Diaphorina citri psyllid: psy11336


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190----
MSPYLEVGGSTSSRGRGRKSSASASNASSAGTPTPIIPNPCPSPGSPAGDSRILDRVFIWDLDETIIIFHSLLTGSYATKHGKCPQTVIQLGYKMEEMIFGVADNHFFFNEVEDCDQVHIDDISTDDNGQDLNGYNFSADGFRASVLNVPSGPPGLCVASGVRGGVDWMRKLAFRYRKIKDIYNNYRNSVYLMC
cccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEECcHHHHHHHHHHccccHHccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccEEEEc
****************************************************ILDRVFIWDLDETIIIFHSLLTGSYATKHGKCPQTVIQLGYKMEEMIFGVADNHFFFNEVEDCDQVHIDDISTDDNGQDLNGYNFSADGFRASVLNVPSGPPGLCVASGVRGGVDWMRKLAFRYRKIKDIYNNYRNSVYLMC
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSPYLEVGGSTSSRGRGRKSSASASNASSAGTPTPIIPNPCPSPGSPAGDSRILDRVFIWDLDETIIIFHSLLTGSYATKHGKCPQTVIQLGYKMEEMIFGVADNHFFFNEVEDCDQVHIDDISTDDNGQDLNGYNFSADGFRASVLNVPSGPPGLCVASGVRGGVDWMRKLAFRYRKIKDIYNNYRNSVYLMC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Developmental protein eyes absent Thought to play a role in transcription regulation during organogenesis through its intrinsic protein phosphatase activity. The phosphatase activity was shown in vitro. Appears to function together with So and Dac in eye development. Required for the survival of eye progenitor cells at a critical stage in morphogenesis.confidentQ05201
Eyes absent homolog 1 Tyrosine phosphatase that specifically dephosphorylates 'Tyr-142' of histone H2AX (H2AXY142ph). 'Tyr-142' phosphorylation of histone H2AX plays a central role in DNA repair and acts as a mark that distinguishes between apoptotic and repair responses to genotoxic stress. Promotes efficient DNA repair by dephosphorylating H2AX, promoting the recruitment of DNA repair complexes containing MDC1. Its function as histone phosphatase probably explains its role in transcription regulation during organogenesis. Seems to coactivate SIX2, SIX4 and SIX5. May be required for normal development of branchial arches, ear and kidney.confidentQ99502
Eyes absent homolog 1 Tyrosine phosphatase that specifically dephosphorylates 'Tyr-142' of histone H2AX (H2AXY142ph). 'Tyr-142' phosphorylation of histone H2AX plays a central role in DNA repair and acts as a mark that distinguishes between apoptotic and repair responses to genotoxic stress. Promotes efficient DNA repair by dephosphorylating H2AX, promoting the recruitment of DNA repair complexes containing MDC1. Its function as histone phosphatase probably explains its role in transcription regulation during organogenesis. Seems to coactivate SIX2, SIX4 and SIX5. May be involved in development of the eye. May play a role in mediating the induction and differentiation of cranial placodes.confidentP97767

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0035335 [BP]peptidyl-tyrosine dephosphorylationprobableGO:0071704, GO:0044267, GO:0044260, GO:0044238, GO:0016311, GO:0006470, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0019538, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0016576 [BP]histone dephosphorylationprobableGO:0016311, GO:0006470, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0016043, GO:0071704, GO:0016570, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0044763, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0019538, GO:0044237, GO:0043170, GO:0006796, GO:0006793, GO:0008150, GO:0016568, GO:0016569
GO:0004725 [MF]protein tyrosine phosphatase activityprobableGO:0016787, GO:0016791, GO:0016788, GO:0042578, GO:0003824, GO:0003674, GO:0004721
GO:0006302 [BP]double-strand break repairprobableGO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:0044699, GO:0006281, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0071600 [BP]otic vesicle morphogenesisprobableGO:0032502, GO:0048562, GO:0048568, GO:0009790, GO:0009653, GO:0007275, GO:0044699, GO:0071599, GO:0048513, GO:0043583, GO:0048598, GO:0009887, GO:0032501, GO:0044767, GO:0008150, GO:0042471, GO:0048839, GO:0042472, GO:0007423, GO:0044707, GO:0048856, GO:0048731
GO:0000287 [MF]magnesium ion bindingprobableGO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0007605 [BP]sensory perception of soundprobableGO:0032501, GO:0044707, GO:0050954, GO:0007600, GO:0008150, GO:0050877, GO:0044699, GO:0003008
GO:0048523 [BP]negative regulation of cellular processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0050793 [BP]regulation of developmental processprobableGO:0008150, GO:0065007, GO:0050789
GO:0010212 [BP]response to ionizing radiationprobableGO:0009314, GO:0050896, GO:0008150, GO:0009628
GO:0008138 [MF]protein tyrosine/serine/threonine phosphatase activityprobableGO:0016787, GO:0016791, GO:0016788, GO:0042578, GO:0003824, GO:0003674, GO:0004721
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0014706 [BP]striated muscle tissue developmentprobableGO:0032502, GO:0048856, GO:0008150, GO:0009888, GO:0060537
GO:0030182 [BP]neuron differentiationprobableGO:0032502, GO:0048699, GO:0009987, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0022008, GO:0007275, GO:0044699, GO:0048856
GO:0007501 [BP]mesodermal cell fate specificationprobableGO:0048598, GO:0007498, GO:0030154, GO:0009790, GO:0009653, GO:0007275, GO:0044699, GO:0001707, GO:0001704, GO:0048869, GO:0001708, GO:0007369, GO:0048729, GO:0048646, GO:0032502, GO:0032501, GO:0048332, GO:0048333, GO:0009987, GO:0009888, GO:0044767, GO:0044763, GO:0001710, GO:0045165, GO:0044707, GO:0048856, GO:0060795, GO:0008150
GO:0042577 [MF]lipid phosphatase activityprobableGO:0016787, GO:0016791, GO:0016788, GO:0042578, GO:0003824, GO:0003674
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0051179 [BP]localizationprobableGO:0008150
GO:0006915 [BP]apoptotic processprobableGO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699
GO:0007507 [BP]heart developmentprobableGO:0032502, GO:0048513, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0072359, GO:0072358, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0004722 [MF]protein serine/threonine phosphatase activityprobableGO:0016787, GO:0016791, GO:0016788, GO:0042578, GO:0003824, GO:0003674, GO:0004721
GO:0045739 [BP]positive regulation of DNA repairprobableGO:0009893, GO:0019222, GO:0031325, GO:0048584, GO:0031323, GO:0045935, GO:0050789, GO:0080090, GO:0010604, GO:0019219, GO:0065007, GO:0048518, GO:0051054, GO:0006282, GO:0051052, GO:0060255, GO:0048583, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:2001020, GO:2001022, GO:0080134, GO:0080135, GO:0048522
GO:0035295 [BP]tube developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0007275, GO:0044699
GO:0016925 [BP]protein sumoylationprobableGO:0071704, GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0032446, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0019204 [MF]nucleotide phosphatase activityprobableGO:0016787, GO:0016791, GO:0016788, GO:0042578, GO:0003824, GO:0003674
GO:0042474 [BP]middle ear morphogenesisprobableGO:0042471, GO:0048598, GO:0009887, GO:0048562, GO:0044707, GO:0007423, GO:0048568, GO:0032501, GO:0048856, GO:0044767, GO:0009790, GO:0048513, GO:0008150, GO:0043583, GO:0048731, GO:0009653, GO:0032502, GO:0007275, GO:0044699
GO:0032993 [CC]protein-DNA complexprobableGO:0005575, GO:0032991

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3GEB, chain A
Confidence level:very confident
Coverage over the Query: 53-142,164-192
View the alignment between query and template
View the model in PyMOL