Diaphorina citri psyllid: psy11345

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280--
VNGHDGKQLVNKQYNSPVGIYSEESIAETLSAQAEVLAGGVLGVNFKKNEKNYTPANSEVLKMVQEADQEPRSPEPGSGAGGKGGSSGLTTAPRRGRGVLNPQNLAPGARVPLCGQCYQQIRGPFITALGKIWCPDHFLCVRPQCKRPLQDIGFVEEDSGLYCEFCFEQYLAPDCLNAIGKHYHPECFTCAYCGKLFGNNPFFLEEGLPYCENDWNDLFTTKCFACGFPIEAGDRWVEALNNNYHSLCFNCSSPSSPALSGAKPYGTQNTIKSTSGTIVCLE
cccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccEEEccccccccccccccECcccccccHHHHcccccHHHHHcccccccccccccccccccccccccEECccccccHHHHHHHHccccccccccCCccccEEEEcccccccccccccccccccccccccccccccccccccCEECcc
*****************VGIYSEESIAETLSAQAEVL***********************************************************************ARVPLCGQCYQQIRGPFITALGKIWCPDHFLCVRPQCKRPLQDIGFVEEDSGLYCEFCFEQYLAPDCLNAIGKHYHPECFTCAYCGKLFGNNPFFLEEGLPYCENDWNDLFTTKCFACGFPIEAGDRWVEALNNNYHSLCFNCSSPSSPALSGAKPYGTQNTIKSTSGTIVCLE
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VNGHDGKQLVNKQYNSPVGIYSEESIAETLSAQAEVLAGGVLGVNFKKNEKNYTPANSEVLKMVQEADQEPRSPEPGSGAGGKGGSSGLTTAPRRGRGVLNPQNLAPGARVPLCGQCYQQIRGPFITALGKIWCPDHFLCVRPQCKRPLQDIGFVEEDSGLYCEFCFEQYLAPDCLNAIGKHYHPECFTCAYCGKLFGNNPFFLEEGLPYCENDWNDLFTTKCFACGFPIEAGDRWVEALNNNYHSLCFNCSSPSSPALSGAKPYGTQNTIKSTSGTIVCLE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
PDZ and LIM domain protein Zasp Regulator of cell matrix adhesion having two related functions, one upstream of Actn organizing the Z line and the other downstream of integrins regulating assembly of integrin adhesion sites. Also required for the formation of myotendinous junctions in muscles.confidentA1ZA47

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005927 [CC]muscle tendon junctionprobableGO:0070161, GO:0005575, GO:0005912, GO:0005924, GO:0030054, GO:0030055
GO:0030018 [CC]Z discprobableGO:0005737, GO:0005575, GO:0043229, GO:0043232, GO:0044464, GO:0031674, GO:0005623, GO:0005622, GO:0030016, GO:0030017, GO:0044444, GO:0043228, GO:0043292, GO:0044424, GO:0043226, GO:0044422, GO:0044449
GO:0005911 [CC]cell-cell junctionprobableGO:0005575, GO:0030054
GO:0031252 [CC]cell leading edgeprobableGO:0005575, GO:0044464, GO:0005623
GO:0051128 [BP]regulation of cellular component organizationprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0001725 [CC]stress fiberprobableGO:0032432, GO:0005856, GO:0043228, GO:0015629, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0005575, GO:0044424, GO:0043226, GO:0044422, GO:0042641
GO:0007275 [BP]multicellular organismal developmentprobableGO:0032502, GO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0051371 [MF]muscle alpha-actinin bindingprobableGO:0051393, GO:0008092, GO:0003674, GO:0005488, GO:0005515, GO:0042805
GO:0000932 [CC]cytoplasmic mRNA processing bodyprobableGO:0005737, GO:0035770, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0032991, GO:0005622, GO:0043226
GO:0042995 [CC]cell projectionprobableGO:0005575, GO:0044464, GO:0005623
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0055120 [CC]striated muscle dense bodyprobableGO:0005737, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0044444, GO:0043228, GO:0043292, GO:0043226, GO:0044422, GO:0044449
GO:0005925 [CC]focal adhesionprobableGO:0070161, GO:0005575, GO:0005912, GO:0005924, GO:0030054, GO:0030055
GO:0051239 [BP]regulation of multicellular organismal processprobableGO:0008150, GO:0065007, GO:0050789
GO:0035331 [BP]negative regulation of hippo signaling cascadeprobableGO:0009968, GO:0009966, GO:0048585, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0023051, GO:0048519, GO:0010646, GO:0035330, GO:0050789, GO:0048523
GO:0044237 [BP]cellular metabolic processprobableGO:0009987, GO:0008150, GO:0008152
GO:0009967 [BP]positive regulation of signal transductionprobableGO:0009966, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0048522
GO:0044700 [BP]single organism signalingprobableGO:0008150, GO:0023052, GO:0044699
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0061061 [BP]muscle structure developmentprobableGO:0044767, GO:0032502, GO:0048856, GO:0008150, GO:0044699
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0001952 [BP]regulation of cell-matrix adhesionprobableGO:0010810, GO:0030155, GO:0050794, GO:0008150, GO:0065007, GO:0050789
GO:0080090 [BP]regulation of primary metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0003712 [MF]transcription cofactor activityprobableGO:0003674, GO:0000989, GO:0000988
GO:0060255 [BP]regulation of macromolecule metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0001666 [BP]response to hypoxiaprobableGO:0009628, GO:0036293, GO:0050896, GO:0006950, GO:0008150, GO:0070482
GO:0045595 [BP]regulation of cell differentiationprobableGO:0050793, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0031323 [BP]regulation of cellular metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222, GO:0050794
GO:0007154 [BP]cell communicationprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1NYP, chain A
Confidence level:very confident
Coverage over the Query: 160-222
View the alignment between query and template
View the model in PyMOL
Template: 1NYP, chain A
Confidence level:very confident
Coverage over the Query: 111-173
View the alignment between query and template
View the model in PyMOL
Template: 2RGT, chain A
Confidence level:very confident
Coverage over the Query: 112-250
View the alignment between query and template
View the model in PyMOL
Template: 2JTN, chain A
Confidence level:very confident
Coverage over the Query: 158-281
View the alignment between query and template
View the model in PyMOL