score=28.07  Aligned_cols=40  Identities=25%  Similarity=0.208  Sum_probs=28.3

Q ss_pred             ecchhhhHHhhhccchhhhhcCCChHHHhHHHHHHHHHHH
Q psy11336         61 DLDETIIIFHSLLTGSYATKHGKCPQTVIQLGYKMEEMIF  100 (194)
Q Consensus        61 DLDETiIIfhSLLtGsyA~~~~KD~~~~v~lG~rmEemIf  100 (194)
                      |.+++.+||+++|.|-.--.|.+|......+.+..-.+++
T Consensus        87 dv~~~a~il~s~l~GL~~~~~~~~~~e~~~l~~~ai~ifL  126 (131)
T PF08360_consen   87 DVEELAYILMSLLDGLSQWYYEKDKEELEALYRKAIDIFL  126 (131)
T ss_dssp             THHHHHHHHHHHHHHHHHTTTSS-HHHHHHHHHHHHHHHH
T ss_pred             CHHHHHHHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHHHH
Confidence            5678899999999996655556777776666665555544


No 27 
>PLN02575 haloacid dehalogenase-like hydrolase
Probab=46.18  E-value=14  Score=34.60  Aligned_cols=48  Identities=25%  Similarity=0.228  Sum_probs=28.3

Q ss_pred             eeEEeecchhhhH----HhhhccchhhhhcCCChHHH----hHHHHHHHHHHHHhh
Q psy11336         56 RVFIWDLDETIII----FHSLLTGSYATKHGKCPQTV----IQLGYKMEEMIFGVA  103 (194)
Q Consensus        56 RVFIWDLDETiII----fhSLLtGsyA~~~~KD~~~~----v~lG~rmEemIf~la  103 (194)
                      +.+|||||-|||=    .+.-..-..++++|.++...    .-+|..+++++-.+.
T Consensus       132 ~~VIFDlDGTLIDS~~~i~~~a~~~l~~e~G~~~~~~e~~~~~~G~~~~~~l~~ll  187 (381)
T PLN02575        132 LGAIFEWEGVIIEDNPDLENQAWLTLAQEEGKSPPPAFILRRVEGMKNEQAISEVL  187 (381)
T ss_pred             CEEEEcCcCcceeCHHHHHHHHHHHHHHHcCCCCCHHHHHHHhcCCCHHHHHHHHh
Confidence            3589999999993    23222224667888664332    224666666655543


No 28 
>PRK10563 6-phosphogluconate phosphatase; Provisional
Probab=45.69  E-value=8.2  Score=30.92  Aligned_cols=29  Identities=14%  Similarity=0.232  Sum_probs=20.3

Q ss_pred             eeEEeecchhhhHHhhhccc---hhhhhcCCC
Q psy11336         56 RVFIWDLDETIIIFHSLLTG---SYATKHGKC   84 (194)
Q Consensus        56 RVFIWDLDETiIIfhSLLtG---syA~~~~KD   84 (194)
                      +..|||+|.|||=...+..-   ..+.+||..
T Consensus         5 ~~viFD~DGTL~d~~~~~~~a~~~~~~~~g~~   36 (221)
T PRK10563          5 EAVFFDCDGTLVDSEVICSRAYVTMFAEFGIT   36 (221)
T ss_pred             CEEEECCCCCCCCChHHHHHHHHHHHHHcCCC
Confidence            57899999999987665433   344567754


No 29 
>PLN02954 phosphoserine phosphatase
Probab=42.05  E-value=29  Score=27.74  Aligned_cols=18  Identities=17%  Similarity=0.375  Sum_probs=14.8

Q ss_pred             ceeEEeecchhhhHHhhh
Q psy11336         55 DRVFIWDLDETIIIFHSL   72 (194)
Q Consensus        55 eRVFIWDLDETiIIfhSL   72 (194)
                      -+++|+|||-||+-..++
T Consensus        12 ~k~viFDfDGTL~~~~~~   29 (224)
T PLN02954         12 ADAVCFDVDSTVCVDEGI   29 (224)
T ss_pred             CCEEEEeCCCcccchHHH
Confidence            368899999999976665


No 30 
>TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase. The Subfamily IA and IB capping domains are predicted by PSI-PRED to consist of an alpha helical bundle. Subfamily I encompasses such a wide region of sequence space (the sequences are highly divergent) that modelling it with a single alignment is impossible, resulting in an overly broad description which allows in many unrelated sequences. Subfamily IA and IB are separated based on an aparrent phylogenetic bifurcation. Subfamily IA is still too broad to model, but cannot be further subdivided into large chunks based on phylogenetic trees. Of the three motifs defining the HAD superfamily, the third has three variant forms : (1) hhhhsDxxx(x)D, (2) hhhhssxxx(x)D and (3) hhhhDDxxx(x)s where _s_ refers to a small amino acid and _h_ to a hydrophobic one. All three of these variants are found in subfamily IA. Individual models were made based on seeds exhibiting only o
Probab=41.06  E-value=11  Score=28.94  Aligned_cols=21  Identities=14%  Similarity=0.322  Sum_probs=15.9

Q ss_pred             eEEeecchhhhHHhhhccchh
Q psy11336         57 VFIWDLDETIIIFHSLLTGSY   77 (194)
Q Consensus        57 VFIWDLDETiIIfhSLLtGsy   77 (194)
                      +.|||||.|||=+...+.-.+
T Consensus         1 ~viFD~DGTL~D~~~~~~~~~   21 (175)
T TIGR01493         1 AMVFDVYGTLVDVHGGVRACL   21 (175)
T ss_pred             CeEEecCCcCcccHHHHHHHH
Confidence            469999999998776555543


No 31 
>TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein. The most closely related enzyme below the noise cutoff is IndB which is involved in the biosynthesis of Indigoidine in Pectobacterium (Erwinia) chrysanthemi, a gamma proteobacter. This enzyme is similarly related to PGP. In this case, too it is unclear what role would be be played by a PGPase activity.
Probab=39.91  E-value=11  Score=29.95  Aligned_cols=15  Identities=20%  Similarity=0.479  Sum_probs=11.2

Q ss_pred             EEeecchhhhHHhhh
Q psy11336         58 FIWDLDETIIIFHSL   72 (194)
Q Consensus        58 FIWDLDETiIIfhSL   72 (194)
                      .|||||.||+=....
T Consensus         1 iiFDlDGTL~Ds~~~   15 (205)
T TIGR01454         1 VVFDLDGVLVDSFAV   15 (205)
T ss_pred             CeecCcCccccCHHH
Confidence            489999999864333


No 32 
>TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254. This family is a member of the haloacid dehalogenase (HAD) superfamily of hydrolases which are characterized by three conserved sequence motifs. By virtue of an alpha helical domain in-between the first and second conserved motif, this family is a member of subfamily IA (TIGR01549). Most likely, these enzymes are phosphatases.
Probab=39.83  E-value=12  Score=29.47  Aligned_cols=30  Identities=23%  Similarity=0.394  Sum_probs=20.0

Q ss_pred             eeEEeecchhhhHHhhhccchhh---hhcCCCh
Q psy11336         56 RVFIWDLDETIIIFHSLLTGSYA---TKHGKCP   85 (194)
Q Consensus        56 RVFIWDLDETiIIfhSLLtGsyA---~~~~KD~   85 (194)
                      ++.|||||.|||=.++...-.+.   .++|..+
T Consensus         2 k~viFD~DGTL~d~~~~~~~~~~~~~~~~g~~~   34 (224)
T TIGR02254         2 KTLLFDLDDTILDFQAAEALALRLLFEDQGIPL   34 (224)
T ss_pred             CEEEEcCcCcccccchHHHHHHHHHHHHhCCCc
Confidence            46899999999987665543333   3456543


No 33 
>PRK11587 putative phosphatase; Provisional
Probab=39.72  E-value=22  Score=28.76  Aligned_cols=30  Identities=30%  Similarity=0.599  Sum_probs=19.3

Q ss_pred             eeEEeecchhhhHHhhhccc---hhhhhcCCCh
Q psy11336         56 RVFIWDLDETIIIFHSLLTG---SYATKHGKCP   85 (194)
Q Consensus        56 RVFIWDLDETiIIfhSLLtG---syA~~~~KD~   85 (194)
                      +..|||||-|||=......-   ..+++||..+
T Consensus         4 k~viFDlDGTL~Ds~~~~~~a~~~~~~~~g~~~   36 (218)
T PRK11587          4 KGFLFDLDGTLVDSLPAVERAWSNWADRHGIAP   36 (218)
T ss_pred             CEEEEcCCCCcCcCHHHHHHHHHHHHHHcCCCH
Confidence            35799999999875544433   3345667544


No 34 
>PF04068 RLI:  Possible Fer4-like domain in RNase L inhibitor, RLI;  InterPro: IPR007209 This is a possible metal-binding domain in endoribonuclease RNase L inhibitor. It is found at the N-terminal end of RNase L inhibitor proteins, adjacent to the 4Fe-4S binding domain, fer4, IPR001450 from INTERPRO. Also often found adjacent to IPR007177 from INTERPRO in uncharacterised proteins. The RNase L system plays a major role in the anti-viral and anti-proliferative activities of interferons [], and could possibly play a more general role in the regulation of RNA stability in mammalian cells. Inhibitory activity requires concentration-dependent association of RLI with RNase L [].; PDB: 3J16_B 3BK7_A.
Probab=39.59  E-value=17  Score=23.44  Aligned_cols=10  Identities=40%  Similarity=1.052  Sum_probs=7.1

Q ss_pred             ceeEEeecch
Q psy11336         55 DRVFIWDLDE   64 (194)
Q Consensus        55 eRVFIWDLDE   64 (194)
                      .||+|||.|+
T Consensus         1 mrlav~d~~~   10 (35)
T PF04068_consen    1 MRLAVWDFDQ   10 (35)
T ss_dssp             EEEEEE-CCC
T ss_pred             CEEEEEEcCC
Confidence            3789999886


No 35 
>TIGR01990 bPGM beta-phosphoglucomutase. The enzyme from L. lactis has been extensively characterized including a remarkable crystal structure which traps the pentacoordinate transition state.
Probab=38.73  E-value=12  Score=28.64  Aligned_cols=28  Identities=25%  Similarity=0.113  Sum_probs=17.9

Q ss_pred             EEeecchhhhHHhhhccch---hhhhcCCCh
Q psy11336         58 FIWDLDETIIIFHSLLTGS---YATKHGKCP   85 (194)
Q Consensus        58 FIWDLDETiIIfhSLLtGs---yA~~~~KD~   85 (194)
                      .|||+|.||+=......-.   .++.||.++
T Consensus         2 iiFD~DGTL~ds~~~~~~~~~~~~~~~g~~~   32 (185)
T TIGR01990         2 VIFDLDGVITDTAEYHYLAWKALADELGIPF   32 (185)
T ss_pred             eEEcCCCccccChHHHHHHHHHHHHHcCCCC
Confidence            6999999998655444332   235566553


No 36 
>PF12710 HAD:  haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B.
Probab=37.87  E-value=15  Score=28.05  Aligned_cols=14  Identities=36%  Similarity=0.453  Sum_probs=11.6

Q ss_pred             EEeecchhhhHHhh
Q psy11336         58 FIWDLDETIIIFHS   71 (194)
Q Consensus        58 FIWDLDETiIIfhS   71 (194)
                      .|||+|.||+-..+
T Consensus         1 v~fD~DGTL~~~~~   14 (192)
T PF12710_consen    1 VIFDFDGTLTDSDS   14 (192)
T ss_dssp             EEEESBTTTBSSHH
T ss_pred             eEEecCcCeecCCC
Confidence            58999999988663


No 37 
>TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase. Most likely, these sequences, like the vast majority of HAD sequences, represent phosphatase enzymes.
Probab=37.53  E-value=14  Score=29.10  Aligned_cols=29  Identities=17%  Similarity=0.238  Sum_probs=17.5

Q ss_pred             eeEEeecchhhhHHhhhccc---hhhhhcCCC
Q psy11336         56 RVFIWDLDETIIIFHSLLTG---SYATKHGKC   84 (194)
Q Consensus        56 RVFIWDLDETiIIfhSLLtG---syA~~~~KD   84 (194)
                      ++.|||||.|||=+.....-   ..+++||.+
T Consensus         1 k~viFDlDGTL~d~~~~~~~a~~~~~~~~g~~   32 (203)
T TIGR02252         1 KLITFDAVGTLLALKEPVGEVYCEIARKYGVE   32 (203)
T ss_pred             CeEEEecCCceeeeCCCHHHHHHHHHHHhCCC
Confidence            46899999999854332222   223456654


No 38 
>TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II. Note that the Type I HAD enzymes have not yet been fully characterized, but clearly utilize a substantially different catalytic mechanism and are thus unlikely to be related.
Probab=35.81  E-value=17  Score=28.56  Aligned_cols=26  Identities=23%  Similarity=0.459  Sum_probs=18.1

Q ss_pred             eeEEeecchhhhHHhhhccchhhhhcC
Q psy11336         56 RVFIWDLDETIIIFHSLLTGSYATKHG   82 (194)
Q Consensus        56 RVFIWDLDETiIIfhSLLtGsyA~~~~   82 (194)
                      ++.|+|||.|||=+..+ .-.+.+.++
T Consensus         2 k~viFD~dgTLiD~~~~-~~~~~~~~~   27 (198)
T TIGR01428         2 KALVFDVYGTLFDVHSV-VERFAELYG   27 (198)
T ss_pred             cEEEEeCCCcCccHHHH-HHHHHHHhC
Confidence            46799999999988875 223444443


No 39 
>PRK13222 phosphoglycolate phosphatase; Provisional
Probab=35.69  E-value=26  Score=27.70  Aligned_cols=29  Identities=24%  Similarity=0.233  Sum_probs=17.5

Q ss_pred             eeEEeecchhhhHHhhhcc---chhhhhcCCC
Q psy11336         56 RVFIWDLDETIIIFHSLLT---GSYATKHGKC   84 (194)
Q Consensus        56 RVFIWDLDETiIIfhSLLt---GsyA~~~~KD   84 (194)
                      ++.|||+|-||+=......   ..+++.||..
T Consensus         7 ~~iiFD~DGTL~d~~~~~~~~~~~~~~~~~~~   38 (226)
T PRK13222          7 RAVAFDLDGTLVDSAPDLAAAVNAALAALGLP   38 (226)
T ss_pred             cEEEEcCCcccccCHHHHHHHHHHHHHHCCCC
Confidence            3679999999993221111   2455666654


No 40 
>TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548. All but the Halobacterium sequence currently found are annotated as "Imidazoleglycerol-phosphate dehydratase", however, the source of the annotation could not be traced and significant homology could not be found between any of these sequences and known IGPD's.
Probab=35.48  E-value=13  Score=29.43  Aligned_cols=11  Identities=18%  Similarity=0.534  Sum_probs=9.7

Q ss_pred             eEEeecchhhh
Q psy11336         57 VFIWDLDETII   67 (194)
Q Consensus        57 VFIWDLDETiI   67 (194)
                      ..|||||-|||
T Consensus         2 ~viFD~DGTLi   12 (197)
T TIGR01548         2 ALVLDMDGVMA   12 (197)
T ss_pred             ceEEecCceEE
Confidence            35999999999


No 41 
>PRK09449 dUMP phosphatase; Provisional
Probab=35.42  E-value=19  Score=28.82  Aligned_cols=12  Identities=33%  Similarity=0.628  Sum_probs=10.8

Q ss_pred             eeEEeecchhhh
Q psy11336         56 RVFIWDLDETII   67 (194)
Q Consensus        56 RVFIWDLDETiI   67 (194)
                      +..|||||-|||
T Consensus         4 k~iiFDlDGTLi   15 (224)
T PRK09449          4 DWILFDADETLF   15 (224)
T ss_pred             cEEEEcCCCchh
Confidence            468999999999


No 42 
>PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated
Probab=35.29  E-value=13  Score=34.15  Aligned_cols=22  Identities=32%  Similarity=0.670  Sum_probs=15.5

Q ss_pred             CCCCCCccccceeEEeecchhhh
Q psy11336         45 GSPAGDSRILDRVFIWDLDETII   67 (194)
Q Consensus        45 ~s~p~d~~~~eRVFIWDLDETiI   67 (194)
                      .++.|.++-+ +..|||||-|||
T Consensus       232 ~~~~~~~~m~-k~vIFDlDGTLi  253 (459)
T PRK06698        232 YSSKGENEML-QALIFDMDGTLF  253 (459)
T ss_pred             ccccchHHhh-hheeEccCCcee
Confidence            3445555233 678999999998


No 43 
>TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED. HAD subfamilies caused by an overly broad single model.
Probab=34.89  E-value=14  Score=27.97  Aligned_cols=16  Identities=25%  Similarity=0.434  Sum_probs=13.0

Q ss_pred             eEEeecchhhhHHhhh
Q psy11336         57 VFIWDLDETIIIFHSL   72 (194)
Q Consensus        57 VFIWDLDETiIIfhSL   72 (194)
                      ..|||||-|||=..+.
T Consensus         1 ~vlFDlDgtLv~~~~~   16 (183)
T TIGR01509         1 AILFDLDGVLVDTSSA   16 (183)
T ss_pred             CeeeccCCceechHHH
Confidence            3699999999987654


No 44 
>PRK13226 phosphoglycolate phosphatase; Provisional
Probab=34.23  E-value=18  Score=29.66  Aligned_cols=45  Identities=16%  Similarity=0.240  Sum_probs=25.2

Q ss_pred             eeEEeecchhhhHHhhhccc---hhhhhcCCC---hHHHh-HHHHHHHHHHH
Q psy11336         56 RVFIWDLDETIIIFHSLLTG---SYATKHGKC---PQTVI-QLGYKMEEMIF  100 (194)
Q Consensus        56 RVFIWDLDETiIIfhSLLtG---syA~~~~KD---~~~~v-~lG~rmEemIf  100 (194)
                      +.+|||||-|||=..-+..-   ....+||..   ..... .+|..+++++.
T Consensus        13 k~viFD~DGTL~Ds~~~~~~a~~~~~~~~g~~~~~~~~~~~~~g~~~~~~~~   64 (229)
T PRK13226         13 RAVLFDLDGTLLDSAPDMLATVNAMLAARGRAPITLAQLRPVVSKGARAMLA   64 (229)
T ss_pred             CEEEEcCcCccccCHHHHHHHHHHHHHHCCCCCCCHHHHHHHhhhHHHHHHH
Confidence            56899999999865444333   334556632   11111 24666666554


No 45 
>TIGR02251 HIF-SF_euk Dullard-like phosphatase domain. This domain is related to domains found in FCP1-like phosphatases (TIGR02250), and together both are detected by the Pfam model pfam03031.
Probab=33.73  E-value=16  Score=29.25  Aligned_cols=13  Identities=38%  Similarity=0.636  Sum_probs=10.3

Q ss_pred             eEEeecchhhhHH
Q psy11336         57 VFIWDLDETIIIF   69 (194)
Q Consensus        57 VFIWDLDETiIIf   69 (194)
                      .-|-|||||+|=.
T Consensus         3 ~lvlDLDeTLi~~   15 (162)
T TIGR02251         3 TLVLDLDETLVHS   15 (162)
T ss_pred             EEEEcCCCCcCCC
Confidence            4578999999953


No 46 
>TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like. Subfamily IA includes the enzyme phosphoserine phosphatase (TIGR00338) as well as three hypothetical equivalogs. Many members of these hypothetical equivalogs have been annotated as PSPase-like or PSPase-family proteins. In particular, the hypothetical equivalog which appears to be most closely related to PSPase contains only Archaea (while TIGR00338 contains only eukaryotes and bacteria) of which some are annotated as PSPases. Although this is a reasonable conjecture, none of these sequences has sufficient evidence for this assignment. If such should be found, this model should be retired while the PSPase model should be broadened to include these sequences.
Probab=33.72  E-value=16  Score=27.70  Aligned_cols=15  Identities=33%  Similarity=0.445  Sum_probs=12.0

Q ss_pred             eEEeecchhhhHHhh
Q psy11336         57 VFIWDLDETIIIFHS   71 (194)
Q Consensus        57 VFIWDLDETiIIfhS   71 (194)
                      ++|+|||.||+--.+
T Consensus         1 l~~fD~DgTl~~~~s   15 (177)
T TIGR01488         1 LAIFDFDGTLTRQDS   15 (177)
T ss_pred             CEEecCccccccchh
Confidence            379999999996554


No 47 
>PRK13478 phosphonoacetaldehyde hydrolase; Provisional
Probab=33.60  E-value=19  Score=30.27  Aligned_cols=16  Identities=31%  Similarity=0.443  Sum_probs=13.4

Q ss_pred             eeEEeecchhhhHHhh
Q psy11336         56 RVFIWDLDETIIIFHS   71 (194)
Q Consensus        56 RVFIWDLDETiIIfhS   71 (194)
                      +.+|||||-|||=++.
T Consensus         5 k~vIFDlDGTLiDs~~   20 (267)
T PRK13478          5 QAVIFDWAGTTVDFGS   20 (267)
T ss_pred             EEEEEcCCCCeecCCC
Confidence            5789999999998754


No 48 
>PRK10826 2-deoxyglucose-6-phosphatase; Provisional
Probab=33.36  E-value=25  Score=28.31  Aligned_cols=30  Identities=20%  Similarity=0.155  Sum_probs=20.2

Q ss_pred             eeEEeecchhhhHHhhhccch---hhhhcCCCh
Q psy11336         56 RVFIWDLDETIIIFHSLLTGS---YATKHGKCP   85 (194)
Q Consensus        56 RVFIWDLDETiIIfhSLLtGs---yA~~~~KD~   85 (194)
                      +..|||+|-||+=++....-.   .+..||.+.
T Consensus         8 k~iiFD~DGTL~d~~~~~~~a~~~~~~~~g~~~   40 (222)
T PRK10826          8 LAAIFDMDGLLIDSEPLWDRAELDVMASLGVDI   40 (222)
T ss_pred             cEEEEcCCCCCCcCHHHHHHHHHHHHHHCCCCC
Confidence            567999999998766555543   334567543


No 49 
>PRK10748 flavin mononucleotide phosphatase; Provisional
Probab=33.23  E-value=17  Score=30.08  Aligned_cols=20  Identities=20%  Similarity=0.368  Sum_probs=15.9

Q ss_pred             eeEEeecchhhhHHhhhccc
Q psy11336         56 RVFIWDLDETIIIFHSLLTG   75 (194)
Q Consensus        56 RVFIWDLDETiIIfhSLLtG   75 (194)
                      ++.|+|||.||+=.+..+..
T Consensus        11 k~iiFDlDGTL~D~~~~~~~   30 (238)
T PRK10748         11 SALTFDLDDTLYDNRPVILR   30 (238)
T ss_pred             eeEEEcCcccccCChHHHHH
Confidence            57899999999887665554


No 50 
>TIGR03351 PhnX-like phosphonatase-like hydrolase. This clade of sequences are the closest homologs to the PhnX enzyme, phosphonoacetaldehyde (Pald) hydrolase (phosphonatase, TIGR01422). This phosphonatase-like enzyme and PhnX itself are members of the haloacid dehalogenase (HAD) superfamily (pfam00702) having a a number of distinctive features that set them apart from typical HAD enzymes. The typical HAD N-terminal motif DxDx(T/V) here is DxAGT and the usual conserved lysine prior to the C-terminal motif is instead an arginine. Also distinctive of phosphonatase, and particular to its bi-catalytic mechanism is a conserved lysine in the variable "cap" domain. This lysine forms a Schiff base with the aldehyde of phosphonoacetaldehyde, providing, through the resulting positive charge, a polarization of the C-P bond necesary for cleavage as well as a route to the initial product of cleavage, an ene-amine. The conservation of these elements in this phosphonatase-like enzyme suggests that the
Probab=32.30  E-value=20  Score=28.66  Aligned_cols=20  Identities=15%  Similarity=0.194  Sum_probs=14.3

Q ss_pred             eeEEeecchhhhHHhhhccc
Q psy11336         56 RVFIWDLDETIIIFHSLLTG   75 (194)
Q Consensus        56 RVFIWDLDETiIIfhSLLtG   75 (194)
                      ++.|||||-|||-......-
T Consensus         2 k~iiFD~DGTL~ds~~~~~~   21 (220)
T TIGR03351         2 SLVVLDMAGTTVDEDGLVYR   21 (220)
T ss_pred             cEEEEecCCCeeccCchHHH
Confidence            36799999999975444433


No 51 
>TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic. This enzyme is a member of the Haloacid Dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolase enzymes (pfam00702).
Probab=32.26  E-value=17  Score=28.54  Aligned_cols=11  Identities=36%  Similarity=0.718  Sum_probs=9.5

Q ss_pred             EEeecchhhhH
Q psy11336         58 FIWDLDETIII   68 (194)
Q Consensus        58 FIWDLDETiII   68 (194)
                      .|||||-|||=
T Consensus         1 viFD~DGTL~D   11 (213)
T TIGR01449         1 VLFDLDGTLVD   11 (213)
T ss_pred             CeecCCCcccc
Confidence            38999999984


No 52 
>TIGR00338 serB phosphoserine phosphatase SerB. Phosphoserine phosphatase catalyzes the reaction 3-phospho-serine + H2O = L-serine + phosphate. It catalyzes the last of three steps in the biosynthesis of serine from D-3-phosphoglycerate. Note that this enzyme acts on free phosphoserine, not on phosphoserine residues of phosphoproteins.
Probab=32.24  E-value=20  Score=28.55  Aligned_cols=28  Identities=21%  Similarity=0.360  Sum_probs=19.4

Q ss_pred             ceeEEeecchhhhHHhhhccchhhhhcCCC
Q psy11336         55 DRVFIWDLDETIIIFHSLLTGSYATKHGKC   84 (194)
Q Consensus        55 eRVFIWDLDETiIIfhSLLtGsyA~~~~KD   84 (194)
                      .+++|+|||.||+-..++-  ..++++|+.
T Consensus        14 ~k~iiFD~DGTL~~~~~~~--~l~~~~g~~   41 (219)
T TIGR00338        14 KKLVVFDMDSTLINAETID--EIAKIAGVE   41 (219)
T ss_pred             CCEEEEeCcccCCCchHHH--HHHHHhCCH
Confidence            3589999999999866531  334556653


No 53 
>TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase. Note that SP|P53981 from S. cerevisiae, a member of this family, is annotated as a "probable membrane protein" due to a predicted transmembrane helix. The region in question contains the second of the three conserved HAD superfamily catalytic motifs and thus, considering the fold of the HAD catalytic domain, is unlikely to be a transmembrane region in fact.
Probab=32.07  E-value=22  Score=27.13  Aligned_cols=17  Identities=35%  Similarity=0.317  Sum_probs=13.6

Q ss_pred             eeEEeecchhhhHHhhh
Q psy11336         56 RVFIWDLDETIIIFHSL   72 (194)
Q Consensus        56 RVFIWDLDETiIIfhSL   72 (194)
                      -++|+|+|-|||=+.+.
T Consensus         2 ~~iiFD~dgTL~~~~~~   18 (188)
T TIGR01489         2 VVVVSDFDGTITLNDSD   18 (188)
T ss_pred             eEEEEeCCCcccCCCch
Confidence            37899999999866653


No 54 
>PF06941 NT5C:  5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C);  InterPro: IPR010708 This family consists of several 5' nucleotidase, deoxy (Pyrimidine), and cytosolic type C (NT5C) proteins. 5'(3')-deoxyribonucleotidase is a ubiquitous enzyme in mammalian cells whose physiological function is not known [].; GO: 0016791 phosphatase activity; PDB: 1Z4M_A 1Q92_A 1Q91_A 1Z4J_A 1Z4I_A 1Z4Q_A 1Z4K_A 2JAW_A 1MH9_A 1Z4L_A ....
Probab=31.56  E-value=30  Score=27.81  Aligned_cols=26  Identities=23%  Similarity=0.351  Sum_probs=20.2

Q ss_pred             EeecchhhhHHhhhccchhhhhcCCC
Q psy11336         59 IWDLDETIIIFHSLLTGSYATKHGKC   84 (194)
Q Consensus        59 IWDLDETiIIfhSLLtGsyA~~~~KD   84 (194)
                      .=|||+||.=|.+.+.--|.+.|+++
T Consensus         6 ~iDiDgVLad~~~~~~~~~n~~~~~~   31 (191)
T PF06941_consen    6 AIDIDGVLADFNSAFIEWFNEEFGKN   31 (191)
T ss_dssp             EEESBTTTB-HHHHHHHHHHHHTTTS
T ss_pred             EEECCCCCcccHHHHHHHHHHHcCCC
Confidence            34999999988877777777788877


No 55 
>PRK13223 phosphoglycolate phosphatase; Provisional
Probab=30.02  E-value=24  Score=30.17  Aligned_cols=32  Identities=28%  Similarity=0.432  Sum_probs=20.9

Q ss_pred             cceeEEeecchhhhHHhhhccch---hhhhcCCCh
Q psy11336         54 LDRVFIWDLDETIIIFHSLLTGS---YATKHGKCP   85 (194)
Q Consensus        54 ~eRVFIWDLDETiIIfhSLLtGs---yA~~~~KD~   85 (194)
                      +-.+.|||||.||+=......-.   .+.+||.++
T Consensus        12 ~~k~viFDlDGTL~Ds~~~~~~a~~~~~~~~g~~~   46 (272)
T PRK13223         12 LPRLVMFDLDGTLVDSVPDLAAAVDRMLLELGRPP   46 (272)
T ss_pred             cCCEEEEcCCCccccCHHHHHHHHHHHHHHcCCCC
Confidence            45589999999998654444442   235667553


No 56 
>cd01427 HAD_like Haloacid dehalogenase-like hydrolases. The haloacid dehalogenase-like (HAD) superfamily includes L-2-haloacid dehalogenase, epoxide hydrolase, phosphoserine phosphatase, phosphomannomutase, phosphoglycolate phosphatase, P-type ATPase, and many others, all of which use a nucleophilic aspartate in their phosphoryl transfer reaction. All members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. Members of this superfamily are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.
Probab=29.47  E-value=19  Score=24.77  Aligned_cols=18  Identities=22%  Similarity=0.381  Sum_probs=13.9

Q ss_pred             eEEeecchhhhHHhhhcc
Q psy11336         57 VFIWDLDETIIIFHSLLT   74 (194)
Q Consensus        57 VFIWDLDETiIIfhSLLt   74 (194)
                      ++|.|+|.|++--++.+.
T Consensus         1 ~~vfD~D~tl~~~~~~~~   18 (139)
T cd01427           1 AVLFDLDGTLLDSEPGIA   18 (139)
T ss_pred             CeEEccCCceEccCcccc
Confidence            579999999987775443


No 57 
>TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490. A subset of these sequences, including the Caulobacter crescentus CicA protein, cluster together and may represent a separate equivalog.
Probab=28.67  E-value=19  Score=28.20  Aligned_cols=14  Identities=21%  Similarity=0.368  Sum_probs=11.2

Q ss_pred             EEeecchhhhHHhh
Q psy11336         58 FIWDLDETIIIFHS   71 (194)
Q Consensus        58 FIWDLDETiIIfhS   71 (194)
                      .++|+|+||+=..|
T Consensus         2 a~FD~DgTL~~~~s   15 (202)
T TIGR01490         2 AFFDFDGTLTAKDT   15 (202)
T ss_pred             eEEccCCCCCCCch
Confidence            58999999986444


No 58 
>PLN02770 haloacid dehalogenase-like hydrolase family protein
Probab=28.51  E-value=24  Score=29.54  Aligned_cols=19  Identities=21%  Similarity=0.282  Sum_probs=14.8

Q ss_pred             eeEEeecchhhhHHhhhcc
Q psy11336         56 RVFIWDLDETIIIFHSLLT   74 (194)
Q Consensus        56 RVFIWDLDETiIIfhSLLt   74 (194)
                      +.+|||||-|||=+..+..
T Consensus        23 k~viFDlDGTLiDs~~~~~   41 (248)
T PLN02770         23 EAVLFDVDGTLCDSDPLHY   41 (248)
T ss_pred             CEEEEcCCCccCcCHHHHH
Confidence            5789999999997655443


No 59 
>TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672. Supporting evidence for the inclusion in the HAD superfamily, whose phosphatase members are magnesium dependent, is the inhibition by EDTA and calcium ions, and stimulation by magnesium ion.
Probab=28.41  E-value=26  Score=30.37  Aligned_cols=16  Identities=19%  Similarity=0.445  Sum_probs=12.2

Q ss_pred             eeEEeecchhhhHHhh
Q psy11336         56 RVFIWDLDETIIIFHS   71 (194)
Q Consensus        56 RVFIWDLDETiIIfhS   71 (194)
                      -..|.|||||++=..-
T Consensus        64 ~aViFDlDgTLlDSs~   79 (237)
T TIGR01672        64 IAVSFDIDDTVLFSSP   79 (237)
T ss_pred             eEEEEeCCCccccCcH
Confidence            3789999999765444


No 60 
>PRK13225 phosphoglycolate phosphatase; Provisional
Probab=26.66  E-value=29  Score=30.20  Aligned_cols=30  Identities=20%  Similarity=0.254  Sum_probs=19.2

Q ss_pred             ceeEEeecchhhhHHhhh---ccchhhhhcCCC
Q psy11336         55 DRVFIWDLDETIIIFHSL---LTGSYATKHGKC   84 (194)
Q Consensus        55 eRVFIWDLDETiIIfhSL---LtGsyA~~~~KD   84 (194)
                      -+.+|||||=|||=..-.   ..-..+++||.+
T Consensus        62 ~k~vIFDlDGTLiDS~~~~~~a~~~~~~~~G~~   94 (273)
T PRK13225         62 LQAIIFDFDGTLVDSLPTVVAIANAHAPDFGYD   94 (273)
T ss_pred             cCEEEECCcCccccCHHHHHHHHHHHHHHCCCC
Confidence            557899999998753222   222455677764


No 61 
>cd02188 gamma_tubulin Gamma-tubulin is a ubiquitous phylogenetically conserved member of tubulin superfamily.  Gamma is a low abundance protein present within the cells in both various types of microtubule-organizing centers and cytoplasmic protein complexes.  Gamma-tubulin recruits the alpha/beta-tubulin dimers that form the minus ends of microtubules and is thought to be involved in microtubule nucleation and capping.
Probab=25.73  E-value=84  Score=29.59  Aligned_cols=63  Identities=21%  Similarity=0.342  Sum_probs=38.1

Q ss_pred             CccccceeEEeecchhhhHHhhhccchhhhhcCCC--------------hHHHhHHHHHHHHHHHHhhhhcccccccccc
Q psy11336         50 DSRILDRVFIWDLDETIIIFHSLLTGSYATKHGKC--------------PQTVIQLGYKMEEMIFGVADNHFFFNEVEDC  115 (194)
Q Consensus        50 d~~~~eRVFIWDLDETiIIfhSLLtGsyA~~~~KD--------------~~~~v~lG~rmEemIf~laD~hfFfndlEec  115 (194)
                      +.+.+.|.-+.|||+.+|  +.+++|.+.+.|.++              -..+-..|....+-|.+..++     ++|+|
T Consensus        55 ~~~~~pRav~iD~Ep~vi--~~i~~~~~~~lf~~~~~~~~~~~~gagnnwa~Gy~~g~~~~d~i~d~ir~-----~~E~c  127 (431)
T cd02188          55 DEHYVPRAILIDLEPRVI--NSIQNSEYRNLYNPENIFLSKHGGGAGNNWASGYSQGEEVQEEILDIIDR-----EADGS  127 (431)
T ss_pred             CCccCCcceeccCCcchh--hhhhcCccccccCccceEeeccCCCccccHHHHHHHHHHHHHHHHHHHHH-----HHhcC
Confidence            445678889999999886  455666554444322              222333455666666665553     56888


Q ss_pred             Cccc
Q psy11336        116 DQVH  119 (194)
Q Consensus       116 Dqvh  119 (194)
                      |.+.
T Consensus       128 d~l~  131 (431)
T cd02188         128 DSLE  131 (431)
T ss_pred             CCcc
Confidence            8643


No 62 
>PF03767 Acid_phosphat_B:  HAD superfamily, subfamily IIIB (Acid phosphatase);  InterPro: IPR005519 This family of class B acid phosphatases also contains a number of vegetative storage proteins (VPS25). The acid phosphatase activity of VPS has been experimentally demonstrated [].; GO: 0003993 acid phosphatase activity; PDB: 3PCT_C 2I34_A 2I33_A 1Z5U_D 1Z5G_A 2AUT_C 1Z88_B 3OCV_A 3OCZ_A 3OCX_A ....
Probab=25.44  E-value=34  Score=29.20  Aligned_cols=13  Identities=31%  Similarity=0.756  Sum_probs=11.1

Q ss_pred             ceeEEeecchhhh
Q psy11336         55 DRVFIWDLDETII   67 (194)
Q Consensus        55 eRVFIWDLDETiI   67 (194)
                      ..+-|.|+|||++
T Consensus        72 ~~avv~DIDeTvL   84 (229)
T PF03767_consen   72 PPAVVFDIDETVL   84 (229)
T ss_dssp             EEEEEEESBTTTE
T ss_pred             CcEEEEECCcccc
Confidence            4578999999987


No 63 
>PLN02940 riboflavin kinase
Probab=24.17  E-value=56  Score=29.80  Aligned_cols=32  Identities=28%  Similarity=0.379  Sum_probs=21.3

Q ss_pred             ccceeEEeecchhhhHHhhhccc---hhhhhcCCC
Q psy11336         53 ILDRVFIWDLDETIIIFHSLLTG---SYATKHGKC   84 (194)
Q Consensus        53 ~~eRVFIWDLDETiIIfhSLLtG---syA~~~~KD   84 (194)
                      .+-+..|||||-|||=...+..-   ..+++||+.
T Consensus         9 ~~ik~VIFDlDGTLvDt~~~~~~a~~~~~~~~G~~   43 (382)
T PLN02940          9 KLVSHVILDLDGTLLNTDGIVSDVLKAFLVKYGKQ   43 (382)
T ss_pred             ccCCEEEECCcCcCCcCHHHHHHHHHHHHHHcCCC
Confidence            45677899999999965444433   234667754


No 64 
>PF13041 PPR_2:  PPR repeat family 
Probab=24.16  E-value=90  Score=19.63  Aligned_cols=29  Identities=17%  Similarity=0.452  Sum_probs=19.7

Q ss_pred             hhHHhhhccchhhhhcCCChHHHhHHHHHHHH
Q psy11336         66 IIIFHSLLTGSYATKHGKCPQTVIQLGYKMEE   97 (194)
Q Consensus        66 iIIfhSLLtGsyA~~~~KD~~~~v~lG~rmEe   97 (194)
                      ++.|+.|+.| |+++  .+..++.++-..|.+
T Consensus         3 ~~~yn~li~~-~~~~--~~~~~a~~l~~~M~~   31 (50)
T PF13041_consen    3 VVTYNTLISG-YCKA--GKFEEALKLFKEMKK   31 (50)
T ss_pred             hHHHHHHHHH-HHHC--cCHHHHHHHHHHHHH
Confidence            5678888887 4433  567888777666654


No 65 
>PF13645 YkuD_2:  L,D-transpeptidase catalytic domain
Probab=23.79  E-value=24  Score=30.06  Aligned_cols=34  Identities=29%  Similarity=0.551  Sum_probs=25.4

Q ss_pred             ccceeEEeecchhhhHHhhhcc-----c-hhhhhcCCChH
Q psy11336         53 ILDRVFIWDLDETIIIFHSLLT-----G-SYATKHGKCPQ   86 (194)
Q Consensus        53 ~~eRVFIWDLDETiIIfhSLLt-----G-syA~~~~KD~~   86 (194)
                      .-+|.|||||..-=|++++|.+     | .||++|...+.
T Consensus        47 ~~~R~~v~Dl~~~~~l~~~~VaHG~gsg~~~a~~FSN~~~   86 (176)
T PF13645_consen   47 GEKRFFVIDLKKGKLLYNTLVAHGRGSGNLYATSFSNRPG   86 (176)
T ss_pred             CCCeEEEEECCCCEEEEeeeeecccCCCCCccccCcCCCC
Confidence            4579999999999999887764     3 56777764443


No 66 
>COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only]
Probab=22.97  E-value=37  Score=28.25  Aligned_cols=29  Identities=21%  Similarity=0.196  Sum_probs=20.1

Q ss_pred             eeEEeecchhhhHH---hhhccchhhhhcCCC
Q psy11336         56 RVFIWDLDETIIIF---HSLLTGSYATKHGKC   84 (194)
Q Consensus        56 RVFIWDLDETiIIf---hSLLtGsyA~~~~KD   84 (194)
                      +.+|||||=|||=+   |.-..-..+.+||..
T Consensus         3 ~avIFD~DGvLvDse~~~~~a~~~~~~~~g~~   34 (221)
T COG0637           3 KAVIFDMDGTLVDSEPLHARAWLEALKEYGIE   34 (221)
T ss_pred             cEEEEcCCCCcCcchHHHHHHHHHHHHHcCCC
Confidence            47899999999864   333334556678854


No 67 
>PF15152 Kisspeptin:  Kisspeptin
Probab=22.70  E-value=40  Score=25.84  Aligned_cols=13  Identities=38%  Similarity=0.843  Sum_probs=8.4

Q ss_pred             CCCCCCCCCCCCC
Q psy11336        130 QDLNGYNFSADGF  142 (194)
Q Consensus       130 qDLS~y~F~~Dgf  142 (194)
                      ||||.||++.=|+
T Consensus        63 kdls~YNwNSFGL   75 (78)
T PF15152_consen   63 KDLSAYNWNSFGL   75 (78)
T ss_pred             ccccccccccccc
Confidence            5677777766544


No 68 
>PRK13582 thrH phosphoserine phosphatase; Provisional
Probab=22.63  E-value=44  Score=26.25  Aligned_cols=12  Identities=17%  Similarity=0.509  Sum_probs=11.3

Q ss_pred             eeEEeecchhhh
Q psy11336         56 RVFIWDLDETII   67 (194)
Q Consensus        56 RVFIWDLDETiI   67 (194)
                      +++|+|||=||+
T Consensus         2 ~~v~FD~DGTL~   13 (205)
T PRK13582          2 EIVCLDLEGVLV   13 (205)
T ss_pred             eEEEEeCCCCCh
Confidence            689999999999


No 69 
>KOG0729|consensus
Probab=22.15  E-value=94  Score=29.73  Aligned_cols=40  Identities=28%  Similarity=0.482  Sum_probs=33.7

Q ss_pred             hHHHHHHHHHHHHhhhh----ccccccccccCcccccccccCCC
Q psy11336         89 IQLGYKMEEMIFGVADN----HFFFNEVEDCDQVHIDDISTDDN  128 (194)
Q Consensus        89 v~lG~rmEemIf~laD~----hfFfndlEecDqvhIdDvs~dDn  128 (194)
                      |.-|.||-+-+|++|-+    .+||.++.-.--...||-+-.||
T Consensus       252 vgegarmvrelf~martkkaciiffdeidaiggarfddg~ggdn  295 (435)
T KOG0729|consen  252 VGEGARMVRELFEMARTKKACIIFFDEIDAIGGARFDDGAGGDN  295 (435)
T ss_pred             hhhhHHHHHHHHHHhcccceEEEEeeccccccCccccCCCCCcH
Confidence            55689999999999998    48999998888888888777666


No 70 
>PLN03243 haloacid dehalogenase-like hydrolase; Provisional
Probab=21.96  E-value=41  Score=28.99  Aligned_cols=47  Identities=23%  Similarity=0.241  Sum_probs=27.4

Q ss_pred             eeEEeecchhhhHHh-hhcc---chhhhhcCCChHH--H--hHHHHHHHHHHHHh
Q psy11336         56 RVFIWDLDETIIIFH-SLLT---GSYATKHGKCPQT--V--IQLGYKMEEMIFGV  102 (194)
Q Consensus        56 RVFIWDLDETiIIfh-SLLt---GsyA~~~~KD~~~--~--v~lG~rmEemIf~l  102 (194)
                      +.+|||||-|||=.. .+..   -..+.+||..+..  .  ...|..+.+++..+
T Consensus        25 k~vIFDlDGTLvDS~~~~~~~a~~~~~~~~G~~~~~~e~~~~~~G~~~~~~~~~l   79 (260)
T PLN03243         25 LGVVLEWEGVIVEDDSELERKAWRALAEEEGKRPPPAFLLKRAEGMKNEQAISEV   79 (260)
T ss_pred             eEEEEeCCCceeCCchHHHHHHHHHHHHHcCCCCCHHHHHHHhcCCCHHHHHHHH
Confidence            468999999999653 2222   2455667754321  2  23466666665554


No 71 
>TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase. These appear to be members of the haloacid dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases by general homology and the conservation of all of the recognized catalytic motifs (although the first motif is unusual in the replacement of the more common aspartate with glycine...). The variable domain is found in between motifs 1 and 2, indicating membership in subfamily I and phylogeny and prediction of the alpha helical nature of the variable domain (by PSI-PRED) indicate membership in subfamily IA.
Probab=21.82  E-value=41  Score=26.71  Aligned_cols=14  Identities=14%  Similarity=0.399  Sum_probs=11.7

Q ss_pred             eeEEeecchhhhHH
Q psy11336         56 RVFIWDLDETIIIF   69 (194)
Q Consensus        56 RVFIWDLDETiIIf   69 (194)
                      ++.|+|||.|++=+
T Consensus         3 k~viFDldGtL~d~   16 (211)
T TIGR02247         3 KAVIFDFGGVLLPS   16 (211)
T ss_pred             eEEEEecCCceecC
Confidence            47899999999943


No 72 
>KOG4217|consensus
Probab=20.38  E-value=1.4e+02  Score=30.04  Aligned_cols=20  Identities=35%  Similarity=0.479  Sum_probs=14.9

Q ss_pred             eEEeecchhhhH--Hhhhccch
Q psy11336         57 VFIWDLDETIII--FHSLLTGS   76 (194)
Q Consensus        57 VFIWDLDETiII--fhSLLtGs   76 (194)
                      |.-.+++|+.=|  |-.||||+
T Consensus       399 ~~~~~~tdA~~vqqfy~lLtgs  420 (605)
T KOG4217|consen  399 VPHFSGTDALHVQQFYDLLTGS  420 (605)
T ss_pred             cccccccHHHHHHHHHHHhhhh
Confidence            444677777777  88999993


No 73 
>PF13419 HAD_2:  Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A ....
Probab=20.15  E-value=48  Score=24.16  Aligned_cols=14  Identities=36%  Similarity=0.582  Sum_probs=11.0

Q ss_pred             EEeecchhhhHHhh
Q psy11336         58 FIWDLDETIIIFHS   71 (194)
Q Consensus        58 FIWDLDETiIIfhS   71 (194)
                      .|||||.||+=...
T Consensus         1 iifD~dgtL~d~~~   14 (176)
T PF13419_consen    1 IIFDLDGTLVDTDP   14 (176)
T ss_dssp             EEEESBTTTEEHHH
T ss_pred             cEEECCCCcEeCHH
Confidence            48999999986554


No 74 
>cd02189 delta_tubulin The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa. The alpha- and beta-tubulins are the major components of microtubules, while gamma-tubulin plays a major role in the nucleation of microtubule assembly.  The delta- and epsilon-tubulins are widespread but unlike the alpha, beta, and gamma-tubulins they are not ubiquitous among eukaryotes.  Delta-tubulin plays an essential role in forming the triplet microtubules of centrioles and basal bodies.
Probab=20.01  E-value=86  Score=29.50  Aligned_cols=62  Identities=27%  Similarity=0.347  Sum_probs=35.8

Q ss_pred             CccccceeEEeecchhhhHHhhhccchhhh--hcCCC------------hHHHh-HHHHHHHHHHHHhhhhccccccccc
Q psy11336         50 DSRILDRVFIWDLDETIIIFHSLLTGSYAT--KHGKC------------PQTVI-QLGYKMEEMIFGVADNHFFFNEVED  114 (194)
Q Consensus        50 d~~~~eRVFIWDLDETiIIfhSLLtGsyA~--~~~KD------------~~~~v-~lG~rmEemIf~laD~hfFfndlEe  114 (194)
                      +.+.+.|.-+.|||...|  +.++++.+..  .|.++            -..+- ..|.++.+-|++...     .++|+
T Consensus        50 ~~~~~pRav~iD~ep~vi--~~i~~~~~~~~~~f~~~~~~~~~~gagnnwa~Gy~~~g~~~~~~~~d~ir-----~~~E~  122 (446)
T cd02189          50 DGQPIARSVLVDMEPKVI--ESTLSKSSGGTWKYDKKNVICQQSGSGNNWAYGYYVHGPQIKEDILDLIR-----KEVEK  122 (446)
T ss_pred             CCCcCCceeecCCCchHH--HHhhcCCCCcccccCchheeecCCCCccchhccccccchhhHHHHHHHHH-----HHHHh
Confidence            335788999999999876  6667664321  22111            11110 135666666666555     36788


Q ss_pred             cCcc
Q psy11336        115 CDQV  118 (194)
Q Consensus       115 cDqv  118 (194)
                      ||..
T Consensus       123 cd~~  126 (446)
T cd02189         123 CDSF  126 (446)
T ss_pred             CCCc
Confidence            8764


Done!