Diaphorina citri psyllid: psy11343

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150

TQGSISRLEGEEYTETVSLSKVDITLNFQLEVIVMEVKGLKSLAPNRIVYCTMEVEGGEKLQTDQAEASKPMWDTQADFSTNQPLPAIKVKLFTENPGMLALEDKELGKVILRPTPLSSKAPEWHKMLVPKNCADQDLKIKIACRMEKPLNMKHCGYLFAYGKSTWRKWKKRYFVLVQVSQYTFAMCSFKEKKSDPSEFMQLDGYTVDYIEPASEKVSPRDSISQAHIRNASPITRQNSHTDNLDKEVMDPQDSQEKQEEERKRRIQLYVFVSRCIAYPFNSKQSTDMIRRHSKITRHLLEVIQSRFQVPMLHTSIVFLLQAFLRGDTQIMTDEAFQNAVQSYTDVFLKSDRVLNFVQSGACSLYDFREVFRKNIQKRVRSLPEIDGLSKETVLSSWMAKFDCILKVGEEDLKRPNRALQQALNCELILSKEQLYDMFQQILVIKKFEHQLLFNALQLDSADEQTAAIRRELDNLEGGRYFFNAFKESESILYACDDENEYHLWVMAMYRATGQSHKPTPLNSNAVKNSTISKLQGDTDKARKHGMEEFISADPSKMEHSSLFKSLQSLTLEYRLNDPYCSMGWYSPGQLFVLDEYTARYGVRGCYRHLILLDDLLDRSEKNTMIDPTLIHCSFAFCSSHVLGNRPEGVVGTVTQEEKNRFNVIKERLKELLINQITNFRYAFPFGRPEGILKSTLSLLERVLMKDSVTPVQPEEVREVIKKCLETAALINYSKLSSEARVEEDLTAEGGVSPSKKLEDLIHLGELCVDLLQQNEEHYAEAFAWYSDLLVEHAEIFWSLFAVDMDQVLAEQPSDTWDSFPLFQILNEYLRADENLKNGRFHQHLREYFAPLVVRYVDLMESSIAQSIHKGFEKEKWEIKGNGCATSEDLFWKLDALQSFIRDLHWPDQEFNQHLEQRLKLMACDMIESCIMRTESAFQSWLKKGVSFVSTDYIIHSEMCAMINIIADAKNQSLKLCAVDGIDVHQYHIKIDDLIEKTSANMIQGLISKLVAVLENTLAKLSRYDEGSLIGSILSLTNVSGNGKELGQAYVNFSRNNMDQIRSKINDELWILNFFELWYTAQMKVLCNWLSERVDNSLHVYQCNCLSHCVKKMYSDFELQGVMEDKLNSKTYQTVSQRMQTEEATCALTMK

ccccccccccccccccccccccEEEEEEEEEEEEEEEccccccccccEEEEEEEEccccccccccccccccccccccccccccccccEEEEEEcccccccccccccccEEEEEccccccccccccEEcccccccccccEEEEEEEEcccccccccccEEEEcHHHHHHHHHHHHEEEEHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccEEEEEEEccccccccccccHHHHHHHHHcHHHHHHHHHHHccccccccHHHHHHHHHccccccccHHHHHHHHHHHHHHHccHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHcccccccccccccccccccccEEEEEccccHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHccccccccccccccHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHccccHHHHHHHHcHHHHHccccccccccHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHccccccccccHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHcccccCEEcccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHccccc

*****************SLSKVDITLNFQLEVIVMEVKGLKSLAPNRIVYCTMEVE***************MWDTQADFSTNQPLPAIKVKLFTENPGMLALEDKELGKVILRPTPLSSKAPEWHKMLVPKNCADQDLKIKIACRMEKPLNMKHCGYLFAYGKSTWRKWKKRYFVLVQVSQYTFAMCSFK********FMQLDGYTVDYI******************************************************RIQLYVFVSRCIAYPFNSKQSTDMIRRHSKITRHLLEVIQSRFQVPMLHTSIVFLLQAFLRGDTQIMTDEAFQNAVQSYTDVFLKSDRVLNFVQSGACSLYDFREVFRKNIQKRVRSLPEIDGLSKETVLSSWMAKFDCILKVGEEDLKRPNRA***ALNCELILSKEQLYDMFQQILVIKKFEHQLLFNALQLDSADEQTAAIRRELDNLEGGRYFFNAFKESESILYACDDENEYHLWVMAMYRA*************************************FISADPSKMEHSSLFKSLQSLTLEYRLNDPYCSMGWYSPGQLFVLDEYTARYGVRGCYRHLILLDDLLDRSEKNTMIDPTLIHCSFAFCSSHVLGNRPEGVVGTVTQEEKNRFNVIKERLKELLINQITNFRYAFPFGRPEGILKSTLSLLERVLMKDSVTPVQPEEVREVIKKCLETAALINYSKLSS*******************LEDLIHLGELCVDLLQQNEEHYAEAFAWYSDLLVEHAEIFWSLFAVDMDQVLAEQPSDTWDSFPLFQILNEYLRADENLKNGRFHQHLREYFAPLVVRYVDLMESSIAQSIHKGFEKEKWEIKGNGCATSEDLFWKLDALQSFIRDLHWPDQEFNQHLEQRLKLMACDMIESCIMRTESAFQSWLKKGVSFVSTDYIIHSEMCAMINIIADAKNQSLKLCAVDGIDVHQYHIKIDDLIEKTSANMIQGLISKLVAVLENTLAKLSRYDEGSLIGSILSLTNVSGNGKELGQAYVNFSRNNMDQIRSKINDELWILNFFELWYTAQMKVLCNWLSERVDNSLHVYQCNCLSHCVKKMYSDFELQGVMEDKLNSKTYQTVSQRMQTEEATCAL***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Calcium-dependent secretion activator 1	Calcium-binding protein involved in exocytosis of vesicles filled with neurotransmitters and neuropeptides. Probably acts upstream of fusion in the biogenesis or maintenance of mature secretory vesicles. Regulates catecholamine loading of DCVs. May specifically mediate the Ca(2+)-dependent exocytosis of large dense-core vesicles (DCVs) and other dense-core vesicles by acting as a PtdIns(4,5)P2-binding protein that acts at prefusion step following ATP-dependent priming and participates in DCVs-membrane fusion. However, it may also participate in small clear synaptic vesicles (SVs) exocytosis and it is unclear whether its function is related to Ca(2+) triggering.	confident	Q62717
Calcium-dependent secretion activator	Calcium-binding protein involved in exocytosis of vesicles filled with neurotransmitters and neuropeptides. Probably acts upstream of fusion in the biogenesis or maintenance of mature secretory vesicles. May specifically mediate the Ca(2+)-dependent exocytosis of large dense-core vesicles (DCVs) and other dense-core vesicles (By similarity). Specifically required to activate the neuronal G-alpha pathway. Functions with G-alpha proteins from the same motor neurons to regulate locomotion.	confident	Q23658
Calcium-dependent secretion activator	Calcium-binding protein involved in exocytosis of vesicles filled with neurotransmitters and neuropeptides. May specifically mediate the Ca(2+)-dependent exocytosis of large dense-core vesicles (DCVs) and other dense-core vesicles. However, it probably also participate in small clear synaptic vesicles (SVs) exocytosis and it is unclear whether its function is related to Ca(2+) triggering.	confident	Q9NHE5

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0030424 [CC]	axon	probable	GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0043025 [CC]	neuronal cell body	probable	GO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0005509 [MF]	calcium ion binding	probable	GO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0045202 [CC]	synapse	probable	GO:0005575

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WI1, chain A
Confidence level:very confident
Coverage over the Query: 147-214
View the alignment between query and template
View the model in PyMOL

Template: 3SWH, chain A
Confidence level:confident
Coverage over the Query: 846-983,994-1088,1099-1140
View the alignment between query and template
View the model in PyMOL

Template: 1V27, chain A
Confidence level:confident
Coverage over the Query: 19-131
View the alignment between query and template
View the model in PyMOL