Query         psy11352
Match_columns 107
No_of_seqs    222 out of 1181
Neff          10.7
Searched_HMMs 46136
Date          Fri Aug 16 16:12:31 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy11352.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/11352hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus               99.9 1.3E-23 2.9E-28  128.0   3.8   77   12-99    187-264 (279)
  2 KOG2462|consensus               99.9 2.5E-23 5.4E-28  126.8   2.9   87    7-107   156-243 (279)
  3 KOG3623|consensus               99.7 2.5E-18 5.5E-23  116.4  -1.0   84    5-99    887-971 (1007)
  4 KOG3576|consensus               99.6 1.9E-17 4.1E-22   97.7  -3.8   82   11-103   116-198 (267)
  5 PHA00733 hypothetical protein   99.5 3.7E-15   8E-20   83.8   2.5   93    2-103    30-124 (128)
  6 KOG3623|consensus               99.5   9E-16 1.9E-20  104.3  -2.7   84   10-99    238-330 (1007)
  7 KOG3576|consensus               99.5 9.5E-15 2.1E-19   86.4   1.1   93    1-104   133-238 (267)
  8 PHA02768 hypothetical protein;  99.4 1.1E-13 2.4E-18   65.9   1.8   44   51-95      5-48  (55)
  9 KOG1074|consensus               99.3   9E-13   2E-17   91.0   0.4   82   10-103   603-692 (958)
 10 KOG3608|consensus               99.2 4.9E-12 1.1E-16   80.4   1.5   83   12-105   263-348 (467)
 11 KOG1074|consensus               99.1   2E-11 4.3E-16   84.6   2.2   55   50-104   878-933 (958)
 12 KOG3608|consensus               99.1 6.1E-12 1.3E-16   80.0  -2.3   78   12-103   237-316 (467)
 13 PF13465 zf-H2C2_2:  Zinc-finge  99.0 1.1E-10 2.3E-15   48.0   1.6   25   66-90      1-26  (26)
 14 KOG3993|consensus               98.9 1.8E-10 3.9E-15   74.8  -0.9   84   11-105   266-383 (500)
 15 PHA00732 hypothetical protein   98.8 4.1E-09 8.9E-14   54.5   2.5   45   51-100     1-46  (79)
 16 PHA00733 hypothetical protein   98.8 2.6E-09 5.5E-14   60.2   1.6   59    5-76     66-124 (128)
 17 PHA00616 hypothetical protein   98.8   3E-09 6.5E-14   48.5   1.3   33   51-83      1-34  (44)
 18 PHA00616 hypothetical protein   98.7 4.4E-09 9.5E-14   47.9   1.1   29   78-107     1-29  (44)
 19 PLN03086 PRLI-interacting fact  98.7   8E-09 1.7E-13   70.2   2.6   64   10-89    451-515 (567)
 20 PLN03086 PRLI-interacting fact  98.7 1.4E-08 3.1E-13   69.1   3.2   80   11-104   477-566 (567)
 21 PHA02768 hypothetical protein;  98.6 3.4E-09 7.4E-14   50.6  -1.9   44   12-68      5-48  (55)
 22 PF05605 zf-Di19:  Drought indu  98.5 1.7E-07 3.7E-12   45.1   3.8   49   51-102     2-53  (54)
 23 PF00096 zf-C2H2:  Zinc finger,  98.4 1.7E-07 3.8E-12   37.1   2.0   21   79-99      1-21  (23)
 24 PF13894 zf-C2H2_4:  C2H2-type   98.3 3.2E-07   7E-12   36.5   1.8   24   79-102     1-24  (24)
 25 PF00096 zf-C2H2:  Zinc finger,  98.3 2.1E-07 4.5E-12   36.9   0.9   23   52-74      1-23  (23)
 26 PF13912 zf-C2H2_6:  C2H2-type   98.3 4.4E-07 9.5E-12   37.4   1.4   23   78-100     1-23  (27)
 27 PHA00732 hypothetical protein   98.2 3.9E-07 8.4E-12   47.2   0.3   48   12-76      1-49  (79)
 28 PF13912 zf-C2H2_6:  C2H2-type   98.1 2.7E-06 5.8E-11   35.0   1.8   25   51-75      1-25  (27)
 29 KOG3993|consensus               98.1 2.1E-06 4.6E-11   56.4   1.9   59   11-75    294-380 (500)
 30 PF13894 zf-C2H2_4:  C2H2-type   98.0   6E-06 1.3E-10   32.6   2.4   23   52-74      1-23  (24)
 31 PF13465 zf-H2C2_2:  Zinc-finge  98.0 9.8E-08 2.1E-12   39.1  -3.3   20   38-62      6-25  (26)
 32 COG5189 SFP1 Putative transcri  97.8   5E-06 1.1E-10   53.0   0.6   51   49-99    347-419 (423)
 33 PF09237 GAGA:  GAGA factor;  I  97.8 4.6E-05 9.9E-10   35.7   3.1   29   50-78     23-52  (54)
 34 PF12756 zf-C2H2_2:  C2H2 type   97.7 2.3E-05   5E-10   41.9   2.1   72   14-100     1-72  (100)
 35 smart00355 ZnF_C2H2 zinc finge  97.7 4.1E-05 8.9E-10   30.6   2.3   21   79-99      1-21  (26)
 36 COG5189 SFP1 Putative transcri  97.7 1.4E-05   3E-10   51.1   1.2   59   10-71    347-418 (423)
 37 smart00355 ZnF_C2H2 zinc finge  97.7 3.2E-05   7E-10   30.9   1.9   24   52-75      1-24  (26)
 38 PRK04860 hypothetical protein;  97.7 2.6E-05 5.7E-10   45.6   2.1   38   50-91    118-156 (160)
 39 PF09237 GAGA:  GAGA factor;  I  97.6 3.4E-05 7.5E-10   36.1   1.3   27   77-103    23-49  (54)
 40 PF13909 zf-H2C2_5:  C2H2-type   97.5 5.4E-05 1.2E-09   30.1   1.2   23   79-102     1-23  (24)
 41 PF05605 zf-Di19:  Drought indu  97.5   2E-05 4.3E-10   37.9  -0.5   52   12-75      2-53  (54)
 42 PF12874 zf-met:  Zinc-finger o  97.4 0.00015 3.3E-09   29.0   1.7   20   53-72      2-21  (25)
 43 PF12874 zf-met:  Zinc-finger o  97.3 0.00016 3.5E-09   28.9   1.2   22   79-100     1-22  (25)
 44 PF12171 zf-C2H2_jaz:  Zinc-fin  97.2 0.00016 3.5E-09   29.6   1.0   22   79-100     2-23  (27)
 45 PF13909 zf-H2C2_5:  C2H2-type   96.8  0.0012 2.6E-08   26.0   2.0   23   52-75      1-23  (24)
 46 PF12171 zf-C2H2_jaz:  Zinc-fin  96.8 0.00045 9.8E-09   28.2   0.4   22   52-73      2-23  (27)
 47 PF13913 zf-C2HC_2:  zinc-finge  96.6  0.0024 5.2E-08   25.6   1.9   19   80-99      4-22  (25)
 48 smart00451 ZnF_U1 U1-like zinc  96.4  0.0032   7E-08   27.1   1.9   22   78-99      3-24  (35)
 49 smart00451 ZnF_U1 U1-like zinc  95.8  0.0085 1.8E-07   25.7   1.9   22   51-72      3-24  (35)
 50 PRK04860 hypothetical protein;  95.6  0.0021 4.5E-08   37.7  -0.7   40   10-64    117-156 (160)
 51 cd00350 rubredoxin_like Rubred  95.6   0.012 2.7E-07   25.1   1.8   24   52-86      2-25  (33)
 52 KOG2186|consensus               95.1   0.017 3.7E-07   36.2   2.0   25   51-76     29-53  (276)
 53 COG2888 Predicted Zn-ribbon RN  94.7    0.05 1.1E-06   26.4   2.6   33   50-86     26-58  (61)
 54 KOG1146|consensus               94.6   0.023 5.1E-07   43.0   1.9   51   50-100   464-540 (1406)
 55 PF12756 zf-C2H2_2:  C2H2 type   94.6   0.041 8.9E-07   29.1   2.5   25   51-75     50-74  (100)
 56 KOG2893|consensus               94.6  0.0071 1.5E-07   37.6  -0.6   41   54-97     13-53  (341)
 57 COG4049 Uncharacterized protei  94.0   0.037 8.1E-07   26.5   1.4   25   50-74     16-40  (65)
 58 PF09538 FYDLN_acid:  Protein o  94.0   0.066 1.4E-06   29.5   2.5   31   51-91      9-39  (108)
 59 cd00729 rubredoxin_SM Rubredox  94.0   0.064 1.4E-06   23.1   2.0   25   51-86      2-26  (34)
 60 KOG4173|consensus               93.8   0.011 2.4E-07   35.9  -0.8   80   10-103    77-171 (253)
 61 PRK00464 nrdR transcriptional   93.7   0.058 1.3E-06   31.6   2.0   17   51-67     28-44  (154)
 62 PF09986 DUF2225:  Uncharacteri  93.2   0.028   6E-07   34.7   0.2   13   79-91     49-61  (214)
 63 COG5048 FOG: Zn-finger [Genera  93.2   0.025 5.3E-07   37.5  -0.1   53   51-104   289-348 (467)
 64 COG5048 FOG: Zn-finger [Genera  93.0    0.11 2.3E-06   34.5   2.7   64   11-83    288-356 (467)
 65 COG5236 Uncharacterized conser  92.0    0.21 4.6E-06   33.0   3.0   92    2-99    170-272 (493)
 66 TIGR02605 CxxC_CxxC_SSSS putat  91.9   0.078 1.7E-06   24.9   0.8   12   52-63      6-17  (52)
 67 smart00614 ZnF_BED BED zinc fi  91.8    0.18 3.8E-06   23.6   1.9    8   92-99     37-44  (50)
 68 TIGR02098 MJ0042_CXXC MJ0042 f  91.7    0.19 4.1E-06   21.9   1.9   33   52-88      3-35  (38)
 69 smart00834 CxxC_CXXC_SSSS Puta  91.7    0.09 1.9E-06   23.3   0.8   30   51-86      5-34  (41)
 70 smart00659 RPOLCX RNA polymera  91.5     0.2 4.4E-06   22.9   1.9   27   51-87      2-28  (44)
 71 PHA00626 hypothetical protein   91.5    0.22 4.7E-06   23.9   2.0   14   50-63     22-35  (59)
 72 TIGR00622 ssl1 transcription f  91.5    0.23 4.9E-06   27.5   2.4   85   11-100    14-103 (112)
 73 PF13719 zinc_ribbon_5:  zinc-r  91.3    0.14 3.1E-06   22.4   1.3   10   52-61     26-35  (37)
 74 COG1592 Rubrerythrin [Energy p  90.7    0.22 4.7E-06   29.6   2.0   25   50-86    133-157 (166)
 75 PRK00398 rpoP DNA-directed RNA  90.4    0.18   4E-06   23.1   1.2   11   51-61      3-13  (46)
 76 smart00531 TFIIE Transcription  90.1    0.38 8.2E-06   27.9   2.6   37   50-89     98-134 (147)
 77 PF13717 zinc_ribbon_4:  zinc-r  90.1    0.28 6.1E-06   21.3   1.6   13   53-65      4-16  (36)
 78 TIGR00373 conserved hypothetic  89.7     0.4 8.7E-06   28.2   2.5   32   49-88    107-138 (158)
 79 PF02892 zf-BED:  BED zinc fing  89.5    0.25 5.5E-06   22.3   1.3   22   78-99     16-41  (45)
 80 PRK06266 transcription initiat  89.5    0.41 8.8E-06   28.8   2.5   32   50-89    116-147 (178)
 81 PF09723 Zn-ribbon_8:  Zinc rib  89.4    0.14   3E-06   23.1   0.3   12   13-27      6-17  (42)
 82 TIGR02300 FYDLN_acid conserved  89.2    0.28 6.1E-06   27.7   1.5   30   52-91     10-39  (129)
 83 PRK14890 putative Zn-ribbon RN  89.2    0.62 1.3E-05   22.7   2.5   32   50-86     24-56  (59)
 84 smart00734 ZnF_Rad18 Rad18-lik  89.1    0.55 1.2E-05   18.8   2.0   19   80-99      3-21  (26)
 85 smart00440 ZnF_C2C2 C2C2 Zinc   89.1    0.27 5.8E-06   21.9   1.2   13   50-62     27-39  (40)
 86 PF03604 DNA_RNApol_7kD:  DNA d  89.1    0.31 6.6E-06   20.7   1.3   11   77-87     16-26  (32)
 87 PF04959 ARS2:  Arsenite-resist  88.2    0.29 6.3E-06   30.3   1.3   26   78-103    77-102 (214)
 88 COG1997 RPL43A Ribosomal prote  87.7    0.52 1.1E-05   24.8   1.8   11   78-88     53-63  (89)
 89 KOG1146|consensus               87.5    0.33 7.2E-06   37.3   1.4   59    8-72    461-539 (1406)
 90 COG1996 RPC10 DNA-directed RNA  86.8    0.48   1E-05   22.2   1.3   29   50-87      5-33  (49)
 91 PF05290 Baculo_IE-1:  Baculovi  86.3     0.7 1.5E-05   26.4   2.0   13   80-92    123-135 (140)
 92 PF01096 TFIIS_C:  Transcriptio  86.2     0.2 4.2E-06   22.2  -0.2   12   50-61     27-38  (39)
 93 COG3357 Predicted transcriptio  86.2    0.32 6.9E-06   25.8   0.6   27   50-85     57-83  (97)
 94 PF12013 DUF3505:  Protein of u  85.8    0.73 1.6E-05   25.2   1.9   24   79-102    81-108 (109)
 95 TIGR01206 lysW lysine biosynth  85.7     1.2 2.5E-05   21.4   2.3   13   50-62     21-33  (54)
 96 KOG2186|consensus               85.3    0.29 6.3E-06   30.9   0.2   48   50-99      2-49  (276)
 97 PF01927 Mut7-C:  Mut7-C RNAse   84.8     1.9 4.1E-05   25.0   3.4   18   78-95    124-141 (147)
 98 PF10571 UPF0547:  Uncharacteri  84.1    0.65 1.4E-05   18.7   0.9   10   80-89     16-25  (26)
 99 PRK09678 DNA-binding transcrip  83.4    0.73 1.6E-05   23.5   1.1   18   50-67     26-45  (72)
100 KOG4167|consensus               83.2    0.88 1.9E-05   33.2   1.8   26   50-75    791-816 (907)
101 PF14353 CpXC:  CpXC protein     83.2    0.38 8.2E-06   27.1   0.1   55   13-70      2-57  (128)
102 PF05443 ROS_MUCR:  ROS/MUCR tr  82.9    0.86 1.9E-05   26.1   1.4   24   50-76     71-94  (132)
103 PF12013 DUF3505:  Protein of u  82.8     1.4   3E-05   24.1   2.2   27   50-76     79-109 (109)
104 cd00730 rubredoxin Rubredoxin;  82.3       2 4.4E-05   20.2   2.3    6   13-18      2-7   (50)
105 TIGR00244 transcriptional regu  81.5     1.2 2.6E-05   25.9   1.7   18   50-67     27-44  (147)
106 PF08790 zf-LYAR:  LYAR-type C2  81.3    0.75 1.6E-05   18.9   0.6   19   52-71      1-19  (28)
107 PF07754 DUF1610:  Domain of un  81.1     1.6 3.4E-05   17.3   1.5   10   50-59     15-24  (24)
108 COG3677 Transposase and inacti  80.9     1.3 2.8E-05   25.2   1.7   15   50-64     52-66  (129)
109 COG1327 Predicted transcriptio  80.8     1.3 2.9E-05   25.8   1.7   16   50-65     27-42  (156)
110 PF12907 zf-met2:  Zinc-binding  79.0     1.4 3.1E-05   19.7   1.2   27   79-105     2-31  (40)
111 PF04959 ARS2:  Arsenite-resist  77.8     2.4 5.1E-05   26.4   2.2   24   50-73     76-99  (214)
112 PF02176 zf-TRAF:  TRAF-type zi  77.5     2.1 4.5E-05   20.4   1.6   40   50-90      8-54  (60)
113 PRK03824 hypA hydrogenase nick  76.9     1.5 3.4E-05   25.1   1.2   15   50-64     69-83  (135)
114 PF13451 zf-trcl:  Probable zin  76.6     1.7 3.7E-05   20.4   1.1   35   50-85      3-40  (49)
115 COG4888 Uncharacterized Zn rib  76.0     1.5 3.2E-05   23.8   0.9    9   10-18     20-28  (104)
116 COG0068 HypF Hydrogenase matur  75.9     1.4   3E-05   32.1   1.0   57   14-87    125-182 (750)
117 KOG2893|consensus               75.7     0.5 1.1E-05   29.7  -1.1   50   10-75      9-59  (341)
118 KOG2785|consensus               75.6     3.8 8.2E-05   27.6   2.8   51   50-100   165-242 (390)
119 KOG2907|consensus               75.6     2.3 4.9E-05   23.6   1.5   12   78-89    102-113 (116)
120 PF15269 zf-C2H2_7:  Zinc-finge  74.9     2.6 5.6E-05   19.3   1.4   21   79-99     21-41  (54)
121 PF08274 PhnA_Zn_Ribbon:  PhnA   74.7     1.5 3.3E-05   18.3   0.6    9   77-85     18-26  (30)
122 PHA02998 RNA polymerase subuni  74.7       2 4.4E-05   25.8   1.3   10   79-88    172-181 (195)
123 COG1198 PriA Primosomal protei  74.4     4.8  0.0001   29.7   3.3   11   77-87    474-484 (730)
124 PF12760 Zn_Tnp_IS1595:  Transp  74.3     3.5 7.6E-05   18.8   1.9   10   50-59     36-45  (46)
125 COG4530 Uncharacterized protei  73.8       2 4.3E-05   23.7   1.1   27   53-89     11-37  (129)
126 KOG3408|consensus               73.1       2 4.4E-05   24.1   1.0   22   78-99     57-78  (129)
127 smart00154 ZnF_AN1 AN1-like Zi  72.8     2.1 4.5E-05   18.9   0.8   14   78-91     12-25  (39)
128 KOG2482|consensus               72.7     2.3 4.9E-05   28.4   1.3   23   78-100   195-217 (423)
129 PF03811 Zn_Tnp_IS1:  InsA N-te  72.6     6.3 0.00014   17.1   2.3    8   50-57     28-35  (36)
130 KOG2593|consensus               72.2     2.8   6E-05   28.7   1.6   14   50-63    127-140 (436)
131 COG1594 RPB9 DNA-directed RNA   72.1     2.7 5.8E-05   23.3   1.4   36   52-89     73-111 (113)
132 COG1198 PriA Primosomal protei  71.9     3.4 7.4E-05   30.4   2.1   11   50-60    474-484 (730)
133 cd00924 Cyt_c_Oxidase_Vb Cytoc  71.8     1.9 4.1E-05   23.3   0.7   18   72-89     73-90  (97)
134 KOG4167|consensus               71.8    0.52 1.1E-05   34.2  -1.8   24   78-101   792-815 (907)
135 PF01155 HypA:  Hydrogenase exp  71.5     2.7 5.9E-05   23.2   1.3   27   50-87     69-95  (113)
136 PRK14873 primosome assembly pr  71.3     4.8  0.0001   29.4   2.7   23   50-87    409-431 (665)
137 PF11672 DUF3268:  Protein of u  71.2     7.1 0.00015   21.3   2.8    8   11-18      1-8   (102)
138 PLN02294 cytochrome c oxidase   71.1     1.5 3.2E-05   26.2   0.2   21   71-91    134-154 (174)
139 PF00301 Rubredoxin:  Rubredoxi  70.8     1.8 3.9E-05   20.1   0.4   12   52-63      2-13  (47)
140 KOG2785|consensus               70.0     4.7  0.0001   27.2   2.3   24   77-100    67-90  (390)
141 PRK05978 hypothetical protein;  69.4       4 8.6E-05   23.9   1.7   10   53-62     54-63  (148)
142 KOG2593|consensus               69.2     2.1 4.6E-05   29.2   0.6   39    8-60    124-162 (436)
143 PF04810 zf-Sec23_Sec24:  Sec23  69.0     2.9 6.4E-05   18.5   0.9   11   50-60     23-33  (40)
144 PF13878 zf-C2H2_3:  zinc-finge  68.8     5.2 0.00011   17.8   1.7   24   52-75     14-39  (41)
145 TIGR01562 FdhE formate dehydro  68.8     8.3 0.00018   25.4   3.2    8   12-19    184-191 (305)
146 PF07800 DUF1644:  Protein of u  68.3      16 0.00035   21.7   4.0   56   50-107    79-137 (162)
147 PF13453 zf-TFIIB:  Transcripti  68.2       6 0.00013   17.5   1.8   21   50-70     18-38  (41)
148 KOG1842|consensus               68.0       3 6.5E-05   28.8   1.1   22   51-72     15-36  (505)
149 PRK12380 hydrogenase nickel in  67.7     4.4 9.5E-05   22.5   1.6   26   50-86     69-94  (113)
150 PF01363 FYVE:  FYVE zinc finge  66.9     2.5 5.5E-05   20.9   0.5    9   53-61     11-19  (69)
151 cd00065 FYVE FYVE domain; Zinc  66.1     4.9 0.00011   18.9   1.4   10   52-61     19-28  (57)
152 PF01780 Ribosomal_L37ae:  Ribo  65.9     1.6 3.6E-05   23.2  -0.3   11   78-88     53-63  (90)
153 TIGR00100 hypA hydrogenase nic  65.8     5.1 0.00011   22.2   1.6   26   50-86     69-94  (115)
154 PF04780 DUF629:  Protein of un  65.8     4.9 0.00011   28.0   1.8   28   77-104    56-83  (466)
155 PF01428 zf-AN1:  AN1-like Zinc  65.7       2 4.3E-05   19.3  -0.0   15   77-91     12-26  (43)
156 PRK12496 hypothetical protein;  65.0     6.1 0.00013   23.4   1.9   27   51-88    127-153 (164)
157 PF09963 DUF2197:  Uncharacteri  64.6     3.3 7.1E-05   20.0   0.6   36   52-87      3-40  (56)
158 COG3364 Zn-ribbon containing p  64.2     4.4 9.6E-05   22.1   1.1   14   51-64      2-15  (112)
159 PTZ00255 60S ribosomal protein  63.1     5.5 0.00012   21.2   1.4   11   78-88     54-64  (90)
160 PRK00564 hypA hydrogenase nick  61.8     6.4 0.00014   22.0   1.5   27   50-86     70-96  (117)
161 PRK03564 formate dehydrogenase  61.6      14 0.00029   24.5   3.2    9   11-19    186-194 (309)
162 COG4957 Predicted transcriptio  60.4       9 0.00019   22.1   1.9   26   50-78     75-101 (148)
163 smart00064 FYVE Protein presen  59.6     9.1  0.0002   18.8   1.8   10   53-62     12-21  (68)
164 PRK03681 hypA hydrogenase nick  58.6     8.2 0.00018   21.4   1.6   27   50-86     69-95  (114)
165 TIGR00686 phnA alkylphosphonat  58.5     5.8 0.00013   21.9   1.0   14   51-64     19-32  (109)
166 smart00661 RPOL9 RNA polymeras  58.2      18 0.00039   16.5   2.6   15   50-64     19-33  (52)
167 TIGR00280 L37a ribosomal prote  57.9     6.1 0.00013   21.1   1.0   11   78-88     53-63  (91)
168 TIGR01384 TFS_arch transcripti  57.2     7.4 0.00016   21.0   1.3   37   51-89     62-101 (104)
169 PF07975 C1_4:  TFIIH C1-like d  57.0     4.3 9.2E-05   19.2   0.3   26   50-75     20-45  (51)
170 KOG0717|consensus               56.5     6.4 0.00014   27.4   1.1   22   79-100   293-314 (508)
171 COG3091 SprT Zn-dependent meta  56.2     7.6 0.00016   22.8   1.2   34   50-87    116-149 (156)
172 PF04423 Rad50_zn_hook:  Rad50   56.1     4.2 9.1E-05   19.2   0.2   12   80-91     22-33  (54)
173 PRK10220 hypothetical protein;  55.9     8.3 0.00018   21.3   1.3   15   50-64     19-33  (111)
174 PF07503 zf-HYPF:  HypF finger;  55.5     1.5 3.4E-05   18.9  -1.3   11   78-88     21-31  (35)
175 KOG2482|consensus               55.5     7.3 0.00016   26.1   1.2   23   51-73    195-217 (423)
176 TIGR01385 TFSII transcription   55.0      10 0.00022   24.9   1.8   10   52-61    287-296 (299)
177 KOG2636|consensus               54.8     9.1  0.0002   26.6   1.6   23   50-72    400-423 (497)
178 PRK14714 DNA polymerase II lar  54.6      24 0.00051   28.1   3.7   28   50-87    691-718 (1337)
179 KOG0978|consensus               54.5     8.5 0.00018   28.3   1.5   46   51-96    643-696 (698)
180 TIGR00595 priA primosomal prot  54.4      12 0.00027   26.3   2.3    9   51-59    240-248 (505)
181 PF13824 zf-Mss51:  Zinc-finger  53.2      14  0.0003   17.8   1.7   12   50-61     13-24  (55)
182 PF15135 UPF0515:  Uncharacteri  53.1      16 0.00034   23.4   2.3   14   50-63    154-167 (278)
183 COG1773 Rubredoxin [Energy pro  53.0     7.4 0.00016   18.7   0.7   36   50-86      2-44  (55)
184 PRK00432 30S ribosomal protein  52.5      17 0.00037   17.0   1.9    9   52-60     38-46  (50)
185 PF14311 DUF4379:  Domain of un  51.5      21 0.00046   16.7   2.3   16   50-65     27-42  (55)
186 PRK03976 rpl37ae 50S ribosomal  51.0     8.7 0.00019   20.5   0.9   11   78-88     54-64  (90)
187 PF09855 DUF2082:  Nucleic-acid  50.9     7.6 0.00017   19.3   0.6    6   13-18      1-6   (64)
188 PF07282 OrfB_Zn_ribbon:  Putat  50.8      12 0.00025   18.4   1.3   13   77-89     45-57  (69)
189 KOG3507|consensus               50.4      10 0.00022   18.5   1.0   30   50-89     19-48  (62)
190 KOG2071|consensus               50.0     9.3  0.0002   27.4   1.1   24   77-100   417-440 (579)
191 PF09845 DUF2072:  Zn-ribbon co  49.7     8.2 0.00018   22.1   0.7   15   51-65      1-15  (131)
192 TIGR00416 sms DNA repair prote  49.6      19 0.00041   25.1   2.5    9   51-59     21-29  (454)
193 PRK05452 anaerobic nitric oxid  49.5      22 0.00047   25.0   2.8   36   50-86    424-466 (479)
194 PRK11823 DNA repair protein Ra  49.3      20 0.00043   24.9   2.6    7   12-18      7-13  (446)
195 PRK04023 DNA polymerase II lar  49.2      40 0.00086   26.3   4.1   10   78-87    663-672 (1121)
196 PF04606 Ogr_Delta:  Ogr/Delta-  49.1     4.4 9.5E-05   18.6  -0.4   15   50-64     24-40  (47)
197 PRK05580 primosome assembly pr  48.6      16 0.00035   26.8   2.2    9   51-59    421-429 (679)
198 PF10083 DUF2321:  Uncharacteri  48.5      15 0.00032   21.8   1.6   17   50-66     67-83  (158)
199 PF10263 SprT-like:  SprT-like   47.8      12 0.00027   21.5   1.3   32   50-88    122-153 (157)
200 COG1571 Predicted DNA-binding   47.7      15 0.00031   25.4   1.7   15   51-65    367-381 (421)
201 TIGR00515 accD acetyl-CoA carb  47.0      20 0.00043   23.4   2.2   32   51-90     26-57  (285)
202 KOG2071|consensus               46.9      15 0.00031   26.5   1.7   27   49-75    416-442 (579)
203 PRK04351 hypothetical protein;  46.3      15 0.00033   21.5   1.5   34   50-90    111-144 (149)
204 PTZ00448 hypothetical protein;  46.1      18 0.00039   24.6   1.9   23   78-100   314-336 (373)
205 CHL00174 accD acetyl-CoA carbo  45.7      22 0.00047   23.4   2.2   34   50-91     37-70  (296)
206 COG1066 Sms Predicted ATP-depe  45.7      19 0.00041   25.1   2.0    6   13-18      8-13  (456)
207 COG1656 Uncharacterized conser  45.5      16 0.00036   21.8   1.5   20   77-96    129-148 (165)
208 PF04780 DUF629:  Protein of un  45.3      18 0.00039   25.4   1.9   27   50-76     56-83  (466)
209 PTZ00043 cytochrome c oxidase   44.7      11 0.00024   23.7   0.8   18   73-90    176-193 (268)
210 PRK09710 lar restriction allev  44.5      25 0.00054   17.5   1.8   11   50-60     26-36  (64)
211 KOG3362|consensus               44.4     8.4 0.00018   22.4   0.2   23   78-100   129-151 (156)
212 PF01215 COX5B:  Cytochrome c o  44.3     4.8  0.0001   23.2  -0.8   18   73-90    107-124 (136)
213 PF10058 DUF2296:  Predicted in  43.9      35 0.00076   16.3   2.3    8   51-58     44-51  (54)
214 PF06397 Desulfoferrod_N:  Desu  43.8     9.8 0.00021   16.6   0.3   10   51-60      6-15  (36)
215 smart00731 SprT SprT homologue  43.5      26 0.00057   20.1   2.2   12   51-62    112-123 (146)
216 COG4338 Uncharacterized protei  43.4      10 0.00022   17.7   0.4   12   80-91     14-25  (54)
217 KOG2231|consensus               42.7      27 0.00058   25.8   2.4   21   80-100   184-204 (669)
218 COG1326 Uncharacterized archae  42.2      33 0.00071   21.2   2.5   11   78-88     30-40  (201)
219 PF08209 Sgf11:  Sgf11 (transcr  41.5      33 0.00071   14.6   2.7   24   50-74      3-26  (33)
220 PRK14892 putative transcriptio  41.4      41  0.0009   18.3   2.6   12   52-63     43-54  (99)
221 PF06220 zf-U1:  U1 zinc finger  41.3      28 0.00062   15.2   1.6   10   79-88      4-13  (38)
222 KOG0782|consensus               41.1     8.9 0.00019   27.7  -0.0   26   66-91    240-266 (1004)
223 COG1675 TFA1 Transcription ini  40.8      32  0.0007   20.8   2.3   30   50-87    112-141 (176)
224 COG4896 Uncharacterized protei  40.6      15 0.00033   18.1   0.7   12   77-88     30-41  (68)
225 PF10537 WAC_Acf1_DNA_bd:  ATP-  40.6      59  0.0013   17.8   3.1   38   50-87      2-39  (102)
226 PLN02748 tRNA dimethylallyltra  40.4      21 0.00046   25.1   1.7   24   50-73    417-441 (468)
227 PF05129 Elf1:  Transcription e  40.4     6.5 0.00014   20.5  -0.6   12   52-63     47-58  (81)
228 TIGR03830 CxxCG_CxxCG_HTH puta  40.4      17 0.00037   20.1   1.1   21   50-70     30-50  (127)
229 TIGR00143 hypF [NiFe] hydrogen  40.2      11 0.00023   27.9   0.3   59   14-88     92-150 (711)
230 PF07295 DUF1451:  Protein of u  39.9      12 0.00026   21.9   0.4   28   50-86    111-138 (146)
231 PRK06260 threonine synthase; V  39.3      24 0.00052   24.0   1.8   15   50-64     18-32  (397)
232 PF14787 zf-CCHC_5:  GAG-polypr  39.2      18 0.00038   15.8   0.8   14   53-66      4-17  (36)
233 PF11931 DUF3449:  Domain of un  39.1      10 0.00022   23.3   0.0   23   10-34     99-121 (196)
234 COG2331 Uncharacterized protei  38.9     4.1 8.9E-05   21.0  -1.4   13   12-27     12-24  (82)
235 cd01121 Sms Sms (bacterial rad  38.4      18 0.00039   24.5   1.1   10   51-60     14-23  (372)
236 PRK05654 acetyl-CoA carboxylas  38.2      27 0.00059   22.9   1.8   31   51-89     27-57  (292)
237 PF15616 TerY-C:  TerY-C metal   38.1      20 0.00044   20.6   1.1   11   77-87    104-114 (131)
238 PRK00762 hypA hydrogenase nick  37.9      21 0.00046   20.1   1.2   32   50-86     69-100 (124)
239 PF10276 zf-CHCC:  Zinc-finger   37.7      24 0.00051   15.7   1.1   12   50-61     28-39  (40)
240 TIGR00627 tfb4 transcription f  37.7      36 0.00077   22.2   2.3   26   50-88    254-279 (279)
241 COG5188 PRP9 Splicing factor 3  37.7      22 0.00047   24.1   1.3   22   50-71    373-395 (470)
242 PF01286 XPA_N:  XPA protein N-  37.6      29 0.00062   14.9   1.3   13   14-29      5-17  (34)
243 KOG3214|consensus               37.3      19 0.00041   19.6   0.9   13   52-64     48-60  (109)
244 PF07649 C1_3:  C1-like domain;  37.1      31 0.00067   13.9   1.4    9   51-59     15-23  (30)
245 PF05180 zf-DNL:  DNL zinc fing  36.3     4.1 8.9E-05   20.4  -1.6   34   51-87      4-38  (66)
246 PF05191 ADK_lid:  Adenylate ki  36.3      17 0.00037   15.7   0.5   30   52-89      2-32  (36)
247 COG0675 Transposase and inacti  36.1      21 0.00045   23.1   1.1   14   77-90    321-334 (364)
248 TIGR00310 ZPR1_znf ZPR1 zinc f  35.4     9.3  0.0002   23.4  -0.5   12   51-62     30-41  (192)
249 cd02341 ZZ_ZZZ3 Zinc finger, Z  34.6      55  0.0012   15.1   2.2    8   51-58     15-22  (48)
250 PLN03238 probable histone acet  33.5      60  0.0013   21.4   2.8   23   50-72     47-69  (290)
251 KOG3352|consensus               33.4      19 0.00042   21.1   0.6   18   73-90    128-145 (153)
252 PF02591 DUF164:  Putative zinc  33.2      45 0.00098   15.7   1.8   31   53-87     24-55  (56)
253 PRK00420 hypothetical protein;  33.0      33 0.00072   19.1   1.4    9   52-60     41-49  (112)
254 PRK08222 hydrogenase 4 subunit  32.6      38 0.00083   20.4   1.8   19   77-95    113-131 (181)
255 smart00132 LIM Zinc-binding do  32.2      35 0.00077   13.9   1.2    9   52-60     28-36  (39)
256 COG4306 Uncharacterized protei  32.0      20 0.00042   20.5   0.4   16   50-65     67-82  (160)
257 COG5151 SSL1 RNA polymerase II  31.8      70  0.0015   21.5   2.9   23   77-99    387-409 (421)
258 PRK07591 threonine synthase; V  31.1      37 0.00081   23.4   1.7    9   52-60     34-42  (421)
259 PF10071 DUF2310:  Zn-ribbon-co  31.0      26 0.00057   22.6   0.9   32   50-87    219-250 (258)
260 TIGR00319 desulf_FeS4 desulfof  30.9      35 0.00075   14.2   1.1   12   50-61      6-17  (34)
261 PF10013 DUF2256:  Uncharacteri  30.8      48   0.001   15.0   1.5   16   53-68     10-25  (42)
262 COG4391 Uncharacterized protei  30.7      21 0.00045   17.6   0.3   37   50-89     23-59  (62)
263 PF14599 zinc_ribbon_6:  Zinc-r  30.6      17 0.00037   17.9   0.1   14   52-65     31-44  (61)
264 cd00974 DSRD Desulforedoxin (D  30.3      37  0.0008   14.2   1.1   12   50-61      3-14  (34)
265 KOG1994|consensus               30.3      24 0.00052   22.4   0.6   21   77-97    238-258 (268)
266 PRK06450 threonine synthase; V  30.1      38 0.00082   22.6   1.6   10   52-61     19-28  (338)
267 PF11023 DUF2614:  Protein of u  30.1      45 0.00097   18.7   1.6   31   50-91     68-98  (114)
268 KOG4118|consensus               29.7      27  0.0006   17.4   0.7   28   78-105    38-65  (74)
269 PRK01343 zinc-binding protein;  29.3      37 0.00081   16.5   1.1   10   79-88     10-19  (57)
270 KOG1280|consensus               29.3      67  0.0014   21.8   2.5   37   49-85     77-116 (381)
271 PF14255 Cys_rich_CPXG:  Cystei  29.2      29 0.00062   16.5   0.7    9   80-88      2-10  (52)
272 PF11789 zf-Nse:  Zinc-finger o  29.2      61  0.0013   15.5   1.8   31   50-83     23-53  (57)
273 TIGR03831 YgiT_finger YgiT-typ  29.2      26 0.00056   15.4   0.5   13   51-63     32-44  (46)
274 COG2995 PqiA Uncharacterized p  28.9      84  0.0018   21.8   2.9   34   10-62     16-49  (418)
275 PRK14138 NAD-dependent deacety  28.3   1E+02  0.0022   19.6   3.2   34   50-86    118-151 (244)
276 KOG4727|consensus               28.3      49  0.0011   20.0   1.6   23   50-72     74-96  (193)
277 PF14690 zf-ISL3:  zinc-finger   28.2      33 0.00071   15.2   0.8   10   77-86      1-10  (47)
278 PF05876 Terminase_GpA:  Phage   28.2      80  0.0017   22.8   2.9   14   50-63    228-241 (557)
279 PF06524 NOA36:  NOA36 protein;  27.9      16 0.00034   23.6  -0.4   20   77-96    208-227 (314)
280 PF14447 Prok-RING_4:  Prokaryo  27.9      32 0.00069   16.6   0.7   11   80-90     41-51  (55)
281 COG5112 UFD2 U1-like Zn-finger  27.8      20 0.00044   19.7   0.0   21   79-99     56-76  (126)
282 PF03833 PolC_DP2:  DNA polymer  27.6      20 0.00044   27.1   0.0    7   80-86    694-700 (900)
283 PF08792 A2L_zn_ribbon:  A2L zi  27.1      32 0.00069   14.6   0.6   10   52-61     22-31  (33)
284 COG4332 Uncharacterized protei  27.0      24 0.00052   21.5   0.2   44   13-63     18-61  (203)
285 PF04032 Rpr2:  RNAse P Rpr2/Rp  26.8      31 0.00066   17.6   0.6    9   10-18     44-52  (85)
286 PF03145 Sina:  Seven in absent  26.8      62  0.0014   19.6   2.0   53   50-104    13-73  (198)
287 PF02150 RNA_POL_M_15KD:  RNA p  26.6      13 0.00029   15.9  -0.7   10   53-62     22-31  (35)
288 TIGR03829 YokU_near_AblA uncha  26.2      46 0.00099   17.8   1.2   22   51-72     35-56  (89)
289 PF09332 Mcm10:  Mcm10 replicat  26.1      19 0.00041   24.2  -0.3   14   51-64    252-265 (344)
290 COG1779 C4-type Zn-finger prot  26.1      15 0.00032   22.7  -0.7   11   52-62     44-54  (201)
291 PLN03239 histone acetyltransfe  25.8      47   0.001   22.5   1.4   23   77-99    105-127 (351)
292 COG1998 RPS31 Ribosomal protei  25.3      66  0.0014   15.2   1.5    8   52-59     38-45  (51)
293 PF13901 DUF4206:  Domain of un  25.2 1.1E+02  0.0024   18.8   2.9   14   50-63    171-184 (202)
294 PRK12387 formate hydrogenlyase  25.1      52  0.0011   19.7   1.4   18   77-94    113-130 (180)
295 PLN00104 MYST -like histone ac  25.1      68  0.0015   22.6   2.1   23   77-99    197-219 (450)
296 cd01327 KAZAL_PSTI Kazal-type   24.9      41 0.00089   15.1   0.8   16   16-31     11-26  (45)
297 PF06170 DUF983:  Protein of un  24.1      41 0.00089   17.7   0.8   12   79-90      9-20  (86)
298 PF02146 SIR2:  Sir2 family;  I  23.7 1.1E+02  0.0023   18.2   2.6   35   50-87    104-138 (178)
299 PF02891 zf-MIZ:  MIZ/SP-RING z  23.7      34 0.00074   15.9   0.4   10   77-86     40-49  (50)
300 PF14446 Prok-RING_1:  Prokaryo  23.6      35 0.00076   16.4   0.4   12   79-90      6-17  (54)
301 PF03107 C1_2:  C1 domain;  Int  23.3      55  0.0012   13.2   1.0    9   79-87      1-9   (30)
302 KOG2807|consensus               23.2      85  0.0018   21.2   2.2   19   78-96    290-308 (378)
303 PF08271 TF_Zn_Ribbon:  TFIIB z  23.0      48   0.001   14.6   0.8   10   52-61     20-29  (43)
304 PF14375 Cys_rich_CWC:  Cystein  22.6      50  0.0011   15.2   0.8    9   81-89      1-9   (50)
305 cd01410 SIRT7 SIRT7: Eukaryoti  22.4 1.4E+02  0.0029   18.5   2.9   34   50-86     94-128 (206)
306 PTZ00064 histone acetyltransfe  22.2      95   0.002   22.4   2.3   24   77-100   279-302 (552)
307 PRK08270 anaerobic ribonucleos  22.2      65  0.0014   23.9   1.6   10   77-86    638-647 (656)
308 PF14369 zf-RING_3:  zinc-finge  21.7      49  0.0011   14.1   0.7    8   81-88     24-31  (35)
309 KOG2857|consensus               21.7      50  0.0011   19.3   0.8   21   12-35     17-37  (157)
310 PF12230 PRP21_like_P:  Pre-mRN  21.5      31 0.00067   21.5   0.0   26   50-76    167-192 (229)
311 cd01413 SIR2_Af2 SIR2_Af2: Arc  21.5 1.4E+02  0.0029   18.6   2.8   33   50-86    112-144 (222)
312 PF03966 Trm112p:  Trm112p-like  21.0      43 0.00093   16.5   0.4   14   50-63     52-65  (68)
313 COG2879 Uncharacterized small   20.8 1.1E+02  0.0024   15.2   1.8   16   90-105    24-39  (65)
314 PF02748 PyrI_C:  Aspartate car  20.7      70  0.0015   15.1   1.1   15   50-64     34-48  (52)
315 COG1439 Predicted nucleic acid  20.7      61  0.0013   19.7   1.1   25   50-87    138-162 (177)
316 PF04328 DUF466:  Protein of un  20.4   1E+02  0.0022   15.3   1.7   15   93-107    27-41  (65)
317 PF12773 DZR:  Double zinc ribb  20.3      65  0.0014   14.5   1.0   10   78-87     29-38  (50)
318 KOG4477|consensus               20.1      57  0.0012   20.0   0.9   23   50-85     23-45  (228)
319 PF01844 HNH:  HNH endonuclease  20.0      19 0.00041   15.9  -0.9   11   54-64      1-11  (47)
320 PRK11032 hypothetical protein;  20.0      41 0.00089   20.0   0.3   28   51-87    124-151 (160)

No 1  
>KOG2462|consensus
Probab=99.88  E-value=1.3e-23  Score=128.00  Aligned_cols=77  Identities=27%  Similarity=0.379  Sum_probs=40.3

Q ss_pred             cccCCCCCCCCCccCCCCCCCCCCCCCCCCCCCCCCCCCeeeCCCCcccccchhhHHHHHhhhCC-CcccCCCCCCcccC
Q psy11352         12 FLISDHCLTSPLSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQLSNQYNLRVHMETHQN-AFYACSSCSHVSRS   90 (107)
Q Consensus        12 ~~~C~~C~~~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~-k~~~C~~C~~~f~~   90 (107)
                      +++|.+|   ++.|..+..|.-|   .++|+|+     +||.|+.|++.|...++|+.|+++|.+ |+|+|..|+|.|+.
T Consensus       187 ~c~C~iC---GKaFSRPWLLQGH---iRTHTGE-----KPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl  255 (279)
T KOG2462|consen  187 PCECGIC---GKAFSRPWLLQGH---IRTHTGE-----KPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFAL  255 (279)
T ss_pred             Ccccccc---cccccchHHhhcc---cccccCC-----CCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHH
Confidence            4455555   5555555555555   5555555     555555555555555555555555555 55555555555555


Q ss_pred             hHHHHHHHH
Q psy11352         91 RDALRKHVS   99 (107)
Q Consensus        91 ~~~l~~H~~   99 (107)
                      .+.|.+|..
T Consensus       256 ~SyLnKH~E  264 (279)
T KOG2462|consen  256 KSYLNKHSE  264 (279)
T ss_pred             HHHHHHhhh
Confidence            555555543


No 2  
>KOG2462|consensus
Probab=99.87  E-value=2.5e-23  Score=126.85  Aligned_cols=87  Identities=22%  Similarity=0.374  Sum_probs=80.3

Q ss_pred             CCCcccccCCCCCCCCCccCCCCCCCCCCCCCCCCCCCCCCCCCeeeCCCCcccccchhhHHHHHhhhCC-CcccCCCCC
Q psy11352          7 PSTLHFLISDHCLTSPLSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQLSNQYNLRVHMETHQN-AFYACSSCS   85 (107)
Q Consensus         7 ~~~~~~~~C~~C~~~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~-k~~~C~~C~   85 (107)
                      -...+.+.|++|   ++.+.+...|+.|   .++|+..       ++|.+|||.|...=-|+.|+|+|+| |||.|+.|+
T Consensus       156 ~~s~ka~~C~~C---~K~YvSmpALkMH---irTH~l~-------c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~  222 (279)
T KOG2462|consen  156 LDSKKAFSCKYC---GKVYVSMPALKMH---IRTHTLP-------CECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCG  222 (279)
T ss_pred             ccccccccCCCC---CceeeehHHHhhH---hhccCCC-------cccccccccccchHHhhcccccccCCCCccCCccc
Confidence            344788999999   9999999999999   8888854       9999999999999999999999999 999999999


Q ss_pred             CcccChHHHHHHHHccCCCCCC
Q psy11352         86 HVSRSRDALRKHVSYRHPHISP  107 (107)
Q Consensus        86 ~~f~~~~~l~~H~~~~H~~ekp  107 (107)
                      ++|...++|+.||+| |.+.|+
T Consensus       223 kAFADRSNLRAHmQT-HS~~K~  243 (279)
T KOG2462|consen  223 KAFADRSNLRAHMQT-HSDVKK  243 (279)
T ss_pred             chhcchHHHHHHHHh-hcCCcc
Confidence            999999999999998 887764


No 3  
>KOG3623|consensus
Probab=99.68  E-value=2.5e-18  Score=116.39  Aligned_cols=84  Identities=15%  Similarity=0.292  Sum_probs=78.6

Q ss_pred             cCCCCcccccCCCCCCCCCccCCCCCCCCCCCCCCCCCCCCCCCCCeeeCCCCcccccchhhHHHHHhhhCC-CcccCCC
Q psy11352          5 YKPSTLHFLISDHCLTSPLSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQLSNQYNLRVHMETHQN-AFYACSS   83 (107)
Q Consensus         5 ~~~~~~~~~~C~~C~~~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~-k~~~C~~   83 (107)
                      ++....-.|.|+.|   .+.|...++|.+|   .-.|+|.     +||.|.+|.|.|..+..|..|+|.|.| |||+|+.
T Consensus       887 ~~kte~gmyaCDqC---DK~FqKqSSLaRH---KYEHsGq-----RPyqC~iCkKAFKHKHHLtEHkRLHSGEKPfQCdK  955 (1007)
T KOG3623|consen  887 HAKTEDGMYACDQC---DKAFQKQSSLARH---KYEHSGQ-----RPYQCIICKKAFKHKHHLTEHKRLHSGEKPFQCDK  955 (1007)
T ss_pred             cccCccccchHHHH---HHHHHhhHHHHHh---hhhhcCC-----CCcccchhhHhhhhhhhhhhhhhhccCCCcchhhh
Confidence            33444668999999   9999999999999   8899999     999999999999999999999999999 9999999


Q ss_pred             CCCcccChHHHHHHHH
Q psy11352         84 CSHVSRSRDALRKHVS   99 (107)
Q Consensus        84 C~~~f~~~~~l~~H~~   99 (107)
                      |+|.|+..+...+||.
T Consensus       956 ClKRFSHSGSYSQHMN  971 (1007)
T KOG3623|consen  956 CLKRFSHSGSYSQHMN  971 (1007)
T ss_pred             hhhhcccccchHhhhc
Confidence            9999999999999996


No 4  
>KOG3576|consensus
Probab=99.59  E-value=1.9e-17  Score=97.69  Aligned_cols=82  Identities=21%  Similarity=0.370  Sum_probs=52.9

Q ss_pred             ccccCCCCCCCCCccCCCCCCCCCCCCCCCCCCCCCCCCCeeeCCCCcccccchhhHHHHHhhhCC-CcccCCCCCCccc
Q psy11352         11 HFLISDHCLTSPLSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQLSNQYNLRVHMETHQN-AFYACSSCSHVSR   89 (107)
Q Consensus        11 ~~~~C~~C~~~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~-k~~~C~~C~~~f~   89 (107)
                      ..|.|..|   ++.|....-|.+|   +.-|...     +.+.|..||+.|.....|++|+++|+| +||+|..|+++|.
T Consensus       116 d~ftCrvC---gK~F~lQRmlnrh---~kch~~v-----kr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaft  184 (267)
T KOG3576|consen  116 DSFTCRVC---GKKFGLQRMLNRH---LKCHSDV-----KRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFT  184 (267)
T ss_pred             Ceeeeehh---hhhhhHHHHHHHH---hhhccHH-----HHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHH
Confidence            34666666   6666666666666   6666655     666666666666666666666666666 6666666666666


Q ss_pred             ChHHHHHHHHccCC
Q psy11352         90 SRDALRKHVSYRHP  103 (107)
Q Consensus        90 ~~~~l~~H~~~~H~  103 (107)
                      +.-.|..|.+.+|.
T Consensus       185 qrcsleshl~kvhg  198 (267)
T KOG3576|consen  185 QRCSLESHLKKVHG  198 (267)
T ss_pred             hhccHHHHHHHHcC
Confidence            66666666665453


No 5  
>PHA00733 hypothetical protein
Probab=99.53  E-value=3.7e-15  Score=83.77  Aligned_cols=93  Identities=18%  Similarity=0.208  Sum_probs=72.5

Q ss_pred             ccccCCCCcccccCCCCCCCCCccCCCCCCCCCCC--CCCCCCCCCCCCCCeeeCCCCcccccchhhHHHHHhhhCCCcc
Q psy11352          2 NFHYKPSTLHFLISDHCLTSPLSSSIPGSSKTKAS--GSGTTGGSSNHSKLFATCFVCGKQLSNQYNLRVHMETHQNAFY   79 (107)
Q Consensus         2 ~~h~~~~~~~~~~C~~C~~~~~~~~~~~~l~~h~~--~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~k~~   79 (107)
                      .+|.=+...+++.|..|   ...|..+..|..+..  ......+.     .+|.|+.|++.|.....|..|++.+. .+|
T Consensus        30 ~~~~~~~~~~~~~~~~~---~~~~~~~~~l~~~~~l~~~~~~~~~-----kPy~C~~Cgk~Fss~s~L~~H~r~h~-~~~  100 (128)
T PHA00733         30 RYHSLTPEQKRLIRAVV---KTLIYNPQLLDESSYLYKLLTSKAV-----SPYVCPLCLMPFSSSVSLKQHIRYTE-HSK  100 (128)
T ss_pred             hhhcCChhhhhHHHHHH---hhhccChhhhcchHHHHhhcccCCC-----CCccCCCCCCcCCCHHHHHHHHhcCC-cCc
Confidence            34555667889999999   888887776665411  01112224     78999999999999999999998763 579


Q ss_pred             cCCCCCCcccChHHHHHHHHccCC
Q psy11352         80 ACSSCSHVSRSRDALRKHVSYRHP  103 (107)
Q Consensus        80 ~C~~C~~~f~~~~~l~~H~~~~H~  103 (107)
                      .|..|++.|.....|..|+...|.
T Consensus       101 ~C~~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733        101 VCPVCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             cCCCCCCccCCHHHHHHHHHHhcC
Confidence            999999999999999999986553


No 6  
>KOG3623|consensus
Probab=99.49  E-value=9e-16  Score=104.31  Aligned_cols=84  Identities=14%  Similarity=0.234  Sum_probs=72.1

Q ss_pred             cccccCCCCCCCCCccCCCCCCCCCCCCCCCCCCC--------CCCCCCeeeCCCCcccccchhhHHHHHhhhCC-Cccc
Q psy11352         10 LHFLISDHCLTSPLSSSIPGSSKTKASGSGTTGGS--------SNHSKLFATCFVCGKQLSNQYNLRVHMETHQN-AFYA   80 (107)
Q Consensus        10 ~~~~~C~~C~~~~~~~~~~~~l~~h~~~~~~~~~~--------~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~-k~~~   80 (107)
                      +.-|.|..|   ..+|..+..|.+|   +..|...        .....+.|+|.+|||.|..+..|+.|+|+|.| |||.
T Consensus       238 e~nfsC~lC---sytFAyRtQLErh---m~~hkpg~dqa~sltqsa~lRKFKCtECgKAFKfKHHLKEHlRIHSGEKPfe  311 (1007)
T KOG3623|consen  238 EPNFSCMLC---SYTFAYRTQLERH---MQLHKPGGDQAISLTQSALLRKFKCTECGKAFKFKHHLKEHLRIHSGEKPFE  311 (1007)
T ss_pred             CCCCcchhh---hhhhhhHHHHHHH---HHhhcCCCcccccccchhhhccccccccchhhhhHHHHHhhheeecCCCCcC
Confidence            456889999   9999999999988   6655432        11224679999999999999999999999999 9999


Q ss_pred             CCCCCCcccChHHHHHHHH
Q psy11352         81 CSSCSHVSRSRDALRKHVS   99 (107)
Q Consensus        81 C~~C~~~f~~~~~l~~H~~   99 (107)
                      |+.|+|.|+..+.+..||.
T Consensus       312 CpnCkKRFSHSGSySSHmS  330 (1007)
T KOG3623|consen  312 CPNCKKRFSHSGSYSSHMS  330 (1007)
T ss_pred             CcccccccccCCccccccc
Confidence            9999999999999988875


No 7  
>KOG3576|consensus
Probab=99.48  E-value=9.5e-15  Score=86.41  Aligned_cols=93  Identities=22%  Similarity=0.403  Sum_probs=81.8

Q ss_pred             CccccCCCC-cccccCCCCCCCCCccCCCCCCCCCCCCCCCCCCCCCCCCCeeeCCCCcccccchhhHHHHHh-hhC---
Q psy11352          1 MNFHYKPST-LHFLISDHCLTSPLSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQLSNQYNLRVHME-THQ---   75 (107)
Q Consensus         1 ~~~h~~~~~-~~~~~C~~C~~~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~-~h~---   75 (107)
                      ||.|+|-.. ++.|.|..|   ++.|...-.|++|   .++|++.     +||+|..|++.|...-+|..|.+ +|.   
T Consensus       133 lnrh~kch~~vkr~lct~c---gkgfndtfdlkrh---~rthtgv-----rpykc~~c~kaftqrcsleshl~kvhgv~~  201 (267)
T KOG3576|consen  133 LNRHLKCHSDVKRHLCTFC---GKGFNDTFDLKRH---TRTHTGV-----RPYKCSLCEKAFTQRCSLESHLKKVHGVQH  201 (267)
T ss_pred             HHHHhhhccHHHHHHHhhc---cCcccchhhhhhh---hccccCc-----cccchhhhhHHHHhhccHHHHHHHHcCchH
Confidence            467888554 899999999   9999999999999   9999999     99999999999999999999976 342   


Q ss_pred             -------C-CcccCCCCCCcccChHHHHHHHHccCCC
Q psy11352         76 -------N-AFYACSSCSHVSRSRDALRKHVSYRHPH  104 (107)
Q Consensus        76 -------~-k~~~C~~C~~~f~~~~~l~~H~~~~H~~  104 (107)
                             . |-|.|+.||.+-.....+..|++.+|..
T Consensus       202 ~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp~  238 (267)
T KOG3576|consen  202 QYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHHPF  238 (267)
T ss_pred             HHHHHHhhhheeeecccCCCCCChhHHHHHHHhcCCC
Confidence                   2 5799999999988999999999987754


No 8  
>PHA02768 hypothetical protein; Provisional
Probab=99.40  E-value=1.1e-13  Score=65.94  Aligned_cols=44  Identities=18%  Similarity=0.363  Sum_probs=40.6

Q ss_pred             eeeCCCCcccccchhhHHHHHhhhCCCcccCCCCCCcccChHHHH
Q psy11352         51 FATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHVSRSRDALR   95 (107)
Q Consensus        51 ~~~C~~C~~~f~~~~~l~~H~~~h~~k~~~C~~C~~~f~~~~~l~   95 (107)
                      .|+|+.||+.|.....|..|+++|+ ++|+|..|++.|.+.+.|.
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~-k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN-TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC-CcccCCcccceecccceeE
Confidence            4899999999999999999999999 7999999999999887764


No 9  
>KOG1074|consensus
Probab=99.26  E-value=9e-13  Score=90.96  Aligned_cols=82  Identities=22%  Similarity=0.375  Sum_probs=75.9

Q ss_pred             cccccCCCCCCCCCccCCCCCCCCCCCCCCCCCCCCCCCCCeeeCCCCcccccchhhHHHHHhhhCCC-----cccCC--
Q psy11352         10 LHFLISDHCLTSPLSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQLSNQYNLRVHMETHQNA-----FYACS--   82 (107)
Q Consensus        10 ~~~~~C~~C~~~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~k-----~~~C~--   82 (107)
                      ..|-.|-.|   .+....++.|+.|   .+.|+++     +||+|.+||+.|.++.+|+.|+.+|..+     ++.|+  
T Consensus       603 TdPNqCiiC---~rVlSC~saLqmH---yrtHtGE-----RPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~  671 (958)
T KOG1074|consen  603 TDPNQCIIC---LRVLSCPSALQMH---YRTHTGE-----RPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPST  671 (958)
T ss_pred             CCccceeee---eecccchhhhhhh---hhcccCc-----CccccccccchhccccchhhcccccccCccccccccCCch
Confidence            457889999   9999999999999   9999999     9999999999999999999999999852     68899  


Q ss_pred             -CCCCcccChHHHHHHHHccCC
Q psy11352         83 -SCSHVSRSRDALRKHVSYRHP  103 (107)
Q Consensus        83 -~C~~~f~~~~~l~~H~~~~H~  103 (107)
                       +|-+.|...-.|..|+++ |.
T Consensus       672 ~ic~~kftn~V~lpQhIri-H~  692 (958)
T KOG1074|consen  672 FICQKKFTNAVTLPQHIRI-HL  692 (958)
T ss_pred             hhhcccccccccccceEEe-ec
Confidence             999999999999999997 66


No 10 
>KOG3608|consensus
Probab=99.20  E-value=4.9e-12  Score=80.44  Aligned_cols=83  Identities=19%  Similarity=0.318  Sum_probs=40.0

Q ss_pred             cccCCCCCCCCCccCCCCCCCCCCCCCCC-CCCCCCCCCCeeeCCCCcccccchhhHHHHHhhhCCCcccCCC--CCCcc
Q psy11352         12 FLISDHCLTSPLSSSIPGSSKTKASGSGT-TGGSSNHSKLFATCFVCGKQLSNQYNLRVHMETHQNAFYACSS--CSHVS   88 (107)
Q Consensus        12 ~~~C~~C~~~~~~~~~~~~l~~h~~~~~~-~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~k~~~C~~--C~~~f   88 (107)
                      -|+|+-|   .+.....++|..|   ++. |..+     ++|+|+.|++.|.+.+.|.+|..+|....|+|+.  |...|
T Consensus       263 ~ykCplC---dmtc~~~ssL~~H---~r~rHs~d-----kpfKCd~Cd~~c~~esdL~kH~~~HS~~~y~C~h~~C~~s~  331 (467)
T KOG3608|consen  263 CYKCPLC---DMTCSSASSLTTH---IRYRHSKD-----KPFKCDECDTRCVRESDLAKHVQVHSKTVYQCEHPDCHYSV  331 (467)
T ss_pred             ccccccc---ccCCCChHHHHHH---HHhhhccC-----CCccccchhhhhccHHHHHHHHHhccccceecCCCCCcHHH
Confidence            3455555   5555555555544   322 2333     4555555555555555555555555443444544  44444


Q ss_pred             cChHHHHHHHHccCCCC
Q psy11352         89 RSRDALRKHVSYRHPHI  105 (107)
Q Consensus        89 ~~~~~l~~H~~~~H~~e  105 (107)
                      .+...+.+|++.+|.|.
T Consensus       332 r~~~q~~~H~~evhEg~  348 (467)
T KOG3608|consen  332 RTYTQMRRHFLEVHEGN  348 (467)
T ss_pred             HHHHHHHHHHHHhccCC
Confidence            44445555555444443


No 11 
>KOG1074|consensus
Probab=99.14  E-value=2e-11  Score=84.55  Aligned_cols=55  Identities=31%  Similarity=0.518  Sum_probs=50.8

Q ss_pred             CeeeCCCCcccccchhhHHHHHhhhCC-CcccCCCCCCcccChHHHHHHHHccCCC
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHMETHQN-AFYACSSCSHVSRSRDALRKHVSYRHPH  104 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~~h~~-k~~~C~~C~~~f~~~~~l~~H~~~~H~~  104 (107)
                      ..+.|.+||+.|.....|..|+++|++ |||.|..|++.|....+|+.||.+|+..
T Consensus       878 n~h~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFttrgnLKvHMgtH~w~  933 (958)
T KOG1074|consen  878 NAHVCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFTTRGNLKVHMGTHMWV  933 (958)
T ss_pred             chhhhccchhcccchHHHHHhhhcCCCCCCccchhhhhhhhhhhhhhhhhcccccc
Confidence            347899999999999999999999999 9999999999999999999999985543


No 12 
>KOG3608|consensus
Probab=99.07  E-value=6.1e-12  Score=80.02  Aligned_cols=78  Identities=19%  Similarity=0.289  Sum_probs=54.8

Q ss_pred             cccCCCCCCCCCccCCCCCCCCCCCCCCCCCCCCCCCCCeeeCCCCcccccchhhHHHHHhh-hCC-CcccCCCCCCccc
Q psy11352         12 FLISDHCLTSPLSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQLSNQYNLRVHMET-HQN-AFYACSSCSHVSR   89 (107)
Q Consensus        12 ~~~C~~C~~~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~-h~~-k~~~C~~C~~~f~   89 (107)
                      +|.|..|   .+.|.+...|..|   +..|.       ..|+|+.|+.+....++|..|++. |.. +||+|+.|.+.|.
T Consensus       237 ~fqC~~C---~KrFaTeklL~~H---v~rHv-------n~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~  303 (467)
T KOG3608|consen  237 SFQCAQC---FKRFATEKLLKSH---VVRHV-------NCYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCV  303 (467)
T ss_pred             chHHHHH---HHHHhHHHHHHHH---HHHhh-------hcccccccccCCCChHHHHHHHHhhhccCCCccccchhhhhc
Confidence            4444444   4444444444444   33333       347888888888888888888875 666 8999999999888


Q ss_pred             ChHHHHHHHHccCC
Q psy11352         90 SRDALRKHVSYRHP  103 (107)
Q Consensus        90 ~~~~l~~H~~~~H~  103 (107)
                      +.+.|.+|..+ |.
T Consensus       304 ~esdL~kH~~~-HS  316 (467)
T KOG3608|consen  304 RESDLAKHVQV-HS  316 (467)
T ss_pred             cHHHHHHHHHh-cc
Confidence            88899998885 65


No 13 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=99.04  E-value=1.1e-10  Score=48.04  Aligned_cols=25  Identities=40%  Similarity=0.703  Sum_probs=22.6

Q ss_pred             hHHHHHhhhCC-CcccCCCCCCcccC
Q psy11352         66 NLRVHMETHQN-AFYACSSCSHVSRS   90 (107)
Q Consensus        66 ~l~~H~~~h~~-k~~~C~~C~~~f~~   90 (107)
                      +|..|+++|++ +||.|+.|++.|.+
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEESS
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeCc
Confidence            47899999999 99999999999864


No 14 
>KOG3993|consensus
Probab=98.89  E-value=1.8e-10  Score=74.78  Aligned_cols=84  Identities=20%  Similarity=0.222  Sum_probs=59.2

Q ss_pred             ccccCCCCCCCCCccCCCCCCCCCCCCCCCCCCCCCCCCCeeeCCCCcccccchhhHHHHHhhhC--------C-C----
Q psy11352         11 HFLISDHCLTSPLSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQLSNQYNLRVHMETHQ--------N-A----   77 (107)
Q Consensus        11 ~~~~C~~C~~~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~--------~-k----   77 (107)
                      .-|+|.-|   -..|...-.|.+|   .-...-.     ..|.|++|+|+|+-..+|..|.++|.        + .    
T Consensus       266 GdyiCqLC---K~kYeD~F~LAQH---rC~RIV~-----vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~  334 (500)
T KOG3993|consen  266 GDYICQLC---KEKYEDAFALAQH---RCPRIVH-----VEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQ  334 (500)
T ss_pred             HHHHHHHH---HHhhhhHHHHhhc---cCCeeEE-----eeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhh
Confidence            34777777   7777777777777   3333333     45778888888887777877777763        1 1    


Q ss_pred             ---------------------cccCCCCCCcccChHHHHHHHHccCCCC
Q psy11352         78 ---------------------FYACSSCSHVSRSRDALRKHVSYRHPHI  105 (107)
Q Consensus        78 ---------------------~~~C~~C~~~f~~~~~l~~H~~~~H~~e  105 (107)
                                           -|.|..|++.|.+...|+.|+.+||..+
T Consensus       335 ~~~~rae~~ea~rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~~~  383 (500)
T KOG3993|consen  335 AVETRAEVQEAERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQRAP  383 (500)
T ss_pred             hhhhhhhhhhccccCCcccCceeecHHhhhhhHHHHHHHHhHHhhhccc
Confidence                                 2778899999999989999988766543


No 15 
>PHA00732 hypothetical protein
Probab=98.80  E-value=4.1e-09  Score=54.50  Aligned_cols=45  Identities=24%  Similarity=0.563  Sum_probs=28.0

Q ss_pred             eeeCCCCcccccchhhHHHHHhh-hCCCcccCCCCCCcccChHHHHHHHHc
Q psy11352         51 FATCFVCGKQLSNQYNLRVHMET-HQNAFYACSSCSHVSRSRDALRKHVSY  100 (107)
Q Consensus        51 ~~~C~~C~~~f~~~~~l~~H~~~-h~~k~~~C~~C~~~f~~~~~l~~H~~~  100 (107)
                      +|.|+.|++.|.....|..|++. |.  ++.|+.|++.|.   .+..|.++
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~--~~~C~~CgKsF~---~l~~H~~~   46 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT--LTKCPVCNKSYR---RLNQHFYS   46 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC--CCccCCCCCEeC---Chhhhhcc
Confidence            35677777777777777777663 43  346777777766   35556543


No 16 
>PHA00733 hypothetical protein
Probab=98.78  E-value=2.6e-09  Score=60.23  Aligned_cols=59  Identities=22%  Similarity=0.257  Sum_probs=49.0

Q ss_pred             cCCCCcccccCCCCCCCCCccCCCCCCCCCCCCCCCCCCCCCCCCCeeeCCCCcccccchhhHHHHHhhhCC
Q psy11352          5 YKPSTLHFLISDHCLTSPLSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQLSNQYNLRVHMETHQN   76 (107)
Q Consensus         5 ~~~~~~~~~~C~~C~~~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~   76 (107)
                      +.....+||.|+.|   ++.|.....|..|   +..+  .     .++.|+.|++.|.....|..|+....+
T Consensus        66 ~~~~~~kPy~C~~C---gk~Fss~s~L~~H---~r~h--~-----~~~~C~~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733         66 LTSKAVSPYVCPLC---LMPFSSSVSLKQH---IRYT--E-----HSKVCPVCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             cccCCCCCccCCCC---CCcCCCHHHHHHH---HhcC--C-----cCccCCCCCCccCCHHHHHHHHHHhcC
Confidence            33445789999999   9999999999999   6654  2     458999999999999999999876543


No 17 
>PHA00616 hypothetical protein
Probab=98.77  E-value=3e-09  Score=48.50  Aligned_cols=33  Identities=12%  Similarity=0.281  Sum_probs=24.0

Q ss_pred             eeeCCCCcccccchhhHHHHHhhhCC-CcccCCC
Q psy11352         51 FATCFVCGKQLSNQYNLRVHMETHQN-AFYACSS   83 (107)
Q Consensus        51 ~~~C~~C~~~f~~~~~l~~H~~~h~~-k~~~C~~   83 (107)
                      +|.|..||+.|...+.|..|++.|++ +++.|+.
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~~   34 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLEY   34 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCccceeE
Confidence            46777777777777777777777777 7776653


No 18 
>PHA00616 hypothetical protein
Probab=98.72  E-value=4.4e-09  Score=47.95  Aligned_cols=29  Identities=17%  Similarity=0.432  Sum_probs=25.6

Q ss_pred             cccCCCCCCcccChHHHHHHHHccCCCCCC
Q psy11352         78 FYACSSCSHVSRSRDALRKHVSYRHPHISP  107 (107)
Q Consensus        78 ~~~C~~C~~~f~~~~~l~~H~~~~H~~ekp  107 (107)
                      ||+|+.||+.|...++|..|++. |.|++|
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~-~hg~~~   29 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLS-VHKQNK   29 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHH-hcCCCc
Confidence            68999999999999999999996 667664


No 19 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.72  E-value=8e-09  Score=70.25  Aligned_cols=64  Identities=14%  Similarity=0.290  Sum_probs=37.4

Q ss_pred             cccccCCCCCCCCCccCCCCCCCCCCCCCCCCCCCCCCCCCeeeCCCCcccccchhhHHHHHhhhCC-CcccCCCCCCcc
Q psy11352         10 LHFLISDHCLTSPLSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQLSNQYNLRVHMETHQN-AFYACSSCSHVS   88 (107)
Q Consensus        10 ~~~~~C~~C~~~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~-k~~~C~~C~~~f   88 (107)
                      .+.+.|+.|   +..|. ...+..|   +..+.       +++.|+ ||+.+ ....|..|+.+|.. +++.|+.|++.|
T Consensus       451 ~~H~~C~~C---gk~f~-~s~LekH---~~~~H-------kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v  514 (567)
T PLN03086        451 KNHVHCEKC---GQAFQ-QGEMEKH---MKVFH-------EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMV  514 (567)
T ss_pred             ccCccCCCC---CCccc-hHHHHHH---HHhcC-------CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCcc
Confidence            445667777   66664 3445666   44432       346666 66544 44566666666666 666666666666


Q ss_pred             c
Q psy11352         89 R   89 (107)
Q Consensus        89 ~   89 (107)
                      .
T Consensus       515 ~  515 (567)
T PLN03086        515 Q  515 (567)
T ss_pred             c
Confidence            3


No 20 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.69  E-value=1.4e-08  Score=69.08  Aligned_cols=80  Identities=16%  Similarity=0.221  Sum_probs=64.0

Q ss_pred             ccccCCCCCCCCCccCCCCCCCCCCCCCCCCCCCCCCCCCeeeCCCCcccccc----------hhhHHHHHhhhCCCccc
Q psy11352         11 HFLISDHCLTSPLSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQLSN----------QYNLRVHMETHQNAFYA   80 (107)
Q Consensus        11 ~~~~C~~C~~~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~~----------~~~l~~H~~~h~~k~~~   80 (107)
                      +++.|+ |   +..+ ....|..|   ...+-+.     +++.|..|++.+..          ...|..|..+...+++.
T Consensus       477 kpv~Cp-C---g~~~-~R~~L~~H---~~thCp~-----Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~CG~rt~~  543 (567)
T PLN03086        477 EPLQCP-C---GVVL-EKEQMVQH---QASTCPL-----RLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESICGSRTAP  543 (567)
T ss_pred             CCccCC-C---CCCc-chhHHHhh---hhccCCC-----CceeCCCCCCccccCccccchhhhhhhHHHHHHhcCCcceE
Confidence            789999 9   7654 56888889   7778888     99999999998852          34788998886339999


Q ss_pred             CCCCCCcccChHHHHHHHHccCCC
Q psy11352         81 CSSCSHVSRSRDALRKHVSYRHPH  104 (107)
Q Consensus        81 C~~C~~~f~~~~~l~~H~~~~H~~  104 (107)
                      |..||+.|... .|..|+..+|..
T Consensus       544 C~~Cgk~Vrlr-dm~~H~~~~h~~  566 (567)
T PLN03086        544 CDSCGRSVMLK-EMDIHQIAVHQK  566 (567)
T ss_pred             ccccCCeeeeh-hHHHHHHHhhcC
Confidence            99999988765 578888877753


No 21 
>PHA02768 hypothetical protein; Provisional
Probab=98.56  E-value=3.4e-09  Score=50.61  Aligned_cols=44  Identities=9%  Similarity=-0.182  Sum_probs=38.8

Q ss_pred             cccCCCCCCCCCccCCCCCCCCCCCCCCCCCCCCCCCCCeeeCCCCcccccchhhHH
Q psy11352         12 FLISDHCLTSPLSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQLSNQYNLR   68 (107)
Q Consensus        12 ~~~C~~C~~~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~   68 (107)
                      -|.|+.|   ++.|.....|..|   ++.|.       ++++|..|++.|...+.|.
T Consensus         5 ~y~C~~C---GK~Fs~~~~L~~H---~r~H~-------k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          5 GYECPIC---GEIYIKRKSMITH---LRKHN-------TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             ccCcchh---CCeeccHHHHHHH---HHhcC-------CcccCCcccceecccceeE
Confidence            5899999   9999999999999   98887       3589999999998877654


No 22 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.54  E-value=1.7e-07  Score=45.14  Aligned_cols=49  Identities=33%  Similarity=0.539  Sum_probs=38.9

Q ss_pred             eeeCCCCcccccchhhHHHHHhh-hCC--CcccCCCCCCcccChHHHHHHHHccC
Q psy11352         51 FATCFVCGKQLSNQYNLRVHMET-HQN--AFYACSSCSHVSRSRDALRKHVSYRH  102 (107)
Q Consensus        51 ~~~C~~C~~~f~~~~~l~~H~~~-h~~--k~~~C~~C~~~f~~~~~l~~H~~~~H  102 (107)
                      .|.|+.|++. .+...|..|... |..  +.+.|++|...+.  .+|..|+...|
T Consensus         2 ~f~CP~C~~~-~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    2 SFTCPYCGKG-FSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             CcCCCCCCCc-cCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            4899999994 556789999765 554  6899999998654  48999998766


No 23 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.44  E-value=1.7e-07  Score=37.13  Aligned_cols=21  Identities=29%  Similarity=0.760  Sum_probs=11.3

Q ss_pred             ccCCCCCCcccChHHHHHHHH
Q psy11352         79 YACSSCSHVSRSRDALRKHVS   99 (107)
Q Consensus        79 ~~C~~C~~~f~~~~~l~~H~~   99 (107)
                      |.|+.|++.|.....|..|++
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~   21 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMR   21 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHh
Confidence            345555555555555555554


No 24 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.35  E-value=3.2e-07  Score=36.47  Aligned_cols=24  Identities=33%  Similarity=0.779  Sum_probs=13.8

Q ss_pred             ccCCCCCCcccChHHHHHHHHccC
Q psy11352         79 YACSSCSHVSRSRDALRKHVSYRH  102 (107)
Q Consensus        79 ~~C~~C~~~f~~~~~l~~H~~~~H  102 (107)
                      |.|+.|++.|.....|..|+.++|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            456666666666666666666543


No 25 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.32  E-value=2.1e-07  Score=36.90  Aligned_cols=23  Identities=43%  Similarity=0.868  Sum_probs=21.4

Q ss_pred             eeCCCCcccccchhhHHHHHhhh
Q psy11352         52 ATCFVCGKQLSNQYNLRVHMETH   74 (107)
Q Consensus        52 ~~C~~C~~~f~~~~~l~~H~~~h   74 (107)
                      |.|+.|++.|.+...|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            68999999999999999999875


No 26 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=98.28  E-value=4.4e-07  Score=37.37  Aligned_cols=23  Identities=30%  Similarity=0.551  Sum_probs=15.0

Q ss_pred             cccCCCCCCcccChHHHHHHHHc
Q psy11352         78 FYACSSCSHVSRSRDALRKHVSY  100 (107)
Q Consensus        78 ~~~C~~C~~~f~~~~~l~~H~~~  100 (107)
                      ||.|..|++.|....+|..|++.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~   23 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRS   23 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCT
T ss_pred             CCCCCccCCccCChhHHHHHhHH
Confidence            45666666666666666666664


No 27 
>PHA00732 hypothetical protein
Probab=98.18  E-value=3.9e-07  Score=47.17  Aligned_cols=48  Identities=17%  Similarity=0.276  Sum_probs=38.8

Q ss_pred             cccCCCCCCCCCccCCCCCCCCCCCCCCC-CCCCCCCCCCeeeCCCCcccccchhhHHHHHhhhCC
Q psy11352         12 FLISDHCLTSPLSSSIPGSSKTKASGSGT-TGGSSNHSKLFATCFVCGKQLSNQYNLRVHMETHQN   76 (107)
Q Consensus        12 ~~~C~~C~~~~~~~~~~~~l~~h~~~~~~-~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~   76 (107)
                      ||.|+.|   ++.|.....|..|   +.. +.+        +.|+.|++.|.   .+..|......
T Consensus         1 py~C~~C---gk~F~s~s~Lk~H---~r~~H~~--------~~C~~CgKsF~---~l~~H~~~~~~   49 (79)
T PHA00732          1 MFKCPIC---GFTTVTLFALKQH---ARRNHTL--------TKCPVCNKSYR---RLNQHFYSQYD   49 (79)
T ss_pred             CccCCCC---CCccCCHHHHHHH---hhcccCC--------CccCCCCCEeC---ChhhhhcccCC
Confidence            6899999   9999999999999   763 432        47999999998   47788865554


No 28 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=98.08  E-value=2.7e-06  Score=34.95  Aligned_cols=25  Identities=36%  Similarity=0.513  Sum_probs=22.8

Q ss_pred             eeeCCCCcccccchhhHHHHHhhhC
Q psy11352         51 FATCFVCGKQLSNQYNLRVHMETHQ   75 (107)
Q Consensus        51 ~~~C~~C~~~f~~~~~l~~H~~~h~   75 (107)
                      +|.|+.|++.|.+...|..|++.|.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            5899999999999999999998765


No 29 
>KOG3993|consensus
Probab=98.07  E-value=2.1e-06  Score=56.40  Aligned_cols=59  Identities=25%  Similarity=0.295  Sum_probs=47.3

Q ss_pred             ccccCCCCCCCCCccCCCCCCCCCCCCCCCCCCCC------------C----------------CCCCeeeCCCCccccc
Q psy11352         11 HFLISDHCLTSPLSSSIPGSSKTKASGSGTTGGSS------------N----------------HSKLFATCFVCGKQLS   62 (107)
Q Consensus        11 ~~~~C~~C~~~~~~~~~~~~l~~h~~~~~~~~~~~------------~----------------~~~~~~~C~~C~~~f~   62 (107)
                      --|+|++|   ++.|..+.+|..|   .+.|...+            .                ...-.|.|..|++.|.
T Consensus       294 vEYrCPEC---~KVFsCPANLASH---RRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~rsg~dss~gi~~C~~C~KkFr  367 (500)
T KOG3993|consen  294 VEYRCPEC---DKVFSCPANLASH---RRWHKPRPEAAKAGSPPPKQAVETRAEVQEAERSGDDSSSGIFSCHTCGKKFR  367 (500)
T ss_pred             eeecCCcc---cccccCchhhhhh---hcccCCchhhhhcCCCChhhhhhhhhhhhhccccCCcccCceeecHHhhhhhH
Confidence            36999999   9999999999998   66653210            0                1123699999999999


Q ss_pred             chhhHHHHHhhhC
Q psy11352         63 NQYNLRVHMETHQ   75 (107)
Q Consensus        63 ~~~~l~~H~~~h~   75 (107)
                      +...|+.|+.+|.
T Consensus       368 RqAYLrKHqlthq  380 (500)
T KOG3993|consen  368 RQAYLRKHQLTHQ  380 (500)
T ss_pred             HHHHHHHhHHhhh
Confidence            9999999988775


No 30 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.04  E-value=6e-06  Score=32.63  Aligned_cols=23  Identities=43%  Similarity=0.863  Sum_probs=19.4

Q ss_pred             eeCCCCcccccchhhHHHHHhhh
Q psy11352         52 ATCFVCGKQLSNQYNLRVHMETH   74 (107)
Q Consensus        52 ~~C~~C~~~f~~~~~l~~H~~~h   74 (107)
                      |.|+.|++.|.+...|..|+..|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            68999999999999999999876


No 31 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.00  E-value=9.8e-08  Score=39.07  Aligned_cols=20  Identities=35%  Similarity=0.497  Sum_probs=15.3

Q ss_pred             CCCCCCCCCCCCCeeeCCCCccccc
Q psy11352         38 SGTTGGSSNHSKLFATCFVCGKQLS   62 (107)
Q Consensus        38 ~~~~~~~~~~~~~~~~C~~C~~~f~   62 (107)
                      ++.|.++     ++|.|+.|++.|.
T Consensus         6 ~~~H~~~-----k~~~C~~C~k~F~   25 (26)
T PF13465_consen    6 MRTHTGE-----KPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHSSS-----SSEEESSSSEEES
T ss_pred             hhhcCCC-----CCCCCCCCcCeeC
Confidence            5667777     8888888888775


No 32 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.83  E-value=5e-06  Score=52.99  Aligned_cols=51  Identities=27%  Similarity=0.472  Sum_probs=41.9

Q ss_pred             CCeeeCC--CCcccccchhhHHHHHhh-h------------------CC-CcccCCCCCCcccChHHHHHHHH
Q psy11352         49 KLFATCF--VCGKQLSNQYNLRVHMET-H------------------QN-AFYACSSCSHVSRSRDALRKHVS   99 (107)
Q Consensus        49 ~~~~~C~--~C~~~f~~~~~l~~H~~~-h------------------~~-k~~~C~~C~~~f~~~~~l~~H~~   99 (107)
                      .+||+|+  .|.|.|.+...|+.|+.- |                  .. |||.|++|+|.+.....|+-|..
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceeccc
Confidence            4899995  499999999889888752 2                  13 79999999999999999988875


No 33 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.78  E-value=4.6e-05  Score=35.69  Aligned_cols=29  Identities=34%  Similarity=0.518  Sum_probs=15.3

Q ss_pred             CeeeCCCCcccccchhhHHHHHhhhCC-Cc
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHMETHQN-AF   78 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~~h~~-k~   78 (107)
                      .|..|++|+..+..+.+|.+|+.+..+ ||
T Consensus        23 ~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   23 QPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             --EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             CCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            566677777777777777777665554 44


No 34 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.73  E-value=2.3e-05  Score=41.94  Aligned_cols=72  Identities=21%  Similarity=0.230  Sum_probs=16.4

Q ss_pred             cCCCCCCCCCccCCCCCCCCCCCCCCCCCCCCCCCCCeeeCCCCcccccchhhHHHHHhhhCCCcccCCCCCCcccChHH
Q psy11352         14 ISDHCLTSPLSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHVSRSRDA   93 (107)
Q Consensus        14 ~C~~C~~~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~k~~~C~~C~~~f~~~~~   93 (107)
                      +|..|   +..|.....+..|   +....+..    .+     ....+.....+..+...-....+.|..|++.|.....
T Consensus         1 ~C~~C---~~~f~~~~~l~~H---~~~~H~~~----~~-----~~~~l~~~~~~~~~~~~~~~~~~~C~~C~~~f~s~~~   65 (100)
T PF12756_consen    1 QCLFC---DESFSSVDDLLQH---MKKKHGFD----IP-----DQKYLVDPNRLLNYLRKKVKESFRCPYCNKTFRSREA   65 (100)
T ss_dssp             ---------------------------------------------------------------SSEEBSSSS-EESSHHH
T ss_pred             Ccccc---ccccccccccccc---cccccccc----cc-----cccccccccccccccccccCCCCCCCccCCCCcCHHH
Confidence            48889   9999999999888   53322210    00     0001111222222222211235777777777777777


Q ss_pred             HHHHHHc
Q psy11352         94 LRKHVSY  100 (107)
Q Consensus        94 l~~H~~~  100 (107)
                      |..|++.
T Consensus        66 l~~Hm~~   72 (100)
T PF12756_consen   66 LQEHMRS   72 (100)
T ss_dssp             HHHHHHH
T ss_pred             HHHHHcC
Confidence            7777774


No 35 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.72  E-value=4.1e-05  Score=30.56  Aligned_cols=21  Identities=38%  Similarity=0.923  Sum_probs=13.9

Q ss_pred             ccCCCCCCcccChHHHHHHHH
Q psy11352         79 YACSSCSHVSRSRDALRKHVS   99 (107)
Q Consensus        79 ~~C~~C~~~f~~~~~l~~H~~   99 (107)
                      |.|..|++.|.....|..|++
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~   21 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMR   21 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHH
Confidence            456666666666666666666


No 36 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.72  E-value=1.4e-05  Score=51.08  Aligned_cols=59  Identities=15%  Similarity=0.067  Sum_probs=42.7

Q ss_pred             cccccCCC--CCCCCCccCCCCCCCCCCCCC----CCCC---CC----CCCCCCeeeCCCCcccccchhhHHHHH
Q psy11352         10 LHFLISDH--CLTSPLSSSIPGSSKTKASGS----GTTG---GS----SNHSKLFATCFVCGKQLSNQYNLRVHM   71 (107)
Q Consensus        10 ~~~~~C~~--C~~~~~~~~~~~~l~~h~~~~----~~~~---~~----~~~~~~~~~C~~C~~~f~~~~~l~~H~   71 (107)
                      .|||+|++  |   .+.++....|+.|....    ..+.   .+    =+...+||.|++|+|.|.+...|+.|.
T Consensus       347 ~KpykCpV~gC---~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr  418 (423)
T COG5189         347 GKPYKCPVEGC---NKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHR  418 (423)
T ss_pred             CceecCCCCCc---hhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceecc
Confidence            48999976  9   99999999999883110    0111   01    113358999999999999988888775


No 37 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.70  E-value=3.2e-05  Score=30.89  Aligned_cols=24  Identities=38%  Similarity=0.688  Sum_probs=21.3

Q ss_pred             eeCCCCcccccchhhHHHHHhhhC
Q psy11352         52 ATCFVCGKQLSNQYNLRVHMETHQ   75 (107)
Q Consensus        52 ~~C~~C~~~f~~~~~l~~H~~~h~   75 (107)
                      |.|+.|++.|.....|..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            579999999999999999998764


No 38 
>PRK04860 hypothetical protein; Provisional
Probab=97.70  E-value=2.6e-05  Score=45.62  Aligned_cols=38  Identities=24%  Similarity=0.506  Sum_probs=32.9

Q ss_pred             CeeeCCCCcccccchhhHHHHHhhhCC-CcccCCCCCCcccCh
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHMETHQN-AFYACSSCSHVSRSR   91 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~~h~~-k~~~C~~C~~~f~~~   91 (107)
                      -+|.|. |+.   ....+.+|.++|++ ++|.|..|+..|...
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVFK  156 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEEe
Confidence            569998 987   56778999999999 999999999988654


No 39 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.60  E-value=3.4e-05  Score=36.10  Aligned_cols=27  Identities=33%  Similarity=0.580  Sum_probs=20.0

Q ss_pred             CcccCCCCCCcccChHHHHHHHHccCC
Q psy11352         77 AFYACSSCSHVSRSRDALRKHVSYRHP  103 (107)
Q Consensus        77 k~~~C~~C~~~f~~~~~l~~H~~~~H~  103 (107)
                      .|-.|++|+..+.+..+|.+|+.+.|.
T Consensus        23 ~PatCP~C~a~~~~srnLrRHle~~H~   49 (54)
T PF09237_consen   23 QPATCPICGAVIRQSRNLRRHLEIRHF   49 (54)
T ss_dssp             --EE-TTT--EESSHHHHHHHHHHHTT
T ss_pred             CCCCCCcchhhccchhhHHHHHHHHhc
Confidence            799999999999999999999987553


No 40 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.50  E-value=5.4e-05  Score=30.08  Aligned_cols=23  Identities=30%  Similarity=0.810  Sum_probs=12.6

Q ss_pred             ccCCCCCCcccChHHHHHHHHccC
Q psy11352         79 YACSSCSHVSRSRDALRKHVSYRH  102 (107)
Q Consensus        79 ~~C~~C~~~f~~~~~l~~H~~~~H  102 (107)
                      |+|+.|+.... ...|.+|++++|
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            45666666555 666666666544


No 41 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=97.45  E-value=2e-05  Score=37.87  Aligned_cols=52  Identities=13%  Similarity=0.226  Sum_probs=35.0

Q ss_pred             cccCCCCCCCCCccCCCCCCCCCCCCCCCCCCCCCCCCCeeeCCCCcccccchhhHHHHHhhhC
Q psy11352         12 FLISDHCLTSPLSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQLSNQYNLRVHMETHQ   75 (107)
Q Consensus        12 ~~~C~~C~~~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~   75 (107)
                      .|.||.|   ++. .+...|..|...  .|..+    .+.+.|++|...+.  ..|..|+..+.
T Consensus         2 ~f~CP~C---~~~-~~~~~L~~H~~~--~H~~~----~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    2 SFTCPYC---GKG-FSESSLVEHCED--EHRSE----SKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             CcCCCCC---CCc-cCHHHHHHHHHh--HCcCC----CCCccCCCchhhhh--hHHHHHHHHhc
Confidence            4899999   884 445678888322  23322    14689999998654  48889987643


No 42 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.37  E-value=0.00015  Score=28.97  Aligned_cols=20  Identities=35%  Similarity=0.770  Sum_probs=9.7

Q ss_pred             eCCCCcccccchhhHHHHHh
Q psy11352         53 TCFVCGKQLSNQYNLRVHME   72 (107)
Q Consensus        53 ~C~~C~~~f~~~~~l~~H~~   72 (107)
                      .|+.|++.|.+...|..|++
T Consensus         2 ~C~~C~~~f~s~~~~~~H~~   21 (25)
T PF12874_consen    2 YCDICNKSFSSENSLRQHLR   21 (25)
T ss_dssp             EETTTTEEESSHHHHHHHHT
T ss_pred             CCCCCCCCcCCHHHHHHHHC
Confidence            44445555555444444443


No 43 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.26  E-value=0.00016  Score=28.89  Aligned_cols=22  Identities=27%  Similarity=0.665  Sum_probs=20.2

Q ss_pred             ccCCCCCCcccChHHHHHHHHc
Q psy11352         79 YACSSCSHVSRSRDALRKHVSY  100 (107)
Q Consensus        79 ~~C~~C~~~f~~~~~l~~H~~~  100 (107)
                      |.|.+|++.|.....+..|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            6799999999999999999874


No 44 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=97.22  E-value=0.00016  Score=29.58  Aligned_cols=22  Identities=23%  Similarity=0.653  Sum_probs=16.2

Q ss_pred             ccCCCCCCcccChHHHHHHHHc
Q psy11352         79 YACSSCSHVSRSRDALRKHVSY  100 (107)
Q Consensus        79 ~~C~~C~~~f~~~~~l~~H~~~  100 (107)
                      |.|..|++.|.....+..|+++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            5677788778777777777653


No 45 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.85  E-value=0.0012  Score=26.01  Aligned_cols=23  Identities=30%  Similarity=0.574  Sum_probs=17.8

Q ss_pred             eeCCCCcccccchhhHHHHHhhhC
Q psy11352         52 ATCFVCGKQLSNQYNLRVHMETHQ   75 (107)
Q Consensus        52 ~~C~~C~~~f~~~~~l~~H~~~h~   75 (107)
                      |.|+.|+.... ...|..|++.+.
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            68999999888 889999998753


No 46 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.78  E-value=0.00045  Score=28.20  Aligned_cols=22  Identities=32%  Similarity=0.611  Sum_probs=18.9

Q ss_pred             eeCCCCcccccchhhHHHHHhh
Q psy11352         52 ATCFVCGKQLSNQYNLRVHMET   73 (107)
Q Consensus        52 ~~C~~C~~~f~~~~~l~~H~~~   73 (107)
                      |.|..|++.|.+...+..|++.
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            6799999999999999888764


No 47 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=96.59  E-value=0.0024  Score=25.61  Aligned_cols=19  Identities=32%  Similarity=0.602  Sum_probs=10.3

Q ss_pred             cCCCCCCcccChHHHHHHHH
Q psy11352         80 ACSSCSHVSRSRDALRKHVS   99 (107)
Q Consensus        80 ~C~~C~~~f~~~~~l~~H~~   99 (107)
                      .|+.||+.| ..+.|..|+.
T Consensus         4 ~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    4 PCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             cCCCCCCEE-CHHHHHHHHH
Confidence            455666666 3444555554


No 48 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=96.38  E-value=0.0032  Score=27.06  Aligned_cols=22  Identities=14%  Similarity=0.342  Sum_probs=14.2

Q ss_pred             cccCCCCCCcccChHHHHHHHH
Q psy11352         78 FYACSSCSHVSRSRDALRKHVS   99 (107)
Q Consensus        78 ~~~C~~C~~~f~~~~~l~~H~~   99 (107)
                      +|.|++|++.|.....+..|+.
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~   24 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLK   24 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHC
Confidence            4567777777766666666654


No 49 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=95.84  E-value=0.0085  Score=25.70  Aligned_cols=22  Identities=14%  Similarity=0.466  Sum_probs=19.5

Q ss_pred             eeeCCCCcccccchhhHHHHHh
Q psy11352         51 FATCFVCGKQLSNQYNLRVHME   72 (107)
Q Consensus        51 ~~~C~~C~~~f~~~~~l~~H~~   72 (107)
                      +|.|+.|+..|.....+..|+.
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~   24 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLK   24 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHC
Confidence            4889999999999999988875


No 50 
>PRK04860 hypothetical protein; Provisional
Probab=95.61  E-value=0.0021  Score=37.75  Aligned_cols=40  Identities=15%  Similarity=0.231  Sum_probs=32.5

Q ss_pred             cccccCCCCCCCCCccCCCCCCCCCCCCCCCCCCCCCCCCCeeeCCCCcccccch
Q psy11352         10 LHFLISDHCLTSPLSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQLSNQ   64 (107)
Q Consensus        10 ~~~~~C~~C~~~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~   64 (107)
                      .-+|.|. |   +.   ....+..|   .+++.+.     ++|.|..|+..|...
T Consensus       117 ~~~Y~C~-C---~~---~~~~~rrH---~ri~~g~-----~~YrC~~C~~~l~~~  156 (160)
T PRK04860        117 TFPYRCK-C---QE---HQLTVRRH---NRVVRGE-----AVYRCRRCGETLVFK  156 (160)
T ss_pred             EEEEEcC-C---CC---eeCHHHHH---HHHhcCC-----ccEECCCCCceeEEe
Confidence            3579998 9   65   56667888   8888888     999999999988654


No 51 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=95.55  E-value=0.012  Score=25.13  Aligned_cols=24  Identities=29%  Similarity=0.663  Sum_probs=15.8

Q ss_pred             eeCCCCcccccchhhHHHHHhhhCCCcccCCCCCC
Q psy11352         52 ATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSH   86 (107)
Q Consensus        52 ~~C~~C~~~f~~~~~l~~H~~~h~~k~~~C~~C~~   86 (107)
                      |.|..||..+....           .++.|+.||.
T Consensus         2 ~~C~~CGy~y~~~~-----------~~~~CP~Cg~   25 (33)
T cd00350           2 YVCPVCGYIYDGEE-----------APWVCPVCGA   25 (33)
T ss_pred             EECCCCCCEECCCc-----------CCCcCcCCCC
Confidence            67777876654322           4778888874


No 52 
>KOG2186|consensus
Probab=95.11  E-value=0.017  Score=36.17  Aligned_cols=25  Identities=20%  Similarity=0.571  Sum_probs=13.8

Q ss_pred             eeeCCCCcccccchhhHHHHHhhhCC
Q psy11352         51 FATCFVCGKQLSNQYNLRVHMETHQN   76 (107)
Q Consensus        51 ~~~C~~C~~~f~~~~~l~~H~~~h~~   76 (107)
                      .|.|..|++.|.. .++..|...-++
T Consensus        29 ~fSCIDC~k~F~~-~sYknH~kCITE   53 (276)
T KOG2186|consen   29 YFSCIDCGKTFER-VSYKNHTKCITE   53 (276)
T ss_pred             eeEEeeccccccc-chhhhhhhhcch
Confidence            4666666666665 445555544443


No 53 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=94.68  E-value=0.05  Score=26.41  Aligned_cols=33  Identities=18%  Similarity=0.365  Sum_probs=22.3

Q ss_pred             CeeeCCCCcccccchhhHHHHHhhhCCCcccCCCCCC
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSH   86 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~~h~~k~~~C~~C~~   86 (107)
                      ..|.|+.||..-.....    .-.-.+.+|.|+.||.
T Consensus        26 v~F~CPnCGe~~I~Rc~----~CRk~g~~Y~Cp~CGF   58 (61)
T COG2888          26 VKFPCPNCGEVEIYRCA----KCRKLGNPYRCPKCGF   58 (61)
T ss_pred             eEeeCCCCCceeeehhh----hHHHcCCceECCCcCc
Confidence            67999999976544322    1122347999999984


No 54 
>KOG1146|consensus
Probab=94.59  E-value=0.023  Score=43.01  Aligned_cols=51  Identities=24%  Similarity=0.415  Sum_probs=43.9

Q ss_pred             CeeeCCCCcccccchhhHHHHHhh-h------------------------CC-CcccCCCCCCcccChHHHHHHHHc
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHMET-H------------------------QN-AFYACSSCSHVSRSRDALRKHVSY  100 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~~-h------------------------~~-k~~~C~~C~~~f~~~~~l~~H~~~  100 (107)
                      +.+.|+.|+..|.....|-.|++. |                        .+ +||.|..|...++...+|..|+..
T Consensus       464 kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p~~C~~C~~stttng~LsihlqS  540 (1406)
T KOG1146|consen  464 KTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKPYPCRACNYSTTTNGNLSIHLQS  540 (1406)
T ss_pred             ccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCcccceeeeeeeecchHHHHHHHH
Confidence            678999999999999999999887 1                        12 589999999999999999999874


No 55 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=94.58  E-value=0.041  Score=29.11  Aligned_cols=25  Identities=24%  Similarity=0.470  Sum_probs=21.7

Q ss_pred             eeeCCCCcccccchhhHHHHHhhhC
Q psy11352         51 FATCFVCGKQLSNQYNLRVHMETHQ   75 (107)
Q Consensus        51 ~~~C~~C~~~f~~~~~l~~H~~~h~   75 (107)
                      .+.|..|++.|.+...|..|++.+.
T Consensus        50 ~~~C~~C~~~f~s~~~l~~Hm~~~~   74 (100)
T PF12756_consen   50 SFRCPYCNKTFRSREALQEHMRSKH   74 (100)
T ss_dssp             SEEBSSSS-EESSHHHHHHHHHHTT
T ss_pred             CCCCCccCCCCcCHHHHHHHHcCcc
Confidence            5999999999999999999998643


No 56 
>KOG2893|consensus
Probab=94.58  E-value=0.0071  Score=37.63  Aligned_cols=41  Identities=22%  Similarity=0.537  Sum_probs=27.6

Q ss_pred             CCCCcccccchhhHHHHHhhhCCCcccCCCCCCcccChHHHHHH
Q psy11352         54 CFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHVSRSRDALRKH   97 (107)
Q Consensus        54 C~~C~~~f~~~~~l~~H~~~h~~k~~~C~~C~~~f~~~~~l~~H   97 (107)
                      |..|++.|.....|.+|++.   |-|+|.+|.+...+...|..|
T Consensus        13 cwycnrefddekiliqhqka---khfkchichkkl~sgpglsih   53 (341)
T KOG2893|consen   13 CWYCNREFDDEKILIQHQKA---KHFKCHICHKKLFSGPGLSIH   53 (341)
T ss_pred             eeecccccchhhhhhhhhhh---ccceeeeehhhhccCCCceee
Confidence            77788888888888777642   667888887654444444333


No 57 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=94.03  E-value=0.037  Score=26.48  Aligned_cols=25  Identities=20%  Similarity=0.412  Sum_probs=22.0

Q ss_pred             CeeeCCCCcccccchhhHHHHHhhh
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHMETH   74 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~~h   74 (107)
                      .-+.|+.||..|.....+.+|+..-
T Consensus        16 ~~lrCPRC~~~FR~~K~Y~RHVNKa   40 (65)
T COG4049          16 EFLRCPRCGMVFRRRKDYIRHVNKA   40 (65)
T ss_pred             eeeeCCchhHHHHHhHHHHHHhhHH
Confidence            7889999999999999999998643


No 58 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=94.01  E-value=0.066  Score=29.45  Aligned_cols=31  Identities=19%  Similarity=0.417  Sum_probs=21.6

Q ss_pred             eeeCCCCcccccchhhHHHHHhhhCCCcccCCCCCCcccCh
Q psy11352         51 FATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHVSRSR   91 (107)
Q Consensus        51 ~~~C~~C~~~f~~~~~l~~H~~~h~~k~~~C~~C~~~f~~~   91 (107)
                      ...|+.||..|....          ..|..|+.||..|.-.
T Consensus         9 KR~Cp~CG~kFYDLn----------k~PivCP~CG~~~~~~   39 (108)
T PF09538_consen    9 KRTCPSCGAKFYDLN----------KDPIVCPKCGTEFPPE   39 (108)
T ss_pred             cccCCCCcchhccCC----------CCCccCCCCCCccCcc
Confidence            357888888876521          1588888888877655


No 59 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=93.97  E-value=0.064  Score=23.09  Aligned_cols=25  Identities=28%  Similarity=0.482  Sum_probs=15.8

Q ss_pred             eeeCCCCcccccchhhHHHHHhhhCCCcccCCCCCC
Q psy11352         51 FATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSH   86 (107)
Q Consensus        51 ~~~C~~C~~~f~~~~~l~~H~~~h~~k~~~C~~C~~   86 (107)
                      .|.|..||..+....           .|..|+.||.
T Consensus         2 ~~~C~~CG~i~~g~~-----------~p~~CP~Cg~   26 (34)
T cd00729           2 VWVCPVCGYIHEGEE-----------APEKCPICGA   26 (34)
T ss_pred             eEECCCCCCEeECCc-----------CCCcCcCCCC
Confidence            467888876643321           4677888874


No 60 
>KOG4173|consensus
Probab=93.84  E-value=0.011  Score=35.93  Aligned_cols=80  Identities=16%  Similarity=0.326  Sum_probs=55.9

Q ss_pred             cccccCCC--CCCCCCccCCCCCCCCCCCCCCCCCCCCCCCCCeeeCCCCcccccchhhHHHHHh-hh---------CC-
Q psy11352         10 LHFLISDH--CLTSPLSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQLSNQYNLRVHME-TH---------QN-   76 (107)
Q Consensus        10 ~~~~~C~~--C~~~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~-~h---------~~-   76 (107)
                      +..|.|+.  |   ...|........|   .....+        ..|..|.+.|.+...|..|+. .|         .| 
T Consensus        77 ~~~~~cqvagc---~~~~d~lD~~E~h---Y~~~h~--------~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~  142 (253)
T KOG4173|consen   77 VPAFACQVAGC---CQVFDALDDYEHH---YHTLHG--------NSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQ  142 (253)
T ss_pred             cccccccccch---HHHHhhhhhHHHh---hhhccc--------chhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCc
Confidence            44567766  5   5556655555555   322222        279999999999999998874 33         34 


Q ss_pred             CcccC--CCCCCcccChHHHHHHHHccCC
Q psy11352         77 AFYAC--SSCSHVSRSRDALRKHVSYRHP  103 (107)
Q Consensus        77 k~~~C--~~C~~~f~~~~~l~~H~~~~H~  103 (107)
                      --|+|  +.|+..|........|+-..|.
T Consensus       143 dMy~ClvEgCt~KFkT~r~RkdH~I~~Hk  171 (253)
T KOG4173|consen  143 DMYQCLVEGCTEKFKTSRDRKDHMIRMHK  171 (253)
T ss_pred             cHHHHHHHhhhhhhhhhhhhhhHHHHhcc
Confidence            35888  5699999999888999876563


No 61 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=93.66  E-value=0.058  Score=31.56  Aligned_cols=17  Identities=24%  Similarity=0.653  Sum_probs=13.2

Q ss_pred             eeeCCCCcccccchhhH
Q psy11352         51 FATCFVCGKQLSNQYNL   67 (107)
Q Consensus        51 ~~~C~~C~~~f~~~~~l   67 (107)
                      .+.|+.||++|..-..+
T Consensus        28 ~~~c~~c~~~f~~~e~~   44 (154)
T PRK00464         28 RRECLACGKRFTTFERV   44 (154)
T ss_pred             eeeccccCCcceEeEec
Confidence            48999999999875443


No 62 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=93.25  E-value=0.028  Score=34.66  Aligned_cols=13  Identities=15%  Similarity=0.621  Sum_probs=9.0

Q ss_pred             ccCCCCCCcccCh
Q psy11352         79 YACSSCSHVSRSR   91 (107)
Q Consensus        79 ~~C~~C~~~f~~~   91 (107)
                      ..|+.||.+|...
T Consensus        49 ~vCP~CgyA~~~~   61 (214)
T PF09986_consen   49 WVCPHCGYAAFEE   61 (214)
T ss_pred             EECCCCCCccccc
Confidence            5788888776543


No 63 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=93.16  E-value=0.025  Score=37.46  Aligned_cols=53  Identities=23%  Similarity=0.462  Sum_probs=32.8

Q ss_pred             eeeCCCCcccccchhhHHHHHh--hhCC---CcccCC--CCCCcccChHHHHHHHHccCCC
Q psy11352         51 FATCFVCGKQLSNQYNLRVHME--THQN---AFYACS--SCSHVSRSRDALRKHVSYRHPH  104 (107)
Q Consensus        51 ~~~C~~C~~~f~~~~~l~~H~~--~h~~---k~~~C~--~C~~~f~~~~~l~~H~~~~H~~  104 (107)
                      ++.|..|...|.....|..|.+  .|.+   +++.|+  .|++.|.+...+..|..+ |.+
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~-~~~  348 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILL-HTS  348 (467)
T ss_pred             CCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCccc-ccC
Confidence            4566666666666666666666  5553   366666  566666666666666664 444


No 64 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=93.02  E-value=0.11  Score=34.47  Aligned_cols=64  Identities=22%  Similarity=0.240  Sum_probs=52.4

Q ss_pred             ccccCCCCCCCCCccCCCCCCCCCCCCCC--CCCCCCCCCCCeeeCC--CCcccccchhhHHHHHhhhCC-CcccCCC
Q psy11352         11 HFLISDHCLTSPLSSSIPGSSKTKASGSG--TTGGSSNHSKLFATCF--VCGKQLSNQYNLRVHMETHQN-AFYACSS   83 (107)
Q Consensus        11 ~~~~C~~C~~~~~~~~~~~~l~~h~~~~~--~~~~~~~~~~~~~~C~--~C~~~f~~~~~l~~H~~~h~~-k~~~C~~   83 (107)
                      .++.|..|   ...|.....+..|   ..  .+.++.   .+++.|+  .|++.|.+...+..|...|.+ .++.+..
T Consensus       288 ~~~~~~~~---~~~~s~~~~l~~~---~~~~~h~~~~---~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  356 (467)
T COG5048         288 LPIKSKQC---NISFSRSSPLTRH---LRSVNHSGES---LKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEKL  356 (467)
T ss_pred             cCCCCccc---cCCcccccccccc---cccccccccc---CCceeeeccCCCccccccccccCCcccccCCCcccccc
Confidence            47899999   9999999999999   66  454442   3689998  899999999999999999998 6666643


No 65 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=92.03  E-value=0.21  Score=33.01  Aligned_cols=92  Identities=16%  Similarity=0.261  Sum_probs=52.4

Q ss_pred             ccccCCCCcccccCCCCCCCCCccC------CCCCCCCCCCCCCCCCCCCCCCCC-eeeCCCCcccccchhhHHHHHhhh
Q psy11352          2 NFHYKPSTLHFLISDHCLTSPLSSS------IPGSSKTKASGSGTTGGSSNHSKL-FATCFVCGKQLSNQYNLRVHMETH   74 (107)
Q Consensus         2 ~~h~~~~~~~~~~C~~C~~~~~~~~------~~~~l~~h~~~~~~~~~~~~~~~~-~~~C~~C~~~f~~~~~l~~H~~~h   74 (107)
                      +.|+|.... .+.|..|-+.-+.|.      ....|..|   ......+  .+=+ .-.|..|..-|..-..|..|++.-
T Consensus       170 k~H~K~~H~-~~~C~~C~~nKk~F~~E~~lF~~~~Lr~H---~~~G~~e--~GFKGHP~C~FC~~~FYdDDEL~~HcR~~  243 (493)
T COG5236         170 KKHYKAQHG-FVLCSECIGNKKDFWNEIRLFRSSTLRDH---KNGGLEE--EGFKGHPLCIFCKIYFYDDDELRRHCRLR  243 (493)
T ss_pred             HHHHHhhcC-cEEhHhhhcCcccCccceeeeeccccccc---ccCCccc--cCcCCCchhhhccceecChHHHHHHHHhh
Confidence            445554443 456777744344443      33445555   2222111  1102 235999999999999999999875


Q ss_pred             CCCcccCCCCCC----cccChHHHHHHHH
Q psy11352         75 QNAFYACSSCSH----VSRSRDALRKHVS   99 (107)
Q Consensus        75 ~~k~~~C~~C~~----~f~~~~~l~~H~~   99 (107)
                      .++-+.|+.-+.    -|..-.+|-+|.+
T Consensus       244 HE~ChICD~v~p~~~QYFK~Y~~Le~HF~  272 (493)
T COG5236         244 HEACHICDMVGPIRYQYFKSYEDLEAHFR  272 (493)
T ss_pred             hhhhhhhhccCccchhhhhCHHHHHHHhh
Confidence            555555544332    2556666777765


No 66 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=91.89  E-value=0.078  Score=24.93  Aligned_cols=12  Identities=25%  Similarity=0.755  Sum_probs=6.9

Q ss_pred             eeCCCCcccccc
Q psy11352         52 ATCFVCGKQLSN   63 (107)
Q Consensus        52 ~~C~~C~~~f~~   63 (107)
                      |.|..||..|..
T Consensus         6 y~C~~Cg~~fe~   17 (52)
T TIGR02605         6 YRCTACGHRFEV   17 (52)
T ss_pred             EEeCCCCCEeEE
Confidence            556666665553


No 67 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=91.76  E-value=0.18  Score=23.60  Aligned_cols=8  Identities=38%  Similarity=0.800  Sum_probs=4.1

Q ss_pred             HHHHHHHH
Q psy11352         92 DALRKHVS   99 (107)
Q Consensus        92 ~~l~~H~~   99 (107)
                      ++|.+|++
T Consensus        37 s~L~rHl~   44 (50)
T smart00614       37 SNLRRHLR   44 (50)
T ss_pred             HHHHHHHH
Confidence            34555555


No 68 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=91.74  E-value=0.19  Score=21.95  Aligned_cols=33  Identities=18%  Similarity=0.307  Sum_probs=15.7

Q ss_pred             eeCCCCcccccchhhHHHHHhhhCCCcccCCCCCCcc
Q psy11352         52 ATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHVS   88 (107)
Q Consensus        52 ~~C~~C~~~f~~~~~l~~H~~~h~~k~~~C~~C~~~f   88 (107)
                      ..|+.|+..|.-......    ..+....|+.|+..|
T Consensus         3 ~~CP~C~~~~~v~~~~~~----~~~~~v~C~~C~~~~   35 (38)
T TIGR02098         3 IQCPNCKTSFRVVDSQLG----ANGGKVRCGKCGHVW   35 (38)
T ss_pred             EECCCCCCEEEeCHHHcC----CCCCEEECCCCCCEE
Confidence            456666666554432210    011245666666554


No 69 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=91.68  E-value=0.09  Score=23.27  Aligned_cols=30  Identities=17%  Similarity=0.485  Sum_probs=15.4

Q ss_pred             eeeCCCCcccccchhhHHHHHhhhCCCcccCCCCCC
Q psy11352         51 FATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSH   86 (107)
Q Consensus        51 ~~~C~~C~~~f~~~~~l~~H~~~h~~k~~~C~~C~~   86 (107)
                      .|.|..||..|.......      .+....|+.||.
T Consensus         5 ~y~C~~Cg~~fe~~~~~~------~~~~~~CP~Cg~   34 (41)
T smart00834        5 EYRCEDCGHTFEVLQKIS------DDPLATCPECGG   34 (41)
T ss_pred             EEEcCCCCCEEEEEEecC------CCCCCCCCCCCC
Confidence            366777776665433221      123445666664


No 70 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=91.47  E-value=0.2  Score=22.88  Aligned_cols=27  Identities=19%  Similarity=0.486  Sum_probs=16.5

Q ss_pred             eeeCCCCcccccchhhHHHHHhhhCCCcccCCCCCCc
Q psy11352         51 FATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHV   87 (107)
Q Consensus        51 ~~~C~~C~~~f~~~~~l~~H~~~h~~k~~~C~~C~~~   87 (107)
                      .|.|..||..|...          .+.+..|+.||..
T Consensus         2 ~Y~C~~Cg~~~~~~----------~~~~irC~~CG~r   28 (44)
T smart00659        2 IYICGECGRENEIK----------SKDVVRCRECGYR   28 (44)
T ss_pred             EEECCCCCCEeecC----------CCCceECCCCCce
Confidence            36777777766543          1146677777743


No 71 
>PHA00626 hypothetical protein
Probab=91.47  E-value=0.22  Score=23.92  Aligned_cols=14  Identities=29%  Similarity=0.306  Sum_probs=10.4

Q ss_pred             CeeeCCCCcccccc
Q psy11352         50 LFATCFVCGKQLSN   63 (107)
Q Consensus        50 ~~~~C~~C~~~f~~   63 (107)
                      ..|.|..||..|..
T Consensus        22 nrYkCkdCGY~ft~   35 (59)
T PHA00626         22 DDYVCCDCGYNDSK   35 (59)
T ss_pred             cceEcCCCCCeech
Confidence            55888888877764


No 72 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=91.47  E-value=0.23  Score=27.50  Aligned_cols=85  Identities=13%  Similarity=0.106  Sum_probs=47.6

Q ss_pred             ccccCCCCCCCCCccCCCCCCCCCCCCCCCCC--CC-C-CCCCCeeeCCCCcccccchhhHHHHHhhhCC-CcccCCCCC
Q psy11352         11 HFLISDHCLTSPLSSSIPGSSKTKASGSGTTG--GS-S-NHSKLFATCFVCGKQLSNQYNLRVHMETHQN-AFYACSSCS   85 (107)
Q Consensus        11 ~~~~C~~C~~~~~~~~~~~~l~~h~~~~~~~~--~~-~-~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~-k~~~C~~C~   85 (107)
                      -|-.|+.|   +.....+..|.+...-.-.-.  .+ + ......-.|-.|...|........  ..-.. ..|+|+.|.
T Consensus        14 LP~~CpiC---gLtLVss~HLARSyHHLfPl~~f~ev~~~~~~~~~~C~~C~~~f~~~~~~~~--~~~~~~~~y~C~~C~   88 (112)
T TIGR00622        14 LPVECPIC---GLTLILSTHLARSYHHLFPLKAFQEIPLEEYNGSRFCFGCQGPFPKPPVSPF--DELKDSHRYVCAVCK   88 (112)
T ss_pred             CCCcCCcC---CCEEeccchHHHhhhccCCCcccccccccccCCCCcccCcCCCCCCcccccc--cccccccceeCCCCC
Confidence            47789999   777666665553310000000  00 0 001112348889888876431110  00112 589999999


Q ss_pred             CcccChHHHHHHHHc
Q psy11352         86 HVSRSRDALRKHVSY  100 (107)
Q Consensus        86 ~~f~~~~~l~~H~~~  100 (107)
                      ..|-..-++-.|...
T Consensus        89 ~~FC~dCD~fiHe~L  103 (112)
T TIGR00622        89 NVFCVDCDVFVHESL  103 (112)
T ss_pred             Cccccccchhhhhhc
Confidence            999888888788774


No 73 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=91.33  E-value=0.14  Score=22.40  Aligned_cols=10  Identities=30%  Similarity=0.836  Sum_probs=4.8

Q ss_pred             eeCCCCcccc
Q psy11352         52 ATCFVCGKQL   61 (107)
Q Consensus        52 ~~C~~C~~~f   61 (107)
                      ..|..|+-.|
T Consensus        26 vrC~~C~~~f   35 (37)
T PF13719_consen   26 VRCPKCGHVF   35 (37)
T ss_pred             EECCCCCcEe
Confidence            4455554444


No 74 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=90.71  E-value=0.22  Score=29.56  Aligned_cols=25  Identities=28%  Similarity=0.511  Sum_probs=17.7

Q ss_pred             CeeeCCCCcccccchhhHHHHHhhhCCCcccCCCCCC
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSH   86 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~~h~~k~~~C~~C~~   86 (107)
                      +.|.|++||.++..            ..|-+|++||-
T Consensus       133 ~~~vC~vCGy~~~g------------e~P~~CPiCga  157 (166)
T COG1592         133 KVWVCPVCGYTHEG------------EAPEVCPICGA  157 (166)
T ss_pred             CEEEcCCCCCcccC------------CCCCcCCCCCC
Confidence            36889999865432            16888999983


No 75 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=90.39  E-value=0.18  Score=23.09  Aligned_cols=11  Identities=27%  Similarity=0.773  Sum_probs=5.5

Q ss_pred             eeeCCCCcccc
Q psy11352         51 FATCFVCGKQL   61 (107)
Q Consensus        51 ~~~C~~C~~~f   61 (107)
                      .|.|+.||..|
T Consensus         3 ~y~C~~CG~~~   13 (46)
T PRK00398          3 EYKCARCGREV   13 (46)
T ss_pred             EEECCCCCCEE
Confidence            34555555544


No 76 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=90.09  E-value=0.38  Score=27.88  Aligned_cols=37  Identities=11%  Similarity=0.382  Sum_probs=23.6

Q ss_pred             CeeeCCCCcccccchhhHHHHHhhhCCCcccCCCCCCccc
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHVSR   89 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~~h~~k~~~C~~C~~~f~   89 (107)
                      ..|.|+.|+..|.....+.. .  .....|.|+.||....
T Consensus        98 ~~Y~Cp~C~~~y~~~ea~~~-~--d~~~~f~Cp~Cg~~l~  134 (147)
T smart00531       98 AYYKCPNCQSKYTFLEANQL-L--DMDGTFTCPRCGEELE  134 (147)
T ss_pred             cEEECcCCCCEeeHHHHHHh-c--CCCCcEECCCCCCEEE
Confidence            67899999988875443221 0  1123489999987643


No 77 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=90.05  E-value=0.28  Score=21.33  Aligned_cols=13  Identities=23%  Similarity=0.388  Sum_probs=6.0

Q ss_pred             eCCCCcccccchh
Q psy11352         53 TCFVCGKQLSNQY   65 (107)
Q Consensus        53 ~C~~C~~~f~~~~   65 (107)
                      .|+.|+..|.-..
T Consensus         4 ~Cp~C~~~y~i~d   16 (36)
T PF13717_consen    4 TCPNCQAKYEIDD   16 (36)
T ss_pred             ECCCCCCEEeCCH
Confidence            4445554444443


No 78 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=89.69  E-value=0.4  Score=28.19  Aligned_cols=32  Identities=13%  Similarity=0.367  Sum_probs=24.3

Q ss_pred             CCeeeCCCCcccccchhhHHHHHhhhCCCcccCCCCCCcc
Q psy11352         49 KLFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHVS   88 (107)
Q Consensus        49 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~k~~~C~~C~~~f   88 (107)
                      ..-|.|+.|+..|+....+.        --|.|+.||...
T Consensus       107 ~~~Y~Cp~c~~r~tf~eA~~--------~~F~Cp~Cg~~L  138 (158)
T TIGR00373       107 NMFFICPNMCVRFTFNEAME--------LNFTCPRCGAML  138 (158)
T ss_pred             CCeEECCCCCcEeeHHHHHH--------cCCcCCCCCCEe
Confidence            36788999998887766654        368999998654


No 79 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=89.52  E-value=0.25  Score=22.31  Aligned_cols=22  Identities=23%  Similarity=0.546  Sum_probs=9.0

Q ss_pred             cccCCCCCCcccCh----HHHHHHHH
Q psy11352         78 FYACSSCSHVSRSR----DALRKHVS   99 (107)
Q Consensus        78 ~~~C~~C~~~f~~~----~~l~~H~~   99 (107)
                      -..|..|++.+...    ++|.+|++
T Consensus        16 ~a~C~~C~~~~~~~~~~ts~l~~HL~   41 (45)
T PF02892_consen   16 KAKCKYCGKVIKYSSGGTSNLKRHLK   41 (45)
T ss_dssp             -EEETTTTEE-----SSTHHHHHHHH
T ss_pred             eEEeCCCCeEEeeCCCcHHHHHHhhh
Confidence            34555555544432    45555553


No 80 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=89.51  E-value=0.41  Score=28.76  Aligned_cols=32  Identities=16%  Similarity=0.451  Sum_probs=23.6

Q ss_pred             CeeeCCCCcccccchhhHHHHHhhhCCCcccCCCCCCccc
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHVSR   89 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~~h~~k~~~C~~C~~~f~   89 (107)
                      .-|.|+.|+..|.....+.        --|.|+.||....
T Consensus       116 ~~Y~Cp~C~~rytf~eA~~--------~~F~Cp~Cg~~L~  147 (178)
T PRK06266        116 MFFFCPNCHIRFTFDEAME--------YGFRCPQCGEMLE  147 (178)
T ss_pred             CEEECCCCCcEEeHHHHhh--------cCCcCCCCCCCCe
Confidence            6788999998887765542        3688999986543


No 81 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=89.36  E-value=0.14  Score=23.12  Aligned_cols=12  Identities=8%  Similarity=0.265  Sum_probs=7.0

Q ss_pred             ccCCCCCCCCCccCC
Q psy11352         13 LISDHCLTSPLSSSI   27 (107)
Q Consensus        13 ~~C~~C~~~~~~~~~   27 (107)
                      |.|+.|   +..|..
T Consensus         6 y~C~~C---g~~fe~   17 (42)
T PF09723_consen    6 YRCEEC---GHEFEV   17 (42)
T ss_pred             EEeCCC---CCEEEE
Confidence            566666   655544


No 82 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=89.22  E-value=0.28  Score=27.70  Aligned_cols=30  Identities=7%  Similarity=-0.002  Sum_probs=17.7

Q ss_pred             eeCCCCcccccchhhHHHHHhhhCCCcccCCCCCCcccCh
Q psy11352         52 ATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHVSRSR   91 (107)
Q Consensus        52 ~~C~~C~~~f~~~~~l~~H~~~h~~k~~~C~~C~~~f~~~   91 (107)
                      ..|+.||+.|....          ..|..|+.||..|...
T Consensus        10 r~Cp~cg~kFYDLn----------k~p~vcP~cg~~~~~~   39 (129)
T TIGR02300        10 RICPNTGSKFYDLN----------RRPAVSPYTGEQFPPE   39 (129)
T ss_pred             ccCCCcCccccccC----------CCCccCCCcCCccCcc
Confidence            46777777664411          0467777777666444


No 83 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=89.18  E-value=0.62  Score=22.68  Aligned_cols=32  Identities=22%  Similarity=0.550  Sum_probs=20.8

Q ss_pred             CeeeCCCCcccccchhhHHHHHhh-hCCCcccCCCCCC
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHMET-HQNAFYACSSCSH   86 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~~-h~~k~~~C~~C~~   86 (107)
                      ..|.|+.||......-.     +- -.+.+|.|+.||.
T Consensus        24 ~~F~CPnCG~~~I~RC~-----~CRk~~~~Y~CP~CGF   56 (59)
T PRK14890         24 VKFLCPNCGEVIIYRCE-----KCRKQSNPYTCPKCGF   56 (59)
T ss_pred             CEeeCCCCCCeeEeech-----hHHhcCCceECCCCCC
Confidence            56999999986333211     11 1226999999984


No 84 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=89.09  E-value=0.55  Score=18.84  Aligned_cols=19  Identities=16%  Similarity=0.534  Sum_probs=12.0

Q ss_pred             cCCCCCCcccChHHHHHHHH
Q psy11352         80 ACSSCSHVSRSRDALRKHVS   99 (107)
Q Consensus        80 ~C~~C~~~f~~~~~l~~H~~   99 (107)
                      .|++|++.+ ....+..|..
T Consensus         3 ~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        3 QCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHHH
Confidence            577777766 4456666655


No 85 
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=89.06  E-value=0.27  Score=21.95  Aligned_cols=13  Identities=31%  Similarity=0.859  Sum_probs=8.7

Q ss_pred             CeeeCCCCccccc
Q psy11352         50 LFATCFVCGKQLS   62 (107)
Q Consensus        50 ~~~~C~~C~~~f~   62 (107)
                      .-|.|..|+..|.
T Consensus        27 ~fy~C~~C~~~w~   39 (40)
T smart00440       27 VFYVCTKCGHRWR   39 (40)
T ss_pred             EEEEeCCCCCEeC
Confidence            4577877876653


No 86 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=89.05  E-value=0.31  Score=20.71  Aligned_cols=11  Identities=27%  Similarity=0.685  Sum_probs=5.9

Q ss_pred             CcccCCCCCCc
Q psy11352         77 AFYACSSCSHV   87 (107)
Q Consensus        77 k~~~C~~C~~~   87 (107)
                      .+..|+.||..
T Consensus        16 ~~irC~~CG~R   26 (32)
T PF03604_consen   16 DPIRCPECGHR   26 (32)
T ss_dssp             STSSBSSSS-S
T ss_pred             CcEECCcCCCe
Confidence            35566666643


No 87 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=88.17  E-value=0.29  Score=30.26  Aligned_cols=26  Identities=27%  Similarity=0.705  Sum_probs=19.8

Q ss_pred             cccCCCCCCcccChHHHHHHHHccCC
Q psy11352         78 FYACSSCSHVSRSRDALRKHVSYRHP  103 (107)
Q Consensus        78 ~~~C~~C~~~f~~~~~l~~H~~~~H~  103 (107)
                      .|.|.+|+|.|.-...+..|+...|.
T Consensus        77 K~~C~lc~KlFkg~eFV~KHI~nKH~  102 (214)
T PF04959_consen   77 KWRCPLCGKLFKGPEFVRKHIFNKHP  102 (214)
T ss_dssp             EEEE-SSS-EESSHHHHHHHHHHH-H
T ss_pred             EECCCCCCcccCChHHHHHHHhhcCH
Confidence            58899999999998889999887775


No 88 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=87.66  E-value=0.52  Score=24.83  Aligned_cols=11  Identities=18%  Similarity=0.688  Sum_probs=5.5

Q ss_pred             cccCCCCCCcc
Q psy11352         78 FYACSSCSHVS   88 (107)
Q Consensus        78 ~~~C~~C~~~f   88 (107)
                      -+.|..||..|
T Consensus        53 IW~C~kCg~~f   63 (89)
T COG1997          53 IWKCRKCGAKF   63 (89)
T ss_pred             eEEcCCCCCee
Confidence            44555555544


No 89 
>KOG1146|consensus
Probab=87.49  E-value=0.33  Score=37.31  Aligned_cols=59  Identities=14%  Similarity=0.188  Sum_probs=46.0

Q ss_pred             CCcccccCCCCCCCCCccCCCCCCCCCCCCCCCCCCC--------------------CCCCCCeeeCCCCcccccchhhH
Q psy11352          8 STLHFLISDHCLTSPLSSSIPGSSKTKASGSGTTGGS--------------------SNHSKLFATCFVCGKQLSNQYNL   67 (107)
Q Consensus         8 ~~~~~~~C~~C~~~~~~~~~~~~l~~h~~~~~~~~~~--------------------~~~~~~~~~C~~C~~~f~~~~~l   67 (107)
                      +..+-|+|+.|   +..|.....|..|   ++....+                    .....++|.|..|...+.....|
T Consensus       461 S~~kt~~cpkc---~~~yk~a~~L~vh---mRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p~~C~~C~~stttng~L  534 (1406)
T KOG1146|consen  461 SFFKTLKCPKC---NWHYKLAQTLGVH---MRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKPYPCRACNYSTTTNGNL  534 (1406)
T ss_pred             cccccccCCcc---chhhhhHHHhhhc---ccccccccchhHhHhccccccccccccccCCCCcccceeeeeeeecchHH
Confidence            33478999999   9999999999999   7662110                    11335789999999999999999


Q ss_pred             HHHHh
Q psy11352         68 RVHME   72 (107)
Q Consensus        68 ~~H~~   72 (107)
                      ..|+.
T Consensus       535 sihlq  539 (1406)
T KOG1146|consen  535 SIHLQ  539 (1406)
T ss_pred             HHHHH
Confidence            88875


No 90 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=86.83  E-value=0.48  Score=22.21  Aligned_cols=29  Identities=17%  Similarity=0.455  Sum_probs=19.5

Q ss_pred             CeeeCCCCcccccchhhHHHHHhhhCCCcccCCCCCCc
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHV   87 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~~h~~k~~~C~~C~~~   87 (107)
                      ..|.|..||+.|....         ......|+.||..
T Consensus         5 ~~Y~C~~Cg~~~~~~~---------~~~~irCp~Cg~r   33 (49)
T COG1996           5 MEYKCARCGREVELDQ---------ETRGIRCPYCGSR   33 (49)
T ss_pred             EEEEhhhcCCeeehhh---------ccCceeCCCCCcE
Confidence            5689999998882111         1157789999853


No 91 
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=86.29  E-value=0.7  Score=26.39  Aligned_cols=13  Identities=23%  Similarity=0.608  Sum_probs=10.4

Q ss_pred             cCCCCCCcccChH
Q psy11352         80 ACSSCSHVSRSRD   92 (107)
Q Consensus        80 ~C~~C~~~f~~~~   92 (107)
                      .|+.|.-+|.+.+
T Consensus       123 vCPvCkTSFKss~  135 (140)
T PF05290_consen  123 VCPVCKTSFKSSS  135 (140)
T ss_pred             CCCcccccccccc
Confidence            6899988887664


No 92 
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=86.22  E-value=0.2  Score=22.25  Aligned_cols=12  Identities=42%  Similarity=1.021  Sum_probs=8.5

Q ss_pred             CeeeCCCCcccc
Q psy11352         50 LFATCFVCGKQL   61 (107)
Q Consensus        50 ~~~~C~~C~~~f   61 (107)
                      .-|.|..|+..|
T Consensus        27 ~fy~C~~C~~~w   38 (39)
T PF01096_consen   27 LFYVCCNCGHRW   38 (39)
T ss_dssp             EEEEESSSTEEE
T ss_pred             EEEEeCCCCCee
Confidence            457788888765


No 93 
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=86.21  E-value=0.32  Score=25.79  Aligned_cols=27  Identities=22%  Similarity=0.525  Sum_probs=16.9

Q ss_pred             CeeeCCCCcccccchhhHHHHHhhhCCCcccCCCCC
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCS   85 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~~h~~k~~~C~~C~   85 (107)
                      +|-.|..||..|.... +        .+|-.|+.|.
T Consensus        57 ~Pa~CkkCGfef~~~~-i--------k~pSRCP~CK   83 (97)
T COG3357          57 RPARCKKCGFEFRDDK-I--------KKPSRCPKCK   83 (97)
T ss_pred             cChhhcccCccccccc-c--------CCcccCCcch
Confidence            4567888888776511 1        1477777774


No 94 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=85.80  E-value=0.73  Score=25.18  Aligned_cols=24  Identities=38%  Similarity=0.862  Sum_probs=20.3

Q ss_pred             ccC----CCCCCcccChHHHHHHHHccC
Q psy11352         79 YAC----SSCSHVSRSRDALRKHVSYRH  102 (107)
Q Consensus        79 ~~C----~~C~~~f~~~~~l~~H~~~~H  102 (107)
                      |.|    ..|+..+.+...+.+|.+..|
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~H  108 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEH  108 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhc
Confidence            778    889888888889999988755


No 95 
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=85.71  E-value=1.2  Score=21.38  Aligned_cols=13  Identities=31%  Similarity=0.703  Sum_probs=9.4

Q ss_pred             CeeeCCCCccccc
Q psy11352         50 LFATCFVCGKQLS   62 (107)
Q Consensus        50 ~~~~C~~C~~~f~   62 (107)
                      ....|+.||..+.
T Consensus        21 eiV~Cp~CGaele   33 (54)
T TIGR01206        21 ELVICDECGAELE   33 (54)
T ss_pred             CEEeCCCCCCEEE
Confidence            3568999987654


No 96 
>KOG2186|consensus
Probab=85.30  E-value=0.29  Score=30.91  Aligned_cols=48  Identities=27%  Similarity=0.674  Sum_probs=37.7

Q ss_pred             CeeeCCCCcccccchhhHHHHHhhhCCCcccCCCCCCcccChHHHHHHHH
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHVSRSRDALRKHVS   99 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~~h~~k~~~C~~C~~~f~~~~~l~~H~~   99 (107)
                      ..|.|+.||....- ..+.+|+....+.-|.|.-|++.|.. .....|..
T Consensus         2 V~FtCnvCgEsvKK-p~vekH~srCrn~~fSCIDC~k~F~~-~sYknH~k   49 (276)
T KOG2186|consen    2 VFFTCNVCGESVKK-PQVEKHMSRCRNAYFSCIDCGKTFER-VSYKNHTK   49 (276)
T ss_pred             eEEehhhhhhhccc-cchHHHHHhccCCeeEEeeccccccc-chhhhhhh
Confidence            35899999987654 45777988888888999999999988 45566654


No 97 
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=84.78  E-value=1.9  Score=24.97  Aligned_cols=18  Identities=22%  Similarity=0.700  Sum_probs=10.4

Q ss_pred             cccCCCCCCcccChHHHH
Q psy11352         78 FYACSSCSHVSRSRDALR   95 (107)
Q Consensus        78 ~~~C~~C~~~f~~~~~l~   95 (107)
                      -+.|+.||+.|...+...
T Consensus       124 f~~C~~C~kiyW~GsH~~  141 (147)
T PF01927_consen  124 FWRCPGCGKIYWEGSHWR  141 (147)
T ss_pred             EEECCCCCCEecccccHH
Confidence            456666666666554443


No 98 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=84.14  E-value=0.65  Score=18.67  Aligned_cols=10  Identities=20%  Similarity=0.461  Sum_probs=6.0

Q ss_pred             cCCCCCCccc
Q psy11352         80 ACSSCSHVSR   89 (107)
Q Consensus        80 ~C~~C~~~f~   89 (107)
                      .|+.||..|.
T Consensus        16 ~Cp~CG~~F~   25 (26)
T PF10571_consen   16 FCPHCGYDFE   25 (26)
T ss_pred             cCCCCCCCCc
Confidence            4666666653


No 99 
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=83.42  E-value=0.73  Score=23.46  Aligned_cols=18  Identities=11%  Similarity=0.359  Sum_probs=13.7

Q ss_pred             CeeeCC--CCcccccchhhH
Q psy11352         50 LFATCF--VCGKQLSNQYNL   67 (107)
Q Consensus        50 ~~~~C~--~C~~~f~~~~~l   67 (107)
                      ..+.|.  .||.+|.....+
T Consensus        26 ~Y~qC~N~eCg~tF~t~es~   45 (72)
T PRK09678         26 RYHQCQNVNCSATFITYESV   45 (72)
T ss_pred             eeeecCCCCCCCEEEEEEEE
Confidence            668897  899998876554


No 100
>KOG4167|consensus
Probab=83.20  E-value=0.88  Score=33.17  Aligned_cols=26  Identities=31%  Similarity=0.478  Sum_probs=22.2

Q ss_pred             CeeeCCCCcccccchhhHHHHHhhhC
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHMETHQ   75 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~~h~   75 (107)
                      -.|.|..|++.|..-.++..||++|.
T Consensus       791 giFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  791 GIFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             ceeehHHHHHHHHHHhhhhHHHHHHH
Confidence            46889999999988888888988875


No 101
>PF14353 CpXC:  CpXC protein
Probab=83.19  E-value=0.38  Score=27.09  Aligned_cols=55  Identities=20%  Similarity=0.280  Sum_probs=28.0

Q ss_pred             ccCCCCCCCCCccCCCCCCCCCCCCCCCCCCC-CCCCCCeeeCCCCcccccchhhHHHH
Q psy11352         13 LISDHCLTSPLSSSIPGSSKTKASGSGTTGGS-SNHSKLFATCFVCGKQLSNQYNLRVH   70 (107)
Q Consensus        13 ~~C~~C~~~~~~~~~~~~l~~h~~~~~~~~~~-~~~~~~~~~C~~C~~~f~~~~~l~~H   70 (107)
                      ..||.|   +..|.........++....-... -...=..+.|+.||..|.-...+..|
T Consensus         2 itCP~C---~~~~~~~v~~~I~~~~~p~l~e~il~g~l~~~~CP~Cg~~~~~~~p~lY~   57 (128)
T PF14353_consen    2 ITCPHC---GHEFEFEVWTSINADEDPELKEKILDGSLFSFTCPSCGHKFRLEYPLLYH   57 (128)
T ss_pred             cCCCCC---CCeeEEEEEeEEcCcCCHHHHHHHHcCCcCEEECCCCCCceecCCCEEEE
Confidence            368888   77776655544431111000000 00111457888888887666555444


No 102
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=82.92  E-value=0.86  Score=26.05  Aligned_cols=24  Identities=33%  Similarity=0.843  Sum_probs=15.8

Q ss_pred             CeeeCCCCcccccchhhHHHHHhhhCC
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHMETHQN   76 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~~h~~   76 (107)
                      ..-.|-+||+.|..   |.+|+..|.|
T Consensus        71 d~i~clecGk~~k~---LkrHL~~~~g   94 (132)
T PF05443_consen   71 DYIICLECGKKFKT---LKRHLRTHHG   94 (132)
T ss_dssp             S-EE-TBT--EESB---HHHHHHHTT-
T ss_pred             CeeEEccCCcccch---HHHHHHHccC
Confidence            45679999999876   6899999865


No 103
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=82.83  E-value=1.4  Score=24.10  Aligned_cols=27  Identities=19%  Similarity=0.258  Sum_probs=23.2

Q ss_pred             CeeeC----CCCcccccchhhHHHHHhhhCC
Q psy11352         50 LFATC----FVCGKQLSNQYNLRVHMETHQN   76 (107)
Q Consensus        50 ~~~~C----~~C~~~f~~~~~l~~H~~~h~~   76 (107)
                      .-|.|    ..|+....+...+..|.+.+.|
T Consensus        79 ~G~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   79 DGYRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             CCeeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            45889    9999999999999999987543


No 104
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=82.26  E-value=2  Score=20.19  Aligned_cols=6  Identities=17%  Similarity=0.357  Sum_probs=3.7

Q ss_pred             ccCCCC
Q psy11352         13 LISDHC   18 (107)
Q Consensus        13 ~~C~~C   18 (107)
                      |+|..|
T Consensus         2 y~C~~C    7 (50)
T cd00730           2 YECRIC    7 (50)
T ss_pred             cCCCCC
Confidence            556666


No 105
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=81.54  E-value=1.2  Score=25.88  Aligned_cols=18  Identities=11%  Similarity=0.300  Sum_probs=13.1

Q ss_pred             CeeeCCCCcccccchhhH
Q psy11352         50 LFATCFVCGKQLSNQYNL   67 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l   67 (107)
                      ..-+|..||+.|.+-..+
T Consensus        27 RRReC~~C~~RFTTyErv   44 (147)
T TIGR00244        27 RRRECLECHERFTTFERA   44 (147)
T ss_pred             ecccCCccCCccceeeec
Confidence            345899999999875443


No 106
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=81.30  E-value=0.75  Score=18.89  Aligned_cols=19  Identities=21%  Similarity=0.553  Sum_probs=9.7

Q ss_pred             eeCCCCcccccchhhHHHHH
Q psy11352         52 ATCFVCGKQLSNQYNLRVHM   71 (107)
Q Consensus        52 ~~C~~C~~~f~~~~~l~~H~   71 (107)
                      |.|-.|++.|. ....+.|.
T Consensus         1 ~sCiDC~~~F~-~~~y~~Ht   19 (28)
T PF08790_consen    1 FSCIDCSKDFD-GDSYKSHT   19 (28)
T ss_dssp             EEETTTTEEEE-GGGTTT--
T ss_pred             CeeecCCCCcC-cCCcCCCC
Confidence            45677777773 33444443


No 107
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=81.12  E-value=1.6  Score=17.26  Aligned_cols=10  Identities=30%  Similarity=0.537  Sum_probs=6.5

Q ss_pred             CeeeCCCCcc
Q psy11352         50 LFATCFVCGK   59 (107)
Q Consensus        50 ~~~~C~~C~~   59 (107)
                      ..|.|+.||+
T Consensus        15 v~f~CPnCG~   24 (24)
T PF07754_consen   15 VPFPCPNCGF   24 (24)
T ss_pred             ceEeCCCCCC
Confidence            4577777763


No 108
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=80.93  E-value=1.3  Score=25.22  Aligned_cols=15  Identities=20%  Similarity=0.479  Sum_probs=12.7

Q ss_pred             CeeeCCCCcccccch
Q psy11352         50 LFATCFVCGKQLSNQ   64 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~   64 (107)
                      ..|.|..|+++|...
T Consensus        52 qRyrC~~C~~tf~~~   66 (129)
T COG3677          52 QRYKCKSCGSTFTVE   66 (129)
T ss_pred             cccccCCcCcceeee
Confidence            679999999998764


No 109
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=80.80  E-value=1.3  Score=25.84  Aligned_cols=16  Identities=19%  Similarity=0.522  Sum_probs=12.3

Q ss_pred             CeeeCCCCcccccchh
Q psy11352         50 LFATCFVCGKQLSNQY   65 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~   65 (107)
                      ..-.|..|+..|.+-.
T Consensus        27 RRReC~~C~~RFTTfE   42 (156)
T COG1327          27 RRRECLECGERFTTFE   42 (156)
T ss_pred             hhhcccccccccchhh
Confidence            4468999999987743


No 110
>PF12907 zf-met2:  Zinc-binding
Probab=78.96  E-value=1.4  Score=19.67  Aligned_cols=27  Identities=22%  Similarity=0.557  Sum_probs=13.3

Q ss_pred             ccCCCCCCcc---cChHHHHHHHHccCCCC
Q psy11352         79 YACSSCSHVS---RSRDALRKHVSYRHPHI  105 (107)
Q Consensus        79 ~~C~~C~~~f---~~~~~l~~H~~~~H~~e  105 (107)
                      +.|.+|-..|   .....|..|....|..+
T Consensus         2 i~C~iC~qtF~~t~~~~~L~eH~enKHpK~   31 (40)
T PF12907_consen    2 IICKICRQTFMQTTNEPQLKEHAENKHPKN   31 (40)
T ss_pred             cCcHHhhHHHHhcCCHHHHHHHHHccCCCC
Confidence            3455555333   23345666665555543


No 111
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=77.75  E-value=2.4  Score=26.36  Aligned_cols=24  Identities=25%  Similarity=0.342  Sum_probs=19.8

Q ss_pred             CeeeCCCCcccccchhhHHHHHhh
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHMET   73 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~~   73 (107)
                      ..|.|..|+|.|.-...+..|+..
T Consensus        76 ~K~~C~lc~KlFkg~eFV~KHI~n   99 (214)
T PF04959_consen   76 DKWRCPLCGKLFKGPEFVRKHIFN   99 (214)
T ss_dssp             EEEEE-SSS-EESSHHHHHHHHHH
T ss_pred             CEECCCCCCcccCChHHHHHHHhh
Confidence            569999999999999999999874


No 112
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=77.49  E-value=2.1  Score=20.43  Aligned_cols=40  Identities=18%  Similarity=0.325  Sum_probs=23.6

Q ss_pred             CeeeCCC--CcccccchhhHHHHHhhhCC-CcccCCC----CCCcccC
Q psy11352         50 LFATCFV--CGKQLSNQYNLRVHMETHQN-AFYACSS----CSHVSRS   90 (107)
Q Consensus        50 ~~~~C~~--C~~~f~~~~~l~~H~~~h~~-k~~~C~~----C~~~f~~   90 (107)
                      .+-.|+.  |...+. ...|..|....-. .+..|+.    |...+..
T Consensus         8 ~~v~C~~~cc~~~i~-r~~l~~H~~~~C~~~~v~C~~~~~GC~~~~~~   54 (60)
T PF02176_consen    8 RPVPCPNGCCNEMIP-RKELDDHLENECPKRPVPCPYSPYGCKERVPR   54 (60)
T ss_dssp             SEEE-TT--S-BEEE-CCCHHHHHHTTSTTSEEE-SS----S--EEEH
T ss_pred             CEeeCCCCCccccee-HHHHHHHHHccCCCCcEECCCCCCCCCCccch
Confidence            4567877  444444 5678899886555 7788888    8776643


No 113
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=76.86  E-value=1.5  Score=25.06  Aligned_cols=15  Identities=27%  Similarity=0.545  Sum_probs=11.3

Q ss_pred             CeeeCCCCcccccch
Q psy11352         50 LFATCFVCGKQLSNQ   64 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~   64 (107)
                      ..+.|..||..|...
T Consensus        69 ~~~~C~~CG~~~~~~   83 (135)
T PRK03824         69 AVLKCRNCGNEWSLK   83 (135)
T ss_pred             eEEECCCCCCEEecc
Confidence            558899999877654


No 114
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=76.58  E-value=1.7  Score=20.35  Aligned_cols=35  Identities=20%  Similarity=0.337  Sum_probs=21.8

Q ss_pred             CeeeCCCCcccccchhhHHHHHhhhCC---CcccCCCCC
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHMETHQN---AFYACSSCS   85 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~~h~~---k~~~C~~C~   85 (107)
                      +.+.|..||..|.....=+....- .|   .|-.|..|-
T Consensus         3 k~l~C~dCg~~FvfTa~EQ~fy~e-Kgf~n~p~RC~~CR   40 (49)
T PF13451_consen    3 KTLTCKDCGAEFVFTAGEQKFYAE-KGFDNEPKRCPSCR   40 (49)
T ss_pred             eeEEcccCCCeEEEehhHHHHHHh-cCCcCCCccCHHHH
Confidence            678899999988776543333221 22   366777663


No 115
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=75.95  E-value=1.5  Score=23.81  Aligned_cols=9  Identities=11%  Similarity=0.335  Sum_probs=6.1

Q ss_pred             cccccCCCC
Q psy11352         10 LHFLISDHC   18 (107)
Q Consensus        10 ~~~~~C~~C   18 (107)
                      .+.|.|+.|
T Consensus        20 ~k~FtCp~C   28 (104)
T COG4888          20 PKTFTCPRC   28 (104)
T ss_pred             CceEecCcc
Confidence            455777777


No 116
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=75.91  E-value=1.4  Score=32.10  Aligned_cols=57  Identities=18%  Similarity=0.240  Sum_probs=37.7

Q ss_pred             cCCCCCCCCCccCCCCCCCCCCCCCCCCCCCCCCCCCee-eCCCCcccccchhhHHHHHhhhCCCcccCCCCCCc
Q psy11352         14 ISDHCLTSPLSSSIPGSSKTKASGSGTTGGSSNHSKLFA-TCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHV   87 (107)
Q Consensus        14 ~C~~C~~~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~-~C~~C~~~f~~~~~l~~H~~~h~~k~~~C~~C~~~   87 (107)
                      .|..|   +-.|+-...+-.-    +..+.-     ..| .|+.|.+.|.+..+-    |.|. .|..|+.||..
T Consensus       125 ~CT~C---GPRfTIi~alPYD----R~nTsM-----~~F~lC~~C~~EY~dP~nR----RfHA-Qp~aCp~CGP~  182 (750)
T COG0068         125 NCTNC---GPRFTIIEALPYD----RENTSM-----ADFPLCPFCDKEYKDPLNR----RFHA-QPIACPKCGPH  182 (750)
T ss_pred             ccCCC---CcceeeeccCCCC----cccCcc-----ccCcCCHHHHHHhcCcccc----cccc-ccccCcccCCC
Confidence            68889   8888776665433    222222     334 499999888877653    2333 58899999964


No 117
>KOG2893|consensus
Probab=75.70  E-value=0.5  Score=29.74  Aligned_cols=50  Identities=18%  Similarity=0.196  Sum_probs=37.0

Q ss_pred             cccccCCCCCCCCCccCCCCCCCCCCCCCCCCCCCCCCCCCeeeCCCCcccccchhhHHHH-HhhhC
Q psy11352         10 LHFLISDHCLTSPLSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQLSNQYNLRVH-METHQ   75 (107)
Q Consensus        10 ~~~~~C~~C~~~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H-~~~h~   75 (107)
                      .|+ .|=.|   ++.|.....|..|   +.    .     +.|+|.+|.+.+.+-..|..| +.+|.
T Consensus         9 ~kp-wcwyc---nrefddekiliqh---qk----a-----khfkchichkkl~sgpglsihcmqvhk   59 (341)
T KOG2893|consen    9 DKP-WCWYC---NREFDDEKILIQH---QK----A-----KHFKCHICHKKLFSGPGLSIHCMQVHK   59 (341)
T ss_pred             CCc-eeeec---ccccchhhhhhhh---hh----h-----ccceeeeehhhhccCCCceeehhhhhh
Confidence            344 57789   9999999888888   32    2     679999999987777667666 44554


No 118
>KOG2785|consensus
Probab=75.65  E-value=3.8  Score=27.64  Aligned_cols=51  Identities=22%  Similarity=0.364  Sum_probs=40.7

Q ss_pred             CeeeCCCCcccccchhhHHHHHhhhCC--C----------------------cccCCCCC---CcccChHHHHHHHHc
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHMETHQN--A----------------------FYACSSCS---HVSRSRDALRKHVSY  100 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~~h~~--k----------------------~~~C~~C~---~~f~~~~~l~~H~~~  100 (107)
                      .|-.|-.|++.+.+-..-..||..+.|  .                      -+.|..|.   +.|.+..+.+.||..
T Consensus       165 ~Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~  242 (390)
T KOG2785|consen  165 IPTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRD  242 (390)
T ss_pred             CCcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhh
Confidence            456689999999998888889876543  2                      35677787   899999999999973


No 119
>KOG2907|consensus
Probab=75.59  E-value=2.3  Score=23.60  Aligned_cols=12  Identities=33%  Similarity=0.891  Sum_probs=7.7

Q ss_pred             cccCCCCCCccc
Q psy11352         78 FYACSSCSHVSR   89 (107)
Q Consensus        78 ~~~C~~C~~~f~   89 (107)
                      -|.|+.|++.|.
T Consensus       102 FYTC~kC~~k~~  113 (116)
T KOG2907|consen  102 FYTCPKCKYKFT  113 (116)
T ss_pred             EEEcCccceeee
Confidence            466777766654


No 120
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=74.95  E-value=2.6  Score=19.31  Aligned_cols=21  Identities=24%  Similarity=0.641  Sum_probs=10.6

Q ss_pred             ccCCCCCCcccChHHHHHHHH
Q psy11352         79 YACSSCSHVSRSRDALRKHVS   99 (107)
Q Consensus        79 ~~C~~C~~~f~~~~~l~~H~~   99 (107)
                      |+|-+|..+...++.|-.||+
T Consensus        21 ykcfqcpftc~~kshl~nhmk   41 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMK   41 (54)
T ss_pred             ceeecCCcccchHHHHHHHHH
Confidence            344445444445555555554


No 121
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=74.67  E-value=1.5  Score=18.26  Aligned_cols=9  Identities=22%  Similarity=0.966  Sum_probs=4.8

Q ss_pred             CcccCCCCC
Q psy11352         77 AFYACSSCS   85 (107)
Q Consensus        77 k~~~C~~C~   85 (107)
                      ..|.|+.|+
T Consensus        18 ~~~vCp~C~   26 (30)
T PF08274_consen   18 ELLVCPECG   26 (30)
T ss_dssp             SSEEETTTT
T ss_pred             CEEeCCccc
Confidence            445555554


No 122
>PHA02998 RNA polymerase subunit; Provisional
Probab=74.65  E-value=2  Score=25.82  Aligned_cols=10  Identities=30%  Similarity=0.647  Sum_probs=4.8

Q ss_pred             ccCCCCCCcc
Q psy11352         79 YACSSCSHVS   88 (107)
Q Consensus        79 ~~C~~C~~~f   88 (107)
                      |.|..||+.|
T Consensus       172 YkC~~CG~~w  181 (195)
T PHA02998        172 HACRDCKKHF  181 (195)
T ss_pred             EEcCCCCCcc
Confidence            4455555444


No 123
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=74.39  E-value=4.8  Score=29.69  Aligned_cols=11  Identities=18%  Similarity=0.507  Sum_probs=7.5

Q ss_pred             CcccCCCCCCc
Q psy11352         77 AFYACSSCSHV   87 (107)
Q Consensus        77 k~~~C~~C~~~   87 (107)
                      .|..|+.||-.
T Consensus       474 ~p~~Cp~Cgs~  484 (730)
T COG1198         474 IPQSCPECGSE  484 (730)
T ss_pred             CCCCCCCCCCC
Confidence            57778777743


No 124
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=74.32  E-value=3.5  Score=18.77  Aligned_cols=10  Identities=30%  Similarity=0.401  Sum_probs=7.3

Q ss_pred             CeeeCCCCcc
Q psy11352         50 LFATCFVCGK   59 (107)
Q Consensus        50 ~~~~C~~C~~   59 (107)
                      ..|.|..|++
T Consensus        36 ~~~~C~~C~~   45 (46)
T PF12760_consen   36 GRYRCKACRK   45 (46)
T ss_pred             CeEECCCCCC
Confidence            5688888764


No 125
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=73.77  E-value=2  Score=23.71  Aligned_cols=27  Identities=7%  Similarity=-0.102  Sum_probs=16.2

Q ss_pred             eCCCCcccccchhhHHHHHhhhCCCcccCCCCCCccc
Q psy11352         53 TCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHVSR   89 (107)
Q Consensus        53 ~C~~C~~~f~~~~~l~~H~~~h~~k~~~C~~C~~~f~   89 (107)
                      .|+.||+.|....          ..|..|+.||+.|.
T Consensus        11 idPetg~KFYDLN----------rdPiVsPytG~s~P   37 (129)
T COG4530          11 IDPETGKKFYDLN----------RDPIVSPYTGKSYP   37 (129)
T ss_pred             cCccccchhhccC----------CCccccCcccccch
Confidence            5666776664311          14777777777763


No 126
>KOG3408|consensus
Probab=73.12  E-value=2  Score=24.12  Aligned_cols=22  Identities=23%  Similarity=0.499  Sum_probs=13.5

Q ss_pred             cccCCCCCCcccChHHHHHHHH
Q psy11352         78 FYACSSCSHVSRSRDALRKHVS   99 (107)
Q Consensus        78 ~~~C~~C~~~f~~~~~l~~H~~   99 (107)
                      .|.|-+|.+-|.....|..|.+
T Consensus        57 qfyCi~CaRyFi~~~~l~~H~k   78 (129)
T KOG3408|consen   57 QFYCIECARYFIDAKALKTHFK   78 (129)
T ss_pred             eeehhhhhhhhcchHHHHHHHh
Confidence            4566666666666666666655


No 127
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=72.78  E-value=2.1  Score=18.94  Aligned_cols=14  Identities=14%  Similarity=0.508  Sum_probs=10.6

Q ss_pred             cccCCCCCCcccCh
Q psy11352         78 FYACSSCSHVSRSR   91 (107)
Q Consensus        78 ~~~C~~C~~~f~~~   91 (107)
                      ||.|..|++.|-..
T Consensus        12 ~f~C~~C~~~FC~~   25 (39)
T smart00154       12 GFKCRHCGNLFCGE   25 (39)
T ss_pred             CeECCccCCccccc
Confidence            78888888877543


No 128
>KOG2482|consensus
Probab=72.68  E-value=2.3  Score=28.36  Aligned_cols=23  Identities=22%  Similarity=0.583  Sum_probs=21.1

Q ss_pred             cccCCCCCCcccChHHHHHHHHc
Q psy11352         78 FYACSSCSHVSRSRDALRKHVSY  100 (107)
Q Consensus        78 ~~~C~~C~~~f~~~~~l~~H~~~  100 (107)
                      .++|-.|.+.|..+..|..||+.
T Consensus       195 r~~CLyCekifrdkntLkeHMrk  217 (423)
T KOG2482|consen  195 RLRCLYCEKIFRDKNTLKEHMRK  217 (423)
T ss_pred             hheeeeeccccCCcHHHHHHHHh
Confidence            47899999999999999999984


No 129
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=72.63  E-value=6.3  Score=17.12  Aligned_cols=8  Identities=25%  Similarity=0.401  Sum_probs=4.9

Q ss_pred             CeeeCCCC
Q psy11352         50 LFATCFVC   57 (107)
Q Consensus        50 ~~~~C~~C   57 (107)
                      ..|.|..|
T Consensus        28 qryrC~~C   35 (36)
T PF03811_consen   28 QRYRCKDC   35 (36)
T ss_pred             EeEecCcC
Confidence            55666655


No 130
>KOG2593|consensus
Probab=72.17  E-value=2.8  Score=28.74  Aligned_cols=14  Identities=21%  Similarity=0.346  Sum_probs=7.8

Q ss_pred             CeeeCCCCcccccc
Q psy11352         50 LFATCFVCGKQLSN   63 (107)
Q Consensus        50 ~~~~C~~C~~~f~~   63 (107)
                      ..|.|+.|.+.|..
T Consensus       127 ~~Y~Cp~C~kkyt~  140 (436)
T KOG2593|consen  127 AGYVCPNCQKKYTS  140 (436)
T ss_pred             ccccCCccccchhh
Confidence            44556666655544


No 131
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=72.12  E-value=2.7  Score=23.35  Aligned_cols=36  Identities=25%  Similarity=0.676  Sum_probs=17.3

Q ss_pred             eeCCCCcccccchhhHHHHHhhhCC---CcccCCCCCCccc
Q psy11352         52 ATCFVCGKQLSNQYNLRVHMETHQN---AFYACSSCSHVSR   89 (107)
Q Consensus        52 ~~C~~C~~~f~~~~~l~~H~~~h~~---k~~~C~~C~~~f~   89 (107)
                      ..|+.||..=.  ..++.+.+.-.+   .-|.|..||..|.
T Consensus        73 ~~CpkCg~~ea--~y~~~QtRsaDEp~T~Fy~C~~Cg~~wr  111 (113)
T COG1594          73 EKCPKCGNKEA--YYWQLQTRSADEPETRFYKCTRCGYRWR  111 (113)
T ss_pred             ccCCCCCCcee--EEEeeehhccCCCceEEEEecccCCEee
Confidence            45666664321  122223333222   3477777776653


No 132
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=71.87  E-value=3.4  Score=30.42  Aligned_cols=11  Identities=27%  Similarity=0.788  Sum_probs=9.3

Q ss_pred             CeeeCCCCccc
Q psy11352         50 LFATCFVCGKQ   60 (107)
Q Consensus        50 ~~~~C~~C~~~   60 (107)
                      .|..|+.||..
T Consensus       474 ~p~~Cp~Cgs~  484 (730)
T COG1198         474 IPQSCPECGSE  484 (730)
T ss_pred             CCCCCCCCCCC
Confidence            78899999875


No 133
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=71.84  E-value=1.9  Score=23.33  Aligned_cols=18  Identities=22%  Similarity=0.429  Sum_probs=14.4

Q ss_pred             hhhCCCcccCCCCCCccc
Q psy11352         72 ETHQNAFYACSSCSHVSR   89 (107)
Q Consensus        72 ~~h~~k~~~C~~C~~~f~   89 (107)
                      ..+.++|.+|..||..|.
T Consensus        73 ~l~~g~~~rC~eCG~~fk   90 (97)
T cd00924          73 WLEKGKPKRCPECGHVFK   90 (97)
T ss_pred             EEeCCCceeCCCCCcEEE
Confidence            345568999999999885


No 134
>KOG4167|consensus
Probab=71.76  E-value=0.52  Score=34.24  Aligned_cols=24  Identities=17%  Similarity=0.434  Sum_probs=21.4

Q ss_pred             cccCCCCCCcccChHHHHHHHHcc
Q psy11352         78 FYACSSCSHVSRSRDALRKHVSYR  101 (107)
Q Consensus        78 ~~~C~~C~~~f~~~~~l~~H~~~~  101 (107)
                      -|-|.+|++.|-.--.+..||++|
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~H  815 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTH  815 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHH
Confidence            489999999999888999999973


No 135
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=71.45  E-value=2.7  Score=23.25  Aligned_cols=27  Identities=22%  Similarity=0.535  Sum_probs=17.5

Q ss_pred             CeeeCCCCcccccchhhHHHHHhhhCCCcccCCCCCCc
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHV   87 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~~h~~k~~~C~~C~~~   87 (107)
                      -...|..||..|.....           .+.|+.||..
T Consensus        69 ~~~~C~~Cg~~~~~~~~-----------~~~CP~Cgs~   95 (113)
T PF01155_consen   69 ARARCRDCGHEFEPDEF-----------DFSCPRCGSP   95 (113)
T ss_dssp             -EEEETTTS-EEECHHC-----------CHH-SSSSSS
T ss_pred             CcEECCCCCCEEecCCC-----------CCCCcCCcCC
Confidence            45789999998876442           3669999864


No 136
>PRK14873 primosome assembly protein PriA; Provisional
Probab=71.27  E-value=4.8  Score=29.38  Aligned_cols=23  Identities=22%  Similarity=0.557  Sum_probs=14.3

Q ss_pred             CeeeCCCCcccccchhhHHHHHhhhCCCcccCCCCCCc
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHV   87 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~~h~~k~~~C~~C~~~   87 (107)
                      ....|..||...               .|+.|+.||..
T Consensus       409 ~~l~Ch~CG~~~---------------~p~~Cp~Cgs~  431 (665)
T PRK14873        409 GTPRCRWCGRAA---------------PDWRCPRCGSD  431 (665)
T ss_pred             CeeECCCCcCCC---------------cCccCCCCcCC
Confidence            456777777421               36678888753


No 137
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=71.21  E-value=7.1  Score=21.33  Aligned_cols=8  Identities=25%  Similarity=0.513  Sum_probs=6.6

Q ss_pred             ccccCCCC
Q psy11352         11 HFLISDHC   18 (107)
Q Consensus        11 ~~~~C~~C   18 (107)
                      ||-.|+.|
T Consensus         1 ~p~~CpYC    8 (102)
T PF11672_consen    1 KPIICPYC    8 (102)
T ss_pred             CCcccCCC
Confidence            57789999


No 138
>PLN02294 cytochrome c oxidase subunit Vb
Probab=71.06  E-value=1.5  Score=26.19  Aligned_cols=21  Identities=10%  Similarity=0.321  Sum_probs=15.7

Q ss_pred             HhhhCCCcccCCCCCCcccCh
Q psy11352         71 METHQNAFYACSSCSHVSRSR   91 (107)
Q Consensus        71 ~~~h~~k~~~C~~C~~~f~~~   91 (107)
                      +..+.|+|..|++||..|.-.
T Consensus       134 f~L~kGkp~RCpeCG~~fkL~  154 (174)
T PLN02294        134 FWLEKGKSFECPVCTQYFELE  154 (174)
T ss_pred             EEecCCCceeCCCCCCEEEEE
Confidence            344556899999999988643


No 139
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=70.79  E-value=1.8  Score=20.06  Aligned_cols=12  Identities=33%  Similarity=0.639  Sum_probs=5.8

Q ss_pred             eeCCCCcccccc
Q psy11352         52 ATCFVCGKQLSN   63 (107)
Q Consensus        52 ~~C~~C~~~f~~   63 (107)
                      |.|..|+..|.-
T Consensus         2 y~C~~CgyvYd~   13 (47)
T PF00301_consen    2 YQCPVCGYVYDP   13 (47)
T ss_dssp             EEETTTSBEEET
T ss_pred             cCCCCCCEEEcC
Confidence            445555554433


No 140
>KOG2785|consensus
Probab=70.04  E-value=4.7  Score=27.22  Aligned_cols=24  Identities=21%  Similarity=0.401  Sum_probs=19.5

Q ss_pred             CcccCCCCCCcccChHHHHHHHHc
Q psy11352         77 AFYACSSCSHVSRSRDALRKHVSY  100 (107)
Q Consensus        77 k~~~C~~C~~~f~~~~~l~~H~~~  100 (107)
                      -++.|..|.+.|....+...|+..
T Consensus        67 ~~~~c~~c~k~~~s~~a~~~hl~S   90 (390)
T KOG2785|consen   67 SVVYCEACNKSFASPKAHENHLKS   90 (390)
T ss_pred             cceehHHhhccccChhhHHHHHHH
Confidence            368899999999988888888763


No 141
>PRK05978 hypothetical protein; Provisional
Probab=69.43  E-value=4  Score=23.88  Aligned_cols=10  Identities=30%  Similarity=1.089  Sum_probs=5.3

Q ss_pred             eCCCCccccc
Q psy11352         53 TCFVCGKQLS   62 (107)
Q Consensus        53 ~C~~C~~~f~   62 (107)
                      .|+.||..|.
T Consensus        54 ~C~~CG~~~~   63 (148)
T PRK05978         54 HCAACGEDFT   63 (148)
T ss_pred             CccccCCccc
Confidence            4555555443


No 142
>KOG2593|consensus
Probab=69.21  E-value=2.1  Score=29.24  Aligned_cols=39  Identities=10%  Similarity=0.132  Sum_probs=27.1

Q ss_pred             CCcccccCCCCCCCCCccCCCCCCCCCCCCCCCCCCCCCCCCCeeeCCCCccc
Q psy11352          8 STLHFLISDHCLTSPLSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQ   60 (107)
Q Consensus         8 ~~~~~~~C~~C~~~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~   60 (107)
                      ....-|.|+.|   .+.|+....+..-    ..-.       -.|.|..|+-.
T Consensus       124 t~~~~Y~Cp~C---~kkyt~Lea~~L~----~~~~-------~~F~C~~C~ge  162 (436)
T KOG2593|consen  124 TNVAGYVCPNC---QKKYTSLEALQLL----DNET-------GEFHCENCGGE  162 (436)
T ss_pred             cccccccCCcc---ccchhhhHHHHhh----cccC-------ceEEEecCCCc
Confidence            34678999999   9998887665432    1122       34999999864


No 143
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=69.05  E-value=2.9  Score=18.48  Aligned_cols=11  Identities=27%  Similarity=0.597  Sum_probs=5.8

Q ss_pred             CeeeCCCCccc
Q psy11352         50 LFATCFVCGKQ   60 (107)
Q Consensus        50 ~~~~C~~C~~~   60 (107)
                      +.+.|..|+..
T Consensus        23 ~~w~C~~C~~~   33 (40)
T PF04810_consen   23 KTWICNFCGTK   33 (40)
T ss_dssp             TEEEETTT--E
T ss_pred             CEEECcCCCCc
Confidence            55777777653


No 144
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=68.78  E-value=5.2  Score=17.84  Aligned_cols=24  Identities=29%  Similarity=0.531  Sum_probs=14.9

Q ss_pred             eeCCCCcccccch--hhHHHHHhhhC
Q psy11352         52 ATCFVCGKQLSNQ--YNLRVHMETHQ   75 (107)
Q Consensus        52 ~~C~~C~~~f~~~--~~l~~H~~~h~   75 (107)
                      -.|+.||..|...  ..-..|.+.|.
T Consensus        14 ~~C~~CgM~Y~~~~~eD~~~H~~yH~   39 (41)
T PF13878_consen   14 TTCPTCGMLYSPGSPEDEKLHKKYHD   39 (41)
T ss_pred             cCCCCCCCEECCCCHHHHHHHHHHHh
Confidence            4788888776543  44555665553


No 145
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Probab=68.76  E-value=8.3  Score=25.39  Aligned_cols=8  Identities=13%  Similarity=0.168  Sum_probs=5.9

Q ss_pred             cccCCCCC
Q psy11352         12 FLISDHCL   19 (107)
Q Consensus        12 ~~~C~~C~   19 (107)
                      .-.||.||
T Consensus       184 ~~~CPvCG  191 (305)
T TIGR01562       184 RTLCPACG  191 (305)
T ss_pred             CCcCCCCC
Confidence            44899994


No 146
>PF07800 DUF1644:  Protein of unknown function (DUF1644);  InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function. The region of interest contains nine highly conserved cysteine residues and is approximately 160 amino acids in length, which probably represent a zinc-binding domain. 
Probab=68.26  E-value=16  Score=21.69  Aligned_cols=56  Identities=25%  Similarity=0.411  Sum_probs=36.9

Q ss_pred             CeeeCCCCcccccchhhHHHHHhhhCC-CcccCCC--CCCcccChHHHHHHHHccCCCCCC
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHMETHQN-AFYACSS--CSHVSRSRDALRKHVSYRHPHISP  107 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~~h~~-k~~~C~~--C~~~f~~~~~l~~H~~~~H~~ekp  107 (107)
                      ....|+.|-..-.-+..+.. .+.+.. |+-.|..  |... .....|.+|.+..|+..+|
T Consensus        79 ~~L~CPLCRG~V~GWtvve~-AR~~LN~K~RsC~~e~C~F~-GtY~eLrKHar~~HP~~rP  137 (162)
T PF07800_consen   79 PELACPLCRGEVKGWTVVEP-ARRFLNAKKRSCSQESCSFS-GTYSELRKHARSEHPSARP  137 (162)
T ss_pred             ccccCccccCceeceEEchH-HHHHhccCCccCcccccccc-cCHHHHHHHHHhhCCCCCC
Confidence            45789998654433333333 455665 7777754  6433 3566899999999998877


No 147
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=68.18  E-value=6  Score=17.48  Aligned_cols=21  Identities=19%  Similarity=0.254  Sum_probs=16.0

Q ss_pred             CeeeCCCCcccccchhhHHHH
Q psy11352         50 LFATCFVCGKQLSNQYNLRVH   70 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H   70 (107)
                      ....|+.|+-.|.....|.+-
T Consensus        18 ~id~C~~C~G~W~d~~el~~~   38 (41)
T PF13453_consen   18 EIDVCPSCGGIWFDAGELEKL   38 (41)
T ss_pred             EEEECCCCCeEEccHHHHHHH
Confidence            557899999888887776543


No 148
>KOG1842|consensus
Probab=67.95  E-value=3  Score=28.77  Aligned_cols=22  Identities=27%  Similarity=0.383  Sum_probs=11.4

Q ss_pred             eeeCCCCcccccchhhHHHHHh
Q psy11352         51 FATCFVCGKQLSNQYNLRVHME   72 (107)
Q Consensus        51 ~~~C~~C~~~f~~~~~l~~H~~   72 (107)
                      -|.|++|...|.+-..|..|..
T Consensus        15 gflCPiC~~dl~~~~~L~~H~d   36 (505)
T KOG1842|consen   15 GFLCPICLLDLPNLSALNDHLD   36 (505)
T ss_pred             cccCchHhhhhhhHHHHHHHHh
Confidence            3555555555555555555544


No 149
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=67.72  E-value=4.4  Score=22.46  Aligned_cols=26  Identities=19%  Similarity=0.409  Sum_probs=18.0

Q ss_pred             CeeeCCCCcccccchhhHHHHHhhhCCCcccCCCCCC
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSH   86 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~~h~~k~~~C~~C~~   86 (107)
                      -...|..||..|....           ..+.|+.||.
T Consensus        69 ~~~~C~~Cg~~~~~~~-----------~~~~CP~Cgs   94 (113)
T PRK12380         69 AQAWCWDCSQVVEIHQ-----------HDAQCPHCHG   94 (113)
T ss_pred             cEEEcccCCCEEecCC-----------cCccCcCCCC
Confidence            4578999997775532           2456999984


No 150
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=66.90  E-value=2.5  Score=20.86  Aligned_cols=9  Identities=44%  Similarity=1.534  Sum_probs=2.5

Q ss_pred             eCCCCcccc
Q psy11352         53 TCFVCGKQL   61 (107)
Q Consensus        53 ~C~~C~~~f   61 (107)
                      .|..|++.|
T Consensus        11 ~C~~C~~~F   19 (69)
T PF01363_consen   11 NCMICGKKF   19 (69)
T ss_dssp             B-TTT--B-
T ss_pred             cCcCcCCcC
Confidence            355555555


No 151
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=66.15  E-value=4.9  Score=18.89  Aligned_cols=10  Identities=30%  Similarity=0.863  Sum_probs=4.7

Q ss_pred             eeCCCCcccc
Q psy11352         52 ATCFVCGKQL   61 (107)
Q Consensus        52 ~~C~~C~~~f   61 (107)
                      +.|..||+.|
T Consensus        19 ~~Cr~Cg~~~   28 (57)
T cd00065          19 HHCRNCGRIF   28 (57)
T ss_pred             cccCcCcCCc
Confidence            4444444443


No 152
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=65.85  E-value=1.6  Score=23.18  Aligned_cols=11  Identities=18%  Similarity=0.739  Sum_probs=6.2

Q ss_pred             cccCCCCCCcc
Q psy11352         78 FYACSSCSHVS   88 (107)
Q Consensus        78 ~~~C~~C~~~f   88 (107)
                      -+.|..|++.|
T Consensus        53 IW~C~~C~~~~   63 (90)
T PF01780_consen   53 IWKCKKCGKKF   63 (90)
T ss_dssp             EEEETTTTEEE
T ss_pred             EeecCCCCCEE
Confidence            35666666554


No 153
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=65.76  E-value=5.1  Score=22.25  Aligned_cols=26  Identities=23%  Similarity=0.708  Sum_probs=18.4

Q ss_pred             CeeeCCCCcccccchhhHHHHHhhhCCCcccCCCCCC
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSH   86 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~~h~~k~~~C~~C~~   86 (107)
                      -...|..|+..|.....           .+.|+.||.
T Consensus        69 ~~~~C~~Cg~~~~~~~~-----------~~~CP~Cgs   94 (115)
T TIGR00100        69 VECECEDCSEEVSPEID-----------LYRCPKCHG   94 (115)
T ss_pred             cEEEcccCCCEEecCCc-----------CccCcCCcC
Confidence            45789999987765321           467999985


No 154
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=65.75  E-value=4.9  Score=28.01  Aligned_cols=28  Identities=25%  Similarity=0.600  Sum_probs=20.1

Q ss_pred             CcccCCCCCCcccChHHHHHHHHccCCC
Q psy11352         77 AFYACSSCSHVSRSRDALRKHVSYRHPH  104 (107)
Q Consensus        77 k~~~C~~C~~~f~~~~~l~~H~~~~H~~  104 (107)
                      +-+.|+.|.+.|.....+..|+...|.+
T Consensus        56 rFWiCp~CskkF~d~~~~~~H~~~eH~~   83 (466)
T PF04780_consen   56 RFWICPRCSKKFSDAESCLSHMEQEHPA   83 (466)
T ss_pred             eEeeCCcccceeCCHHHHHHHHHHhhhh
Confidence            4567777887787777777777755654


No 155
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=65.73  E-value=2  Score=19.33  Aligned_cols=15  Identities=13%  Similarity=0.406  Sum_probs=8.2

Q ss_pred             CcccCCCCCCcccCh
Q psy11352         77 AFYACSSCSHVSRSR   91 (107)
Q Consensus        77 k~~~C~~C~~~f~~~   91 (107)
                      -|+.|+.|++.|-..
T Consensus        12 ~~~~C~~C~~~FC~~   26 (43)
T PF01428_consen   12 LPFKCKHCGKSFCLK   26 (43)
T ss_dssp             SHEE-TTTS-EE-TT
T ss_pred             CCeECCCCCcccCcc
Confidence            377888888777543


No 156
>PRK12496 hypothetical protein; Provisional
Probab=64.98  E-value=6.1  Score=23.45  Aligned_cols=27  Identities=22%  Similarity=0.474  Sum_probs=17.8

Q ss_pred             eeeCCCCcccccchhhHHHHHhhhCCCcccCCCCCCcc
Q psy11352         51 FATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHVS   88 (107)
Q Consensus        51 ~~~C~~C~~~f~~~~~l~~H~~~h~~k~~~C~~C~~~f   88 (107)
                      .+.|..|++.|....           ..-.|+.||...
T Consensus       127 ~~~C~gC~~~~~~~~-----------~~~~C~~CG~~~  153 (164)
T PRK12496        127 RKVCKGCKKKYPEDY-----------PDDVCEICGSPV  153 (164)
T ss_pred             eEECCCCCccccCCC-----------CCCcCCCCCChh
Confidence            477999998885421           123589998653


No 157
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=64.56  E-value=3.3  Score=20.01  Aligned_cols=36  Identities=17%  Similarity=0.421  Sum_probs=18.8

Q ss_pred             eeCCCCcccccchhhHHHHHhhhC-C-CcccCCCCCCc
Q psy11352         52 ATCFVCGKQLSNQYNLRVHMETHQ-N-AFYACSSCSHV   87 (107)
Q Consensus        52 ~~C~~C~~~f~~~~~l~~H~~~h~-~-k~~~C~~C~~~   87 (107)
                      -.|..|++.+.-...-..-.+.-. . ..|.|+.|.-.
T Consensus         3 vkC~lCdk~~~Id~~~~~aKrLrnrPi~tYmC~eC~~R   40 (56)
T PF09963_consen    3 VKCILCDKKEEIDEDTPEAKRLRNRPIHTYMCDECKER   40 (56)
T ss_pred             eEEEecCCEEEeccCCHHHHHhhcCCCcceeChhHHHH
Confidence            357777776554433222222222 2 46888888543


No 158
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=64.23  E-value=4.4  Score=22.09  Aligned_cols=14  Identities=21%  Similarity=0.577  Sum_probs=9.4

Q ss_pred             eeeCCCCcccccch
Q psy11352         51 FATCFVCGKQLSNQ   64 (107)
Q Consensus        51 ~~~C~~C~~~f~~~   64 (107)
                      ++.|..||..|..-
T Consensus         2 pH~CtrCG~vf~~g   15 (112)
T COG3364           2 PHQCTRCGEVFDDG   15 (112)
T ss_pred             Cceecccccccccc
Confidence            46677777777663


No 159
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=63.14  E-value=5.5  Score=21.23  Aligned_cols=11  Identities=18%  Similarity=0.839  Sum_probs=5.4

Q ss_pred             cccCCCCCCcc
Q psy11352         78 FYACSSCSHVS   88 (107)
Q Consensus        78 ~~~C~~C~~~f   88 (107)
                      .+.|..|++.|
T Consensus        54 IW~C~~C~~~~   64 (90)
T PTZ00255         54 IWRCKGCKKTV   64 (90)
T ss_pred             EEEcCCCCCEE
Confidence            44555555444


No 160
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=61.83  E-value=6.4  Score=21.97  Aligned_cols=27  Identities=15%  Similarity=0.413  Sum_probs=17.3

Q ss_pred             CeeeCCCCcccccchhhHHHHHhhhCCCcccCCCCCC
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSH   86 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~~h~~k~~~C~~C~~   86 (107)
                      -.+.|..||..|.....          .-+.|+.||.
T Consensus        70 ~~~~C~~Cg~~~~~~~~----------~~~~CP~Cgs   96 (117)
T PRK00564         70 VELECKDCSHVFKPNAL----------DYGVCEKCHS   96 (117)
T ss_pred             CEEEhhhCCCccccCCc----------cCCcCcCCCC
Confidence            45789999977654321          1224888885


No 161
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=61.61  E-value=14  Score=24.49  Aligned_cols=9  Identities=11%  Similarity=0.072  Sum_probs=6.7

Q ss_pred             ccccCCCCC
Q psy11352         11 HFLISDHCL   19 (107)
Q Consensus        11 ~~~~C~~C~   19 (107)
                      ..-.||.||
T Consensus       186 ~~~~CPvCG  194 (309)
T PRK03564        186 QRQFCPVCG  194 (309)
T ss_pred             CCCCCCCCC
Confidence            456899994


No 162
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=60.38  E-value=9  Score=22.08  Aligned_cols=26  Identities=27%  Similarity=0.511  Sum_probs=20.3

Q ss_pred             CeeeCCCCcccccchhhHHHHHhhhCC-Cc
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHMETHQN-AF   78 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~~h~~-k~   78 (107)
                      ..-.|-++|+.|.   +|++|+.+|.+ .|
T Consensus        75 D~IicLEDGkkfK---SLKRHL~t~~gmTP  101 (148)
T COG4957          75 DYIICLEDGKKFK---SLKRHLTTHYGLTP  101 (148)
T ss_pred             CeEEEeccCcchH---HHHHHHhcccCCCH
Confidence            3456999999985   58999999876 44


No 163
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=58.61  E-value=8.2  Score=21.42  Aligned_cols=27  Identities=15%  Similarity=0.327  Sum_probs=17.7

Q ss_pred             CeeeCCCCcccccchhhHHHHHhhhCCCcccCCCCCC
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSH   86 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~~h~~k~~~C~~C~~   86 (107)
                      -...|..|+..|.....          ..+.|+.||.
T Consensus        69 ~~~~C~~Cg~~~~~~~~----------~~~~CP~Cgs   95 (114)
T PRK03681         69 AECWCETCQQYVTLLTQ----------RVRRCPQCHG   95 (114)
T ss_pred             cEEEcccCCCeeecCCc----------cCCcCcCcCC
Confidence            45789999976654211          1256999984


No 165
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=58.53  E-value=5.8  Score=21.87  Aligned_cols=14  Identities=14%  Similarity=0.259  Sum_probs=8.2

Q ss_pred             eeeCCCCcccccch
Q psy11352         51 FATCFVCGKQLSNQ   64 (107)
Q Consensus        51 ~~~C~~C~~~f~~~   64 (107)
                      .|.|+.|+..+...
T Consensus        19 ~~iCpeC~~EW~~~   32 (109)
T TIGR00686        19 QLICPSCLYEWNEN   32 (109)
T ss_pred             eeECcccccccccc
Confidence            46666666655443


No 166
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=58.19  E-value=18  Score=16.53  Aligned_cols=15  Identities=20%  Similarity=0.293  Sum_probs=10.8

Q ss_pred             CeeeCCCCcccccch
Q psy11352         50 LFATCFVCGKQLSNQ   64 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~   64 (107)
                      ..+.|+.||..+...
T Consensus        19 ~~~vC~~Cg~~~~~~   33 (52)
T smart00661       19 RRFVCRKCGYEEPIE   33 (52)
T ss_pred             CEEECCcCCCeEECC
Confidence            368899998776554


No 167
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=57.95  E-value=6.1  Score=21.11  Aligned_cols=11  Identities=18%  Similarity=0.718  Sum_probs=5.6

Q ss_pred             cccCCCCCCcc
Q psy11352         78 FYACSSCSHVS   88 (107)
Q Consensus        78 ~~~C~~C~~~f   88 (107)
                      .+.|..|++.|
T Consensus        53 IW~C~~C~~~~   63 (91)
T TIGR00280        53 IWTCRKCGAKF   63 (91)
T ss_pred             EEEcCCCCCEE
Confidence            45555555544


No 168
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=57.22  E-value=7.4  Score=20.97  Aligned_cols=37  Identities=24%  Similarity=0.547  Sum_probs=19.5

Q ss_pred             eeeCCCCcccccchhhHHHHHhhhCC---CcccCCCCCCccc
Q psy11352         51 FATCFVCGKQLSNQYNLRVHMETHQN---AFYACSSCSHVSR   89 (107)
Q Consensus        51 ~~~C~~C~~~f~~~~~l~~H~~~h~~---k~~~C~~C~~~f~   89 (107)
                      ...|+.||..-..  .++..++.-.+   .-|.|..|+..+.
T Consensus        62 ~~~Cp~Cg~~~a~--f~~~Q~RsadE~~T~fy~C~~C~~~w~  101 (104)
T TIGR01384        62 RVECPKCGHKEAY--YWLLQTRRADEPETRFYKCTKCGYVWR  101 (104)
T ss_pred             cCCCCCCCCCeeE--EEEeccCCCCCCcEEEEEeCCCCCeeE
Confidence            3578888754221  22222333222   3588888887653


No 169
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=56.95  E-value=4.3  Score=19.22  Aligned_cols=26  Identities=15%  Similarity=0.304  Sum_probs=14.3

Q ss_pred             CeeeCCCCcccccchhhHHHHHhhhC
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHMETHQ   75 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~~h~   75 (107)
                      ..|.|+.|...|-..-.+-.|...|.
T Consensus        20 ~~y~C~~C~~~FC~dCD~fiHE~LH~   45 (51)
T PF07975_consen   20 SRYRCPKCKNHFCIDCDVFIHETLHN   45 (51)
T ss_dssp             EEE--TTTT--B-HHHHHTTTTTS-S
T ss_pred             CeEECCCCCCccccCcChhhhccccC
Confidence            56999999998887776666655443


No 170
>KOG0717|consensus
Probab=56.46  E-value=6.4  Score=27.43  Aligned_cols=22  Identities=23%  Similarity=0.496  Sum_probs=17.0

Q ss_pred             ccCCCCCCcccChHHHHHHHHc
Q psy11352         79 YACSSCSHVSRSRDALRKHVSY  100 (107)
Q Consensus        79 ~~C~~C~~~f~~~~~l~~H~~~  100 (107)
                      +.|.+|.+.|.+..+|..|..+
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            6788888888888888777653


No 171
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=56.24  E-value=7.6  Score=22.84  Aligned_cols=34  Identities=21%  Similarity=0.529  Sum_probs=21.3

Q ss_pred             CeeeCCCCcccccchhhHHHHHhhhCCCcccCCCCCCc
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHV   87 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~~h~~k~~~C~~C~~~   87 (107)
                      -+|.|. |+..|.+   .++|-.+-.|..|.|..|+-.
T Consensus       116 ~~Y~C~-C~q~~l~---~RRhn~~~~g~~YrC~~C~gk  149 (156)
T COG3091         116 YPYRCQ-CQQHYLR---IRRHNTVRRGEVYRCGKCGGK  149 (156)
T ss_pred             eeEEee-cCCccch---hhhcccccccceEEeccCCce
Confidence            578888 8887654   233433333456888888743


No 172
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=56.12  E-value=4.2  Score=19.17  Aligned_cols=12  Identities=17%  Similarity=0.534  Sum_probs=6.4

Q ss_pred             cCCCCCCcccCh
Q psy11352         80 ACSSCSHVSRSR   91 (107)
Q Consensus        80 ~C~~C~~~f~~~   91 (107)
                      .|++|++.|...
T Consensus        22 ~CPlC~r~l~~e   33 (54)
T PF04423_consen   22 CCPLCGRPLDEE   33 (54)
T ss_dssp             E-TTT--EE-HH
T ss_pred             cCCCCCCCCCHH
Confidence            899999988644


No 173
>PRK10220 hypothetical protein; Provisional
Probab=55.93  E-value=8.3  Score=21.32  Aligned_cols=15  Identities=13%  Similarity=0.372  Sum_probs=9.0

Q ss_pred             CeeeCCCCcccccch
Q psy11352         50 LFATCFVCGKQLSNQ   64 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~   64 (107)
                      ..|.|+.|+..|...
T Consensus        19 ~~~vCpeC~hEW~~~   33 (111)
T PRK10220         19 GMYICPECAHEWNDA   33 (111)
T ss_pred             CeEECCcccCcCCcc
Confidence            346777776665543


No 174
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=55.49  E-value=1.5  Score=18.94  Aligned_cols=11  Identities=27%  Similarity=0.854  Sum_probs=4.6

Q ss_pred             cccCCCCCCcc
Q psy11352         78 FYACSSCSHVS   88 (107)
Q Consensus        78 ~~~C~~C~~~f   88 (107)
                      +..|..||-.+
T Consensus        21 ~isC~~CGPr~   31 (35)
T PF07503_consen   21 FISCTNCGPRY   31 (35)
T ss_dssp             T--BTTCC-SC
T ss_pred             CccCCCCCCCE
Confidence            45566666544


No 175
>KOG2482|consensus
Probab=55.48  E-value=7.3  Score=26.12  Aligned_cols=23  Identities=26%  Similarity=0.580  Sum_probs=21.1

Q ss_pred             eeeCCCCcccccchhhHHHHHhh
Q psy11352         51 FATCFVCGKQLSNQYNLRVHMET   73 (107)
Q Consensus        51 ~~~C~~C~~~f~~~~~l~~H~~~   73 (107)
                      .+.|-.|.+.|..+..|..||+.
T Consensus       195 r~~CLyCekifrdkntLkeHMrk  217 (423)
T KOG2482|consen  195 RLRCLYCEKIFRDKNTLKEHMRK  217 (423)
T ss_pred             hheeeeeccccCCcHHHHHHHHh
Confidence            47899999999999999999985


No 176
>TIGR01385 TFSII transcription elongation factor S-II. This model represents eukaryotic transcription elongation factor S-II. This protein allows stalled RNA transcription complexes to perform a cleavage of the nascent RNA and restart at the newly generated 3-prime end.
Probab=55.01  E-value=10  Score=24.92  Aligned_cols=10  Identities=40%  Similarity=0.933  Sum_probs=5.0

Q ss_pred             eeCCCCcccc
Q psy11352         52 ATCFVCGKQL   61 (107)
Q Consensus        52 ~~C~~C~~~f   61 (107)
                      |.|..||..|
T Consensus       287 ~~C~~Cg~~w  296 (299)
T TIGR01385       287 VTCEECGNRW  296 (299)
T ss_pred             EEcCCCCCee
Confidence            4555555443


No 177
>KOG2636|consensus
Probab=54.81  E-value=9.1  Score=26.57  Aligned_cols=23  Identities=17%  Similarity=0.439  Sum_probs=18.9

Q ss_pred             CeeeCCCCc-ccccchhhHHHHHh
Q psy11352         50 LFATCFVCG-KQLSNQYNLRVHME   72 (107)
Q Consensus        50 ~~~~C~~C~-~~f~~~~~l~~H~~   72 (107)
                      ..|.|.+|| +++.-...+.+|-.
T Consensus       400 ~ey~CEICGNy~Y~GrkaF~RHF~  423 (497)
T KOG2636|consen  400 IEYNCEICGNYVYKGRKAFDRHFN  423 (497)
T ss_pred             cccceeeccCccccCcHHHHHHhH
Confidence            679999999 78888888888853


No 178
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=54.59  E-value=24  Score=28.09  Aligned_cols=28  Identities=18%  Similarity=0.422  Sum_probs=16.5

Q ss_pred             CeeeCCCCcccccchhhHHHHHhhhCCCcccCCCCCCc
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHV   87 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~~h~~k~~~C~~C~~~   87 (107)
                      ..+.|+.||.......         ++ ...|+.|+..
T Consensus       691 ~vy~CPsCGaev~~de---------s~-a~~CP~CGtp  718 (1337)
T PRK14714        691 PVYVCPDCGAEVPPDE---------SG-RVECPRCDVE  718 (1337)
T ss_pred             CceeCccCCCccCCCc---------cc-cccCCCCCCc
Confidence            3578888887543211         11 3468888843


No 179
>KOG0978|consensus
Probab=54.54  E-value=8.5  Score=28.28  Aligned_cols=46  Identities=20%  Similarity=0.365  Sum_probs=26.0

Q ss_pred             eeeCCCCcccccchhhH-HHHH------hhhCC-CcccCCCCCCcccChHHHHH
Q psy11352         51 FATCFVCGKQLSNQYNL-RVHM------ETHQN-AFYACSSCSHVSRSRDALRK   96 (107)
Q Consensus        51 ~~~C~~C~~~f~~~~~l-~~H~------~~h~~-k~~~C~~C~~~f~~~~~l~~   96 (107)
                      ..+|+.|...+...... --|.      +.-.+ +.-+||.|+..|...+-+..
T Consensus       643 ~LkCs~Cn~R~Kd~vI~kC~H~FC~~Cvq~r~etRqRKCP~Cn~aFganDv~~I  696 (698)
T KOG0978|consen  643 LLKCSVCNTRWKDAVITKCGHVFCEECVQTRYETRQRKCPKCNAAFGANDVHRI  696 (698)
T ss_pred             ceeCCCccCchhhHHHHhcchHHHHHHHHHHHHHhcCCCCCCCCCCCccccccc
Confidence            46788887544332111 1121      11123 56689999999987765543


No 180
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=54.38  E-value=12  Score=26.32  Aligned_cols=9  Identities=33%  Similarity=0.800  Sum_probs=4.5

Q ss_pred             eeeCCCCcc
Q psy11352         51 FATCFVCGK   59 (107)
Q Consensus        51 ~~~C~~C~~   59 (107)
                      ...|..||.
T Consensus       240 ~l~Ch~Cg~  248 (505)
T TIGR00595       240 KLRCHYCGY  248 (505)
T ss_pred             eEEcCCCcC
Confidence            345555553


No 181
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=53.20  E-value=14  Score=17.79  Aligned_cols=12  Identities=25%  Similarity=0.434  Sum_probs=7.9

Q ss_pred             CeeeCCCCcccc
Q psy11352         50 LFATCFVCGKQL   61 (107)
Q Consensus        50 ~~~~C~~C~~~f   61 (107)
                      ..|.|+.||..+
T Consensus        13 v~~~Cp~cGipt   24 (55)
T PF13824_consen   13 VNFECPDCGIPT   24 (55)
T ss_pred             cCCcCCCCCCcC
Confidence            557777777644


No 182
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=53.14  E-value=16  Score=23.43  Aligned_cols=14  Identities=14%  Similarity=0.294  Sum_probs=10.2

Q ss_pred             CeeeCCCCcccccc
Q psy11352         50 LFATCFVCGKQLSN   63 (107)
Q Consensus        50 ~~~~C~~C~~~f~~   63 (107)
                      -.|.|..|+..|.-
T Consensus       154 aef~C~~C~h~F~G  167 (278)
T PF15135_consen  154 AEFHCPKCRHNFRG  167 (278)
T ss_pred             eeeecccccccchh
Confidence            35788888887763


No 183
>COG1773 Rubredoxin [Energy production and conversion]
Probab=53.01  E-value=7.4  Score=18.73  Aligned_cols=36  Identities=17%  Similarity=0.239  Sum_probs=22.0

Q ss_pred             CeeeCCCCcccccchhhHHHHHhhhCC-------CcccCCCCCC
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHMETHQN-------AFYACSSCSH   86 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~~h~~-------k~~~C~~C~~   86 (107)
                      +.|.|..||..|.-..--...- +--|       ..+.|+.||-
T Consensus         2 ~~~~C~~CG~vYd~e~Gdp~~g-i~pgT~fedlPd~w~CP~Cg~   44 (55)
T COG1773           2 KRWRCSVCGYVYDPEKGDPRCG-IAPGTPFEDLPDDWVCPECGV   44 (55)
T ss_pred             CceEecCCceEeccccCCccCC-CCCCCchhhCCCccCCCCCCC
Confidence            3589999999887654332221 1111       1478999984


No 184
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=52.53  E-value=17  Score=17.00  Aligned_cols=9  Identities=33%  Similarity=0.619  Sum_probs=4.4

Q ss_pred             eeCCCCccc
Q psy11352         52 ATCFVCGKQ   60 (107)
Q Consensus        52 ~~C~~C~~~   60 (107)
                      +.|..||.+
T Consensus        38 ~~C~~Cgyt   46 (50)
T PRK00432         38 WHCGKCGYT   46 (50)
T ss_pred             EECCCcCCE
Confidence            445555543


No 185
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=51.50  E-value=21  Score=16.74  Aligned_cols=16  Identities=19%  Similarity=0.553  Sum_probs=10.7

Q ss_pred             CeeeCCCCcccccchh
Q psy11352         50 LFATCFVCGKQLSNQY   65 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~   65 (107)
                      ..+.|+.||-.|...-
T Consensus        27 v~W~C~~Cgh~w~~~v   42 (55)
T PF14311_consen   27 VWWKCPKCGHEWKASV   42 (55)
T ss_pred             EEEECCCCCCeeEccH
Confidence            4577888877665543


No 186
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=51.05  E-value=8.7  Score=20.49  Aligned_cols=11  Identities=18%  Similarity=0.700  Sum_probs=6.0

Q ss_pred             cccCCCCCCcc
Q psy11352         78 FYACSSCSHVS   88 (107)
Q Consensus        78 ~~~C~~C~~~f   88 (107)
                      .+.|..|++.|
T Consensus        54 IW~C~~C~~~~   64 (90)
T PRK03976         54 IWECRKCGAKF   64 (90)
T ss_pred             EEEcCCCCCEE
Confidence            45555555544


No 187
>PF09855 DUF2082:  Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082);  InterPro: IPR018652  This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins.
Probab=50.94  E-value=7.6  Score=19.28  Aligned_cols=6  Identities=17%  Similarity=0.523  Sum_probs=4.9

Q ss_pred             ccCCCC
Q psy11352         13 LISDHC   18 (107)
Q Consensus        13 ~~C~~C   18 (107)
                      |.|+.|
T Consensus         1 y~C~KC    6 (64)
T PF09855_consen    1 YKCPKC    6 (64)
T ss_pred             CCCCCC
Confidence            678888


No 188
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=50.83  E-value=12  Score=18.44  Aligned_cols=13  Identities=15%  Similarity=0.672  Sum_probs=7.7

Q ss_pred             CcccCCCCCCccc
Q psy11352         77 AFYACSSCSHVSR   89 (107)
Q Consensus        77 k~~~C~~C~~~f~   89 (107)
                      .-|.|+.||..+.
T Consensus        45 r~~~C~~Cg~~~~   57 (69)
T PF07282_consen   45 RVFTCPNCGFEMD   57 (69)
T ss_pred             ceEEcCCCCCEEC
Confidence            4566666665543


No 189
>KOG3507|consensus
Probab=50.44  E-value=10  Score=18.49  Aligned_cols=30  Identities=17%  Similarity=0.417  Sum_probs=18.0

Q ss_pred             CeeeCCCCcccccchhhHHHHHhhhCCCcccCCCCCCccc
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHVSR   89 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~~h~~k~~~C~~C~~~f~   89 (107)
                      ..|.|..|+..-..          ..+..++|..||....
T Consensus        19 miYiCgdC~~en~l----------k~~D~irCReCG~RIl   48 (62)
T KOG3507|consen   19 MIYICGDCGQENTL----------KRGDVIRCRECGYRIL   48 (62)
T ss_pred             EEEEeccccccccc----------cCCCcEehhhcchHHH
Confidence            56788888753211          1125788888886543


No 190
>KOG2071|consensus
Probab=50.03  E-value=9.3  Score=27.39  Aligned_cols=24  Identities=21%  Similarity=0.357  Sum_probs=18.3

Q ss_pred             CcccCCCCCCcccChHHHHHHHHc
Q psy11352         77 AFYACSSCSHVSRSRDALRKHVSY  100 (107)
Q Consensus        77 k~~~C~~C~~~f~~~~~l~~H~~~  100 (107)
                      .|-+|..||..|........||.+
T Consensus       417 ~pnqC~~CG~R~~~~ee~sk~md~  440 (579)
T KOG2071|consen  417 SPNQCKSCGLRFDDSEERSKHMDI  440 (579)
T ss_pred             CcchhcccccccccchhhhhHhhh
Confidence            467888888888887777777765


No 191
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=49.73  E-value=8.2  Score=22.08  Aligned_cols=15  Identities=20%  Similarity=0.530  Sum_probs=12.6

Q ss_pred             eeeCCCCcccccchh
Q psy11352         51 FATCFVCGKQLSNQY   65 (107)
Q Consensus        51 ~~~C~~C~~~f~~~~   65 (107)
                      |+.|..||+.|..-+
T Consensus         1 PH~Ct~Cg~~f~dgs   15 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGS   15 (131)
T ss_pred             CcccCcCCCCcCCCc
Confidence            578999999998755


No 192
>TIGR00416 sms DNA repair protein RadA. The gene protuct codes for a probable ATP-dependent protease involved in both DNA repair and degradation of proteins, peptides, glycopeptides. Also known as sms. Residues 11-28 of the SEED alignment contain a putative Zn binding domain. Residues 110-117 of the seed contain a putative ATP binding site both documented in Haemophilus and in Listeria monocytogenes. for E.coli see ( J. BACTERIOL. 178:5045-5048(1996)).
Probab=49.61  E-value=19  Score=25.11  Aligned_cols=9  Identities=22%  Similarity=0.575  Sum_probs=5.1

Q ss_pred             eeeCCCCcc
Q psy11352         51 FATCFVCGK   59 (107)
Q Consensus        51 ~~~C~~C~~   59 (107)
                      ...|+.|+.
T Consensus        21 ~g~Cp~C~~   29 (454)
T TIGR00416        21 QGKCPACHA   29 (454)
T ss_pred             cEECcCCCC
Confidence            356666653


No 193
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=49.48  E-value=22  Score=24.98  Aligned_cols=36  Identities=17%  Similarity=0.319  Sum_probs=19.8

Q ss_pred             CeeeCCCCcccccchhhHHHHHhhhCC-------CcccCCCCCC
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHMETHQN-------AFYACSSCSH   86 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~~h~~-------k~~~C~~C~~   86 (107)
                      ..|.|..||..|.-...-... .+--|       ..|.|+.|+-
T Consensus       424 ~~~~c~~c~~~yd~~~g~~~~-~~~~gt~~~~lp~~~~cp~c~~  466 (479)
T PRK05452        424 PRMQCSVCQWIYDPAKGEPMQ-DVAPGTPWSEVPDNFLCPECSL  466 (479)
T ss_pred             CeEEECCCCeEECCCCCCccc-CCCCCCChhhCCCCCcCcCCCC
Confidence            668888888777654221111 11111       2478888874


No 194
>PRK11823 DNA repair protein RadA; Provisional
Probab=49.31  E-value=20  Score=24.89  Aligned_cols=7  Identities=14%  Similarity=0.652  Sum_probs=4.1

Q ss_pred             cccCCCC
Q psy11352         12 FLISDHC   18 (107)
Q Consensus        12 ~~~C~~C   18 (107)
                      .|.|..|
T Consensus         7 ~y~C~~C   13 (446)
T PRK11823          7 AYVCQEC   13 (446)
T ss_pred             eEECCcC
Confidence            4566666


No 195
>PRK04023 DNA polymerase II large subunit; Validated
Probab=49.19  E-value=40  Score=26.32  Aligned_cols=10  Identities=20%  Similarity=0.524  Sum_probs=6.8

Q ss_pred             cccCCCCCCc
Q psy11352         78 FYACSSCSHV   87 (107)
Q Consensus        78 ~~~C~~C~~~   87 (107)
                      ++.|+.||..
T Consensus       663 ~y~CPKCG~E  672 (1121)
T PRK04023        663 EDECEKCGRE  672 (1121)
T ss_pred             CCcCCCCCCC
Confidence            5668888753


No 196
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=49.08  E-value=4.4  Score=18.60  Aligned_cols=15  Identities=27%  Similarity=0.817  Sum_probs=9.1

Q ss_pred             CeeeCCC--Ccccccch
Q psy11352         50 LFATCFV--CGKQLSNQ   64 (107)
Q Consensus        50 ~~~~C~~--C~~~f~~~   64 (107)
                      ..+.|..  ||-.|...
T Consensus        24 ~Y~qC~N~~Cg~tfv~~   40 (47)
T PF04606_consen   24 LYCQCTNPECGHTFVAN   40 (47)
T ss_pred             EEEEECCCcCCCEEEEE
Confidence            4566744  77777543


No 197
>PRK05580 primosome assembly protein PriA; Validated
Probab=48.65  E-value=16  Score=26.77  Aligned_cols=9  Identities=33%  Similarity=0.755  Sum_probs=4.4

Q ss_pred             eeeCCCCcc
Q psy11352         51 FATCFVCGK   59 (107)
Q Consensus        51 ~~~C~~C~~   59 (107)
                      +..|+.||.
T Consensus       421 ~~~Cp~Cg~  429 (679)
T PRK05580        421 PKACPECGS  429 (679)
T ss_pred             CCCCCCCcC
Confidence            344555543


No 198
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=48.54  E-value=15  Score=21.77  Aligned_cols=17  Identities=29%  Similarity=0.440  Sum_probs=12.2

Q ss_pred             CeeeCCCCcccccchhh
Q psy11352         50 LFATCFVCGKQLSNQYN   66 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~   66 (107)
                      .|.-|..||+.|++...
T Consensus        67 ~PsYC~~CGkpyPWt~~   83 (158)
T PF10083_consen   67 APSYCHNCGKPYPWTEN   83 (158)
T ss_pred             CChhHHhCCCCCchHHH
Confidence            56678888888877644


No 199
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=47.78  E-value=12  Score=21.51  Aligned_cols=32  Identities=19%  Similarity=0.477  Sum_probs=17.7

Q ss_pred             CeeeCCCCcccccchhhHHHHHhhhCCCcccCCCCCCcc
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHVS   88 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~~h~~k~~~C~~C~~~f   88 (107)
                      -.|.|..|+..+.....+ .-      ..|.|..|+..|
T Consensus       122 ~~~~C~~C~~~~~r~~~~-~~------~~~~C~~C~~~l  153 (157)
T PF10263_consen  122 YVYRCPSCGREYKRHRRS-KR------KRYRCGRCGGPL  153 (157)
T ss_pred             eEEEcCCCCCEeeeeccc-ch------hhEECCCCCCEE
Confidence            457777777665554443 11      126677776544


No 200
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=47.68  E-value=15  Score=25.44  Aligned_cols=15  Identities=20%  Similarity=0.401  Sum_probs=11.8

Q ss_pred             eeeCCCCcccccchh
Q psy11352         51 FATCFVCGKQLSNQY   65 (107)
Q Consensus        51 ~~~C~~C~~~f~~~~   65 (107)
                      -|.|..||..+....
T Consensus       367 g~rC~kCg~~~~~~~  381 (421)
T COG1571         367 GFRCKKCGTRARETL  381 (421)
T ss_pred             CcccccccccCCccc
Confidence            489999998877654


No 201
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=46.97  E-value=20  Score=23.43  Aligned_cols=32  Identities=28%  Similarity=0.638  Sum_probs=19.2

Q ss_pred             eeeCCCCcccccchhhHHHHHhhhCCCcccCCCCCCcccC
Q psy11352         51 FATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHVSRS   90 (107)
Q Consensus        51 ~~~C~~C~~~f~~~~~l~~H~~~h~~k~~~C~~C~~~f~~   90 (107)
                      ..+|+.|+.....+. |..       .-+.|+.|+..|.-
T Consensus        26 ~~~c~~c~~~~~~~~-l~~-------~~~vc~~c~~h~rl   57 (285)
T TIGR00515        26 WTKCPKCGQVLYTKE-LER-------NLEVCPKCDHHMRM   57 (285)
T ss_pred             eeECCCCcchhhHHH-HHh-------hCCCCCCCCCcCcC
Confidence            567888887644332 111       24678888876653


No 202
>KOG2071|consensus
Probab=46.91  E-value=15  Score=26.48  Aligned_cols=27  Identities=22%  Similarity=0.461  Sum_probs=22.5

Q ss_pred             CCeeeCCCCcccccchhhHHHHHhhhC
Q psy11352         49 KLFATCFVCGKQLSNQYNLRVHMETHQ   75 (107)
Q Consensus        49 ~~~~~C~~C~~~f~~~~~l~~H~~~h~   75 (107)
                      ..+..|..||..|........||..|.
T Consensus       416 ~~pnqC~~CG~R~~~~ee~sk~md~H~  442 (579)
T KOG2071|consen  416 DSPNQCKSCGLRFDDSEERSKHMDIHD  442 (579)
T ss_pred             CCcchhcccccccccchhhhhHhhhhh
Confidence            367899999999999988888877664


No 203
>PRK04351 hypothetical protein; Provisional
Probab=46.25  E-value=15  Score=21.46  Aligned_cols=34  Identities=21%  Similarity=0.502  Sum_probs=22.6

Q ss_pred             CeeeCCCCcccccchhhHHHHHhhhCCCcccCCCCCCcccC
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHVSRS   90 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~~h~~k~~~C~~C~~~f~~   90 (107)
                      -.|.|..||..+...       +.+....|.|..|+-.+..
T Consensus       111 y~Y~C~~Cg~~~~r~-------Rr~n~~~yrCg~C~g~L~~  144 (149)
T PRK04351        111 YLYECQSCGQQYLRK-------RRINTKRYRCGKCRGKLKL  144 (149)
T ss_pred             EEEECCCCCCEeeee-------eecCCCcEEeCCCCcEeee
Confidence            458899999766432       2233368999999866543


No 204
>PTZ00448 hypothetical protein; Provisional
Probab=46.06  E-value=18  Score=24.56  Aligned_cols=23  Identities=17%  Similarity=0.456  Sum_probs=18.3

Q ss_pred             cccCCCCCCcccChHHHHHHHHc
Q psy11352         78 FYACSSCSHVSRSRDALRKHVSY  100 (107)
Q Consensus        78 ~~~C~~C~~~f~~~~~l~~H~~~  100 (107)
                      .|.|..|+..|......+.|.++
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             CccccccccccCCHHHHHHHhhh
Confidence            57799999888877777788764


No 205
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=45.74  E-value=22  Score=23.42  Aligned_cols=34  Identities=18%  Similarity=0.429  Sum_probs=20.9

Q ss_pred             CeeeCCCCcccccchhhHHHHHhhhCCCcccCCCCCCcccCh
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHVSRSR   91 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~~h~~k~~~C~~C~~~f~~~   91 (107)
                      -..+|+.|+.....+. |..       .-+.|+.|+..|.-.
T Consensus        37 lw~kc~~C~~~~~~~~-l~~-------~~~vcp~c~~h~rlt   70 (296)
T CHL00174         37 LWVQCENCYGLNYKKF-LKS-------KMNICEQCGYHLKMS   70 (296)
T ss_pred             CeeECCCccchhhHHH-HHH-------cCCCCCCCCCCcCCC
Confidence            3567999987654332 111       356888888876533


No 206
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones]
Probab=45.74  E-value=19  Score=25.05  Aligned_cols=6  Identities=17%  Similarity=0.999  Sum_probs=3.1

Q ss_pred             ccCCCC
Q psy11352         13 LISDHC   18 (107)
Q Consensus        13 ~~C~~C   18 (107)
                      |.|..|
T Consensus         8 f~C~~C   13 (456)
T COG1066           8 FVCQEC   13 (456)
T ss_pred             EEcccC
Confidence            455555


No 207
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=45.46  E-value=16  Score=21.78  Aligned_cols=20  Identities=25%  Similarity=0.730  Sum_probs=15.2

Q ss_pred             CcccCCCCCCcccChHHHHH
Q psy11352         77 AFYACSSCSHVSRSRDALRK   96 (107)
Q Consensus        77 k~~~C~~C~~~f~~~~~l~~   96 (107)
                      .-+.|+.||+.|...+...+
T Consensus       129 ~f~~C~~CgkiYW~GsHw~~  148 (165)
T COG1656         129 EFYRCPKCGKIYWKGSHWRR  148 (165)
T ss_pred             ceeECCCCcccccCchHHHH
Confidence            35779999999987776544


No 208
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=45.29  E-value=18  Score=25.37  Aligned_cols=27  Identities=33%  Similarity=0.518  Sum_probs=23.0

Q ss_pred             CeeeCCCCcccccchhhHHHHHh-hhCC
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHME-THQN   76 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~-~h~~   76 (107)
                      +-+.|+.|.+.|.....+..|+. .|.+
T Consensus        56 rFWiCp~CskkF~d~~~~~~H~~~eH~~   83 (466)
T PF04780_consen   56 RFWICPRCSKKFSDAESCLSHMEQEHPA   83 (466)
T ss_pred             eEeeCCcccceeCCHHHHHHHHHHhhhh
Confidence            45789999999999999999987 4655


No 209
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=44.74  E-value=11  Score=23.73  Aligned_cols=18  Identities=17%  Similarity=0.573  Sum_probs=14.1

Q ss_pred             hhCCCcccCCCCCCcccC
Q psy11352         73 THQNAFYACSSCSHVSRS   90 (107)
Q Consensus        73 ~h~~k~~~C~~C~~~f~~   90 (107)
                      .+.|++.+|..||..|.-
T Consensus       176 LrEGkpqRCpECGqVFKL  193 (268)
T PTZ00043        176 CREGFLYRCGECDQIFML  193 (268)
T ss_pred             ecCCCCccCCCCCcEEEE
Confidence            345589999999988864


No 210
>PRK09710 lar restriction alleviation and modification protein; Reviewed
Probab=44.46  E-value=25  Score=17.51  Aligned_cols=11  Identities=27%  Similarity=0.507  Sum_probs=7.8

Q ss_pred             CeeeCCCCccc
Q psy11352         50 LFATCFVCGKQ   60 (107)
Q Consensus        50 ~~~~C~~C~~~   60 (107)
                      ..+.|..|+..
T Consensus        26 ~~v~C~~CgA~   36 (64)
T PRK09710         26 YRAKCNGCESR   36 (64)
T ss_pred             EEEEcCCCCcC
Confidence            34778888864


No 211
>KOG3362|consensus
Probab=44.36  E-value=8.4  Score=22.43  Aligned_cols=23  Identities=26%  Similarity=0.466  Sum_probs=16.1

Q ss_pred             cccCCCCCCcccChHHHHHHHHc
Q psy11352         78 FYACSSCSHVSRSRDALRKHVSY  100 (107)
Q Consensus        78 ~~~C~~C~~~f~~~~~l~~H~~~  100 (107)
                      +|.|.-||-.+-...-+..|..|
T Consensus       129 ~ysC~~CG~kyCsv~C~~~HneT  151 (156)
T KOG3362|consen  129 KYSCVNCGTKYCSVRCLKTHNET  151 (156)
T ss_pred             hhHHHhcCCceeechhhhhcccc
Confidence            66777888777777767666543


No 212
>PF01215 COX5B:  Cytochrome c oxidase subunit Vb This family consists of chains F and S ;  InterPro: IPR002124 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....
Probab=44.33  E-value=4.8  Score=23.21  Aligned_cols=18  Identities=22%  Similarity=0.492  Sum_probs=14.2

Q ss_pred             hhCCCcccCCCCCCcccC
Q psy11352         73 THQNAFYACSSCSHVSRS   90 (107)
Q Consensus        73 ~h~~k~~~C~~C~~~f~~   90 (107)
                      .+.++|.+|..||..|.-
T Consensus       107 l~~g~~~RCpeCG~~fkL  124 (136)
T PF01215_consen  107 LHKGKPQRCPECGQVFKL  124 (136)
T ss_dssp             EETTSEEEETTTEEEEEE
T ss_pred             EeCCCccCCCCCCeEEEE
Confidence            455689999999988864


No 213
>PF10058 DUF2296:  Predicted integral membrane metal-binding protein (DUF2296);  InterPro: IPR019273  This domain, found mainly in the eukaryotic lunapark proteins, has no known function []. 
Probab=43.90  E-value=35  Score=16.25  Aligned_cols=8  Identities=38%  Similarity=0.821  Sum_probs=4.0

Q ss_pred             eeeCCCCc
Q psy11352         51 FATCFVCG   58 (107)
Q Consensus        51 ~~~C~~C~   58 (107)
                      .|.|..|+
T Consensus        44 ~y~C~~Cg   51 (54)
T PF10058_consen   44 QYRCPYCG   51 (54)
T ss_pred             EEEcCCCC
Confidence            35555554


No 214
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=43.83  E-value=9.8  Score=16.58  Aligned_cols=10  Identities=40%  Similarity=0.916  Sum_probs=3.6

Q ss_pred             eeeCCCCccc
Q psy11352         51 FATCFVCGKQ   60 (107)
Q Consensus        51 ~~~C~~C~~~   60 (107)
                      .|.|+.||..
T Consensus         6 ~YkC~~CGni   15 (36)
T PF06397_consen    6 FYKCEHCGNI   15 (36)
T ss_dssp             EEE-TTT--E
T ss_pred             EEEccCCCCE
Confidence            4555555543


No 215
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=43.46  E-value=26  Score=20.15  Aligned_cols=12  Identities=25%  Similarity=0.523  Sum_probs=6.4

Q ss_pred             eeeCCCCccccc
Q psy11352         51 FATCFVCGKQLS   62 (107)
Q Consensus        51 ~~~C~~C~~~f~   62 (107)
                      .|.|..|+..+.
T Consensus       112 ~y~C~~C~~~~~  123 (146)
T smart00731      112 PYRCTGCGQRYL  123 (146)
T ss_pred             EEECCCCCCCCc
Confidence            455655655443


No 216
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=43.37  E-value=10  Score=17.70  Aligned_cols=12  Identities=25%  Similarity=0.528  Sum_probs=6.6

Q ss_pred             cCCCCCCcccCh
Q psy11352         80 ACSSCSHVSRSR   91 (107)
Q Consensus        80 ~C~~C~~~f~~~   91 (107)
                      .|+.|++.|+..
T Consensus        14 ICpvCqRPFsWR   25 (54)
T COG4338          14 ICPVCQRPFSWR   25 (54)
T ss_pred             hhhhhcCchHHH
Confidence            455666655543


No 217
>KOG2231|consensus
Probab=42.66  E-value=27  Score=25.77  Aligned_cols=21  Identities=24%  Similarity=0.553  Sum_probs=10.9

Q ss_pred             cCCCCCCcccChHHHHHHHHc
Q psy11352         80 ACSSCSHVSRSRDALRKHVSY  100 (107)
Q Consensus        80 ~C~~C~~~f~~~~~l~~H~~~  100 (107)
                      .|..|...|.....|.+|++.
T Consensus       184 ~C~~C~~~fld~~el~rH~~~  204 (669)
T KOG2231|consen  184 LCKFCHERFLDDDELYRHLRF  204 (669)
T ss_pred             cchhhhhhhccHHHHHHhhcc
Confidence            445555555555555555553


No 218
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=42.24  E-value=33  Score=21.16  Aligned_cols=11  Identities=27%  Similarity=0.818  Sum_probs=5.3

Q ss_pred             cccCCCCCCcc
Q psy11352         78 FYACSSCSHVS   88 (107)
Q Consensus        78 ~~~C~~C~~~f   88 (107)
                      .+.|..||..+
T Consensus        30 lvrC~eCG~V~   40 (201)
T COG1326          30 LVRCEECGTVH   40 (201)
T ss_pred             EEEccCCCcEe
Confidence            34555555443


No 219
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=41.47  E-value=33  Score=14.59  Aligned_cols=24  Identities=21%  Similarity=0.566  Sum_probs=13.9

Q ss_pred             CeeeCCCCcccccchhhHHHHHhhh
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHMETH   74 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~~h   74 (107)
                      ..+.|+.|++.... ..+..|+..-
T Consensus         3 ~~~~C~nC~R~v~a-~RfA~HLekC   26 (33)
T PF08209_consen    3 PYVECPNCGRPVAA-SRFAPHLEKC   26 (33)
T ss_dssp             -EEE-TTTSSEEEG-GGHHHHHHHH
T ss_pred             CeEECCCCcCCcch-hhhHHHHHHH
Confidence            45778888876543 4566676543


No 220
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=41.40  E-value=41  Score=18.29  Aligned_cols=12  Identities=33%  Similarity=0.443  Sum_probs=6.4

Q ss_pred             eeCCCCcccccc
Q psy11352         52 ATCFVCGKQLSN   63 (107)
Q Consensus        52 ~~C~~C~~~f~~   63 (107)
                      ..|..||..+..
T Consensus        43 ~~C~~CG~y~~~   54 (99)
T PRK14892         43 ITCGNCGLYTEF   54 (99)
T ss_pred             EECCCCCCccCE
Confidence            456666654433


No 221
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=41.30  E-value=28  Score=15.17  Aligned_cols=10  Identities=30%  Similarity=0.823  Sum_probs=2.9

Q ss_pred             ccCCCCCCcc
Q psy11352         79 YACSSCSHVS   88 (107)
Q Consensus        79 ~~C~~C~~~f   88 (107)
                      |-|+.|...|
T Consensus         4 yyCdyC~~~~   13 (38)
T PF06220_consen    4 YYCDYCKKYL   13 (38)
T ss_dssp             -B-TTT--B-
T ss_pred             eeccccccee
Confidence            4566666555


No 222
>KOG0782|consensus
Probab=41.11  E-value=8.9  Score=27.71  Aligned_cols=26  Identities=15%  Similarity=0.294  Sum_probs=12.4

Q ss_pred             hHHHHHhhhCC-CcccCCCCCCcccCh
Q psy11352         66 NLRVHMETHQN-AFYACSSCSHVSRSR   91 (107)
Q Consensus        66 ~l~~H~~~h~~-k~~~C~~C~~~f~~~   91 (107)
                      .|.+|--+|.. ..-+|..|||.|.++
T Consensus       240 ~fvrHHWVHrrRqeGkC~~CgKgFQQK  266 (1004)
T KOG0782|consen  240 GFVRHHWVHRRRQEGKCNTCGKGFQQK  266 (1004)
T ss_pred             cchHHhHhhHhhhccccchhhhhhhhh
Confidence            34444444443 334455555555443


No 223
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=40.75  E-value=32  Score=20.83  Aligned_cols=30  Identities=17%  Similarity=0.403  Sum_probs=17.9

Q ss_pred             CeeeCCCCcccccchhhHHHHHhhhCCCcccCCCCCCc
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHV   87 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~~h~~k~~~C~~C~~~   87 (107)
                      .-|.|+.|...|+.-..+.        .-|.|+.||-.
T Consensus       112 ~~y~C~~~~~r~sfdeA~~--------~~F~Cp~Cg~~  141 (176)
T COG1675         112 NYYVCPNCHVKYSFDEAME--------LGFTCPKCGED  141 (176)
T ss_pred             CceeCCCCCCcccHHHHHH--------hCCCCCCCCch
Confidence            5678877766554432221        24788888854


No 224
>COG4896 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=40.62  E-value=15  Score=18.07  Aligned_cols=12  Identities=33%  Similarity=0.863  Sum_probs=6.8

Q ss_pred             CcccCCCCCCcc
Q psy11352         77 AFYACSSCSHVS   88 (107)
Q Consensus        77 k~~~C~~C~~~f   88 (107)
                      ..|.|+.|....
T Consensus        30 rtymC~eC~~Rv   41 (68)
T COG4896          30 RTYMCPECEHRV   41 (68)
T ss_pred             eeEechhhHhhh
Confidence            346677665433


No 225
>PF10537 WAC_Acf1_DNA_bd:  ATP-utilising chromatin assembly and remodelling N-terminal;  InterPro: IPR013136 ACF (for ATP-utilising chromatin assembly and remodeling factor) is a chromatin-remodeling complex that catalyzes the ATP-dependent assembly of periodic nucleosome arrays. This reaction utilises the energy of ATP hydrolysis by ISWI, the smaller of the two subunits of ACF. Acf1, the large subunit of ACF, is essential for the full activity of the complex. The WAC (WSTF/Acf1/cbp146) domain is an ~110-residue module present at the N-termini of Acf1-related proteins in a variety of organisms. It is found in association with other domains such as the bromodomain, the PHD-type zinc finger, DDT or WAKS. The DNA-binding region of Acf1 includes the WAC domain, which is necessary for the efficient binding of ACF complex to DNA. It seems probable that the WAC domain will be involved in DNA binding in other related factors [, ].   Some proteins known to contain a WAC domain are the Drosophila melanogaster (Fruit fly) ATP-dependent chromatin assembly factor large subunit Acf1, human WSTF (Williams syndrome transcription factor), mouse cbp146, yeast imitation switch two complex protein 1 (ITC1 or YGL133w), and yeast protein YPL216w. 
Probab=40.58  E-value=59  Score=17.77  Aligned_cols=38  Identities=8%  Similarity=0.037  Sum_probs=25.7

Q ss_pred             CeeeCCCCcccccchhhHHHHHhhhCCCcccCCCCCCc
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHV   87 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~~h~~k~~~C~~C~~~   87 (107)
                      ..|.|+.-|..|.+-..+...+.....+-|.|...|+.
T Consensus         2 eVf~i~~T~EiF~dYe~Y~~R~~~y~~~vwtC~~TGk~   39 (102)
T PF10537_consen    2 EVFYIPFTGEIFRDYEEYLKRMILYNQRVWTCEITGKS   39 (102)
T ss_pred             ceEEeCCCCcccCCHHHHHHHHHHHhCCeeEEecCCCC
Confidence            34677777777777666666655555567788877764


No 226
>PLN02748 tRNA dimethylallyltransferase
Probab=40.45  E-value=21  Score=25.05  Aligned_cols=24  Identities=21%  Similarity=0.350  Sum_probs=20.0

Q ss_pred             CeeeCCCCcc-cccchhhHHHHHhh
Q psy11352         50 LFATCFVCGK-QLSNQYNLRVHMET   73 (107)
Q Consensus        50 ~~~~C~~C~~-~f~~~~~l~~H~~~   73 (107)
                      +.|.|+.|++ ++.-...+..|+..
T Consensus       417 ~~~~Ce~C~~~~~~G~~eW~~Hlks  441 (468)
T PLN02748        417 TQYVCEACGNKVLRGAHEWEQHKQG  441 (468)
T ss_pred             ccccccCCCCcccCCHHHHHHHhcc
Confidence            6788999997 78888888888753


No 227
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=40.37  E-value=6.5  Score=20.47  Aligned_cols=12  Identities=33%  Similarity=0.949  Sum_probs=5.3

Q ss_pred             eeCCCCcccccc
Q psy11352         52 ATCFVCGKQLSN   63 (107)
Q Consensus        52 ~~C~~C~~~f~~   63 (107)
                      ..|..|+..|..
T Consensus        47 ~~C~~Cg~~~~~   58 (81)
T PF05129_consen   47 LSCRVCGESFQT   58 (81)
T ss_dssp             EEESSS--EEEE
T ss_pred             EEecCCCCeEEE
Confidence            456666555543


No 228
>TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family. This model describes a family of predicted regulatory proteins with a conserved zinc finger/HTH architecture. The amino-terminal region contains a novel domain, featuring two CXXC motifs and occuring in a number of small bacterial proteins as well as in the present family. The carboxyl-terminal region consists of a helix-turn-helix domain, modeled by pfam01381. The predicted function is DNA binding and transcriptional regulation.
Probab=40.37  E-value=17  Score=20.07  Aligned_cols=21  Identities=19%  Similarity=0.283  Sum_probs=14.7

Q ss_pred             CeeeCCCCcccccchhhHHHH
Q psy11352         50 LFATCFVCGKQLSNQYNLRVH   70 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H   70 (107)
                      .-+.|+.||..+........-
T Consensus        30 ~~~~C~~CGe~~~~~e~~~~~   50 (127)
T TIGR03830        30 PGWYCPACGEELLDPEESKRN   50 (127)
T ss_pred             eeeECCCCCCEEEcHHHHHHH
Confidence            447899999888776655433


No 229
>TIGR00143 hypF [NiFe] hydrogenase maturation protein HypF. A previously described regulatory effect of HypF mutatation is attributable to loss of activity of a regulatory hydrogenase. A zinc finger-like region CXXCX(18)CXXCX(24)CXXCX(18)CXXC region further supported the regulatory hypothesis. However, more recent work (PUBMED:11375153) shows the direct effect is on the activity of expressed hydrogenases with nickel/iron centers, rather than on expression.
Probab=40.19  E-value=11  Score=27.90  Aligned_cols=59  Identities=19%  Similarity=0.291  Sum_probs=34.1

Q ss_pred             cCCCCCCCCCccCCCCCCCCCCCCCCCCCCCCCCCCCeeeCCCCcccccchhhHHHHHhhhCCCcccCCCCCCcc
Q psy11352         14 ISDHCLTSPLSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHVS   88 (107)
Q Consensus        14 ~C~~C~~~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~k~~~C~~C~~~f   88 (107)
                      .|..|   +-.|+-...+-.-    +..+.-    +.--.|+.|-+.+.+...-    +.|. .+..|..||-..
T Consensus        92 nCt~C---GPr~~i~~~lpyd----r~~t~m----~~f~~C~~C~~ey~~p~~r----r~h~-~~~~C~~Cgp~l  150 (711)
T TIGR00143        92 SCTHC---GPRFTIIEALPYD----RENTSM----ADFPLCPDCAKEYKDPLDR----RFHA-QPIACPRCGPQL  150 (711)
T ss_pred             cccCC---CCCeEEeecCCCC----CCCcCC----CCCcCCHHHHHHhcCCccc----cCCC-CCccCCCCCcEE
Confidence            68889   7777666554432    111111    0233589998887665432    2222 577899998643


No 230
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=39.92  E-value=12  Score=21.85  Aligned_cols=28  Identities=29%  Similarity=0.651  Sum_probs=15.9

Q ss_pred             CeeeCCCCcccccchhhHHHHHhhhCCCcccCCCCCC
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSH   86 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~~h~~k~~~C~~C~~   86 (107)
                      -.+.|..||.....         .+.+.--.|+.||.
T Consensus       111 G~l~C~~Cg~~~~~---------~~~~~l~~Cp~C~~  138 (146)
T PF07295_consen  111 GTLVCENCGHEVEL---------THPERLPPCPKCGH  138 (146)
T ss_pred             ceEecccCCCEEEe---------cCCCcCCCCCCCCC
Confidence            34888888865322         12232335888874


No 231
>PRK06260 threonine synthase; Validated
Probab=39.33  E-value=24  Score=24.00  Aligned_cols=15  Identities=33%  Similarity=0.565  Sum_probs=9.1

Q ss_pred             CeeeCCCCcccccch
Q psy11352         50 LFATCFVCGKQLSNQ   64 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~   64 (107)
                      ..+.|+.|+..+...
T Consensus        18 ~~~~Cp~cg~~l~~~   32 (397)
T PRK06260         18 IIYTCPECGGLLEVI   32 (397)
T ss_pred             ccccCCCCCCeEEEE
Confidence            346787787654444


No 232
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=39.16  E-value=18  Score=15.79  Aligned_cols=14  Identities=29%  Similarity=0.517  Sum_probs=8.4

Q ss_pred             eCCCCcccccchhh
Q psy11352         53 TCFVCGKQLSNQYN   66 (107)
Q Consensus        53 ~C~~C~~~f~~~~~   66 (107)
                      .|..|++.|-+.+.
T Consensus         4 ~CprC~kg~Hwa~~   17 (36)
T PF14787_consen    4 LCPRCGKGFHWASE   17 (36)
T ss_dssp             C-TTTSSSCS-TTT
T ss_pred             cCcccCCCcchhhh
Confidence            57778887776654


No 233
>PF11931 DUF3449:  Domain of unknown function (DUF3449);  InterPro: IPR024598 This presumed domain is functionally uncharacterised. It has two conserved sequence motifs: PIP and CEICG and contains a zinc-finger of the C2H2-type.; PDB: 4DGW_A.
Probab=39.06  E-value=10  Score=23.35  Aligned_cols=23  Identities=9%  Similarity=-0.187  Sum_probs=0.0

Q ss_pred             cccccCCCCCCCCCccCCCCCCCCC
Q psy11352         10 LHFLISDHCLTSPLSSSIPGSSKTK   34 (107)
Q Consensus        10 ~~~~~C~~C~~~~~~~~~~~~l~~h   34 (107)
                      .+.|.|++||  +.++.-+..+..|
T Consensus        99 ~~ey~CEICG--N~~Y~GrkaFekH  121 (196)
T PF11931_consen   99 GVEYKCEICG--NQSYKGRKAFEKH  121 (196)
T ss_dssp             -------------------------
T ss_pred             CCeeeeEeCC--CcceecHHHHHHh
Confidence            3469999994  4455555555555


No 234
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=38.94  E-value=4.1  Score=20.95  Aligned_cols=13  Identities=8%  Similarity=0.066  Sum_probs=8.0

Q ss_pred             cccCCCCCCCCCccCC
Q psy11352         12 FLISDHCLTSPLSSSI   27 (107)
Q Consensus        12 ~~~C~~C~~~~~~~~~   27 (107)
                      .|+|..|   +..|..
T Consensus        12 ~Y~c~~c---g~~~dv   24 (82)
T COG2331          12 SYECTEC---GNRFDV   24 (82)
T ss_pred             EEeeccc---chHHHH
Confidence            4677777   665543


No 235
>cd01121 Sms Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of branched DNA molecules.
Probab=38.40  E-value=18  Score=24.51  Aligned_cols=10  Identities=30%  Similarity=0.833  Sum_probs=7.2

Q ss_pred             eeeCCCCccc
Q psy11352         51 FATCFVCGKQ   60 (107)
Q Consensus        51 ~~~C~~C~~~   60 (107)
                      ...|+.|+..
T Consensus        14 ~g~cp~c~~w   23 (372)
T cd01121          14 LGKCPECGEW   23 (372)
T ss_pred             cEECcCCCCc
Confidence            3679998753


No 236
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated
Probab=38.19  E-value=27  Score=22.91  Aligned_cols=31  Identities=29%  Similarity=0.714  Sum_probs=18.1

Q ss_pred             eeeCCCCcccccchhhHHHHHhhhCCCcccCCCCCCccc
Q psy11352         51 FATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHVSR   89 (107)
Q Consensus        51 ~~~C~~C~~~f~~~~~l~~H~~~h~~k~~~C~~C~~~f~   89 (107)
                      ..+|+.|+.....+. |..       .-+.|+.|+..|.
T Consensus        27 ~~~c~~c~~~~~~~~-l~~-------~~~vc~~c~~h~r   57 (292)
T PRK05654         27 WTKCPSCGQVLYRKE-LEA-------NLNVCPKCGHHMR   57 (292)
T ss_pred             eeECCCccchhhHHH-HHh-------cCCCCCCCCCCee
Confidence            567888876543322 111       2457888887665


No 237
>PF15616 TerY-C:  TerY-C metal binding domain
Probab=38.08  E-value=20  Score=20.57  Aligned_cols=11  Identities=18%  Similarity=0.482  Sum_probs=7.1

Q ss_pred             CcccCCCCCCc
Q psy11352         77 AFYACSSCSHV   87 (107)
Q Consensus        77 k~~~C~~C~~~   87 (107)
                      ....|+.|+..
T Consensus       104 ~~~~CPwCg~~  114 (131)
T PF15616_consen  104 GEVTCPWCGNE  114 (131)
T ss_pred             CCEECCCCCCe
Confidence            45667777754


No 238
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=37.86  E-value=21  Score=20.11  Aligned_cols=32  Identities=22%  Similarity=0.405  Sum_probs=16.3

Q ss_pred             CeeeCCCCcccccchhhHHHHHhhhCCCcccCCCCCC
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSH   86 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~~h~~k~~~C~~C~~   86 (107)
                      -.+.| .||..|.....-..|    ..-.+.|+.||.
T Consensus        69 ~~~~C-~Cg~~~~~~~~~~~~----~~~~~~CP~Cgs  100 (124)
T PRK00762         69 VEIEC-ECGYEGVVDEDEIDH----YAAVIECPVCGN  100 (124)
T ss_pred             eeEEe-eCcCcccccccchhc----cccCCcCcCCCC
Confidence            34678 888776543211111    111346788873


No 239
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=37.71  E-value=24  Score=15.75  Aligned_cols=12  Identities=25%  Similarity=0.506  Sum_probs=8.9

Q ss_pred             CeeeCCCCcccc
Q psy11352         50 LFATCFVCGKQL   61 (107)
Q Consensus        50 ~~~~C~~C~~~f   61 (107)
                      .+-.|+.|+..|
T Consensus        28 ~~~~CpYCg~~y   39 (40)
T PF10276_consen   28 GPVVCPYCGTRY   39 (40)
T ss_dssp             CEEEETTTTEEE
T ss_pred             CeEECCCCCCEE
Confidence            457788888766


No 240
>TIGR00627 tfb4 transcription factor tfb4. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=37.69  E-value=36  Score=22.23  Aligned_cols=26  Identities=23%  Similarity=0.402  Sum_probs=16.4

Q ss_pred             CeeeCCCCcccccchhhHHHHHhhhCCCcccCCCCCCcc
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHVS   88 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~~h~~k~~~C~~C~~~f   88 (107)
                      .-|.|+.|.-.|-.             .|-.|+.||-.|
T Consensus       254 ~GyvCs~Clsi~C~-------------~p~~C~~Cgt~f  279 (279)
T TIGR00627       254 IGFVCSVCLSVLCQ-------------YTPICKTCKTAF  279 (279)
T ss_pred             ceEECCCccCCcCC-------------CCCCCCCCCCCC
Confidence            34788887655542             244788887655


No 241
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=37.66  E-value=22  Score=24.12  Aligned_cols=22  Identities=18%  Similarity=0.403  Sum_probs=16.3

Q ss_pred             CeeeCCCCc-ccccchhhHHHHH
Q psy11352         50 LFATCFVCG-KQLSNQYNLRVHM   71 (107)
Q Consensus        50 ~~~~C~~C~-~~f~~~~~l~~H~   71 (107)
                      +.|.|++|| +++.-...+.+|-
T Consensus       373 ~ef~CEICgNyvy~GR~~FdrHF  395 (470)
T COG5188         373 IEFECEICGNYVYYGRDRFDRHF  395 (470)
T ss_pred             cceeeeecccccccchHHHHhhh
Confidence            678999998 6666666676664


No 242
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=37.58  E-value=29  Score=14.92  Aligned_cols=13  Identities=15%  Similarity=-0.005  Sum_probs=5.1

Q ss_pred             cCCCCCCCCCccCCCC
Q psy11352         14 ISDHCLTSPLSSSIPG   29 (107)
Q Consensus        14 ~C~~C~~~~~~~~~~~   29 (107)
                      .|.+|   ++.|..+.
T Consensus         5 ~C~eC---~~~f~dSy   17 (34)
T PF01286_consen    5 KCDEC---GKPFMDSY   17 (34)
T ss_dssp             E-TTT-----EES-SS
T ss_pred             hHhHh---CCHHHHHH
Confidence            46666   66665544


No 243
>KOG3214|consensus
Probab=37.29  E-value=19  Score=19.63  Aligned_cols=13  Identities=23%  Similarity=0.772  Sum_probs=8.0

Q ss_pred             eeCCCCcccccch
Q psy11352         52 ATCFVCGKQLSNQ   64 (107)
Q Consensus        52 ~~C~~C~~~f~~~   64 (107)
                      ..|.+|+..|...
T Consensus        48 ~sC~iC~esFqt~   60 (109)
T KOG3214|consen   48 ASCRICEESFQTT   60 (109)
T ss_pred             eeeeehhhhhccc
Confidence            4567777666553


No 244
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=37.10  E-value=31  Score=13.89  Aligned_cols=9  Identities=33%  Similarity=0.729  Sum_probs=3.3

Q ss_pred             eeeCCCCcc
Q psy11352         51 FATCFVCGK   59 (107)
Q Consensus        51 ~~~C~~C~~   59 (107)
                      .|.|.+|+.
T Consensus        15 ~Y~C~~Cdf   23 (30)
T PF07649_consen   15 FYRCSECDF   23 (30)
T ss_dssp             EEE-TTT--
T ss_pred             eEECccCCC
Confidence            455555543


No 245
>PF05180 zf-DNL:  DNL zinc finger;  InterPro: IPR007853 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The DNL-type zinc finger is found in Tim15, a zinc finger protein essential for protein import into mitochondria. Mitochondrial functions rely on the correct transport of resident proteins synthesized in the cytosol to mitochondria. Protein import into mitochondria is mediated by membrane protein complexes, protein translocators, in the outer and inner mitochondrial membranes, in cooperation with their assistant proteins in the cytosol, intermembrane space and matrix. Proteins destined to the mitochondrial matrix cross the outer membrane with the aid of the outer membrane translocator, the tOM40 complex, and then the inner membrane with the aid of the inner membrane translocator, the TIM23 complex, and mitochondrial motor and chaperone (MMC) proteins including mitochondrial heat- shock protein 70 (mtHsp70), and translocase in the inner mitochondrial membrane (Tim)15. Tim15 is also known as zinc finger motif (Zim)17 or mtHsp70 escort protein (Hep)1. Tim15 contains a zinc-finger motif (CXXC and CXXC) of ~100 residues, which has been named DNL after a short C-terminal motif of D(N/H)L [, , ]. The DNL-type zinc finger is an L-shaped molecule. The two CXXC motifs are located at the end of the L, and are sandwiched by two- stranded antiparallel beta-sheets. Two short alpha-helices constitute another leg of the L. The outer (convex) face of the L has a large acidic groove, which is lined with five acidic residues, whereas the inner (concave) face of the L has two positively charged residues, next to the CXXC motifs []. This entry represents the DNL-type zinc finger.; GO: 0008270 zinc ion binding; PDB: 2E2Z_A.
Probab=36.30  E-value=4.1  Score=20.39  Aligned_cols=34  Identities=21%  Similarity=0.463  Sum_probs=18.6

Q ss_pred             eeeCCCCcccccchhhHHHHHhhhCC-CcccCCCCCCc
Q psy11352         51 FATCFVCGKQLSNQYNLRVHMETHQN-AFYACSSCSHV   87 (107)
Q Consensus        51 ~~~C~~C~~~f~~~~~l~~H~~~h~~-k~~~C~~C~~~   87 (107)
                      .|+|..|+..-.  ..+.. ...+.| --.+|+.|...
T Consensus         4 ~FTC~~C~~Rs~--~~~sk-~aY~~GvViv~C~gC~~~   38 (66)
T PF05180_consen    4 TFTCNKCGTRSA--KMFSK-QAYHKGVVIVQCPGCKNR   38 (66)
T ss_dssp             EEEETTTTEEEE--EEEEH-HHHHTSEEEEE-TTS--E
T ss_pred             EEEcCCCCCccc--eeeCH-HHHhCCeEEEECCCCcce
Confidence            588988874322  22222 245667 67788888643


No 246
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=36.30  E-value=17  Score=15.72  Aligned_cols=30  Identities=20%  Similarity=0.444  Sum_probs=18.9

Q ss_pred             eeCCCCcccccchhhHHHHHhhhCC-CcccCCCCCCccc
Q psy11352         52 ATCFVCGKQLSNQYNLRVHMETHQN-AFYACSSCSHVSR   89 (107)
Q Consensus        52 ~~C~~C~~~f~~~~~l~~H~~~h~~-k~~~C~~C~~~f~   89 (107)
                      ..|+.||..|.....        -. .+-.|..||-.+.
T Consensus         2 r~C~~Cg~~Yh~~~~--------pP~~~~~Cd~cg~~L~   32 (36)
T PF05191_consen    2 RICPKCGRIYHIEFN--------PPKVEGVCDNCGGELV   32 (36)
T ss_dssp             EEETTTTEEEETTTB----------SSTTBCTTTTEBEB
T ss_pred             cCcCCCCCccccccC--------CCCCCCccCCCCCeeE
Confidence            578899988764322        11 3567888886544


No 247
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=36.07  E-value=21  Score=23.12  Aligned_cols=14  Identities=21%  Similarity=0.769  Sum_probs=8.9

Q ss_pred             CcccCCCCCCcccC
Q psy11352         77 AFYACSSCSHVSRS   90 (107)
Q Consensus        77 k~~~C~~C~~~f~~   90 (107)
                      +-|.|+.||..+-.
T Consensus       321 r~~~C~~cg~~~~r  334 (364)
T COG0675         321 RLFKCPRCGFVHDR  334 (364)
T ss_pred             eeEECCCCCCeehh
Confidence            56777777765443


No 248
>TIGR00310 ZPR1_znf ZPR1 zinc finger domain.
Probab=35.36  E-value=9.3  Score=23.37  Aligned_cols=12  Identities=25%  Similarity=0.531  Sum_probs=7.7

Q ss_pred             eeeCCCCccccc
Q psy11352         51 FATCFVCGKQLS   62 (107)
Q Consensus        51 ~~~C~~C~~~f~   62 (107)
                      .|.|+.||....
T Consensus        30 sf~C~~CGyr~~   41 (192)
T TIGR00310        30 STICEHCGYRSN   41 (192)
T ss_pred             EEECCCCCCccc
Confidence            467777776543


No 249
>cd02341 ZZ_ZZZ3 Zinc finger, ZZ type. Zinc finger present in ZZZ3 (ZZ finger containing 3) and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=34.59  E-value=55  Score=15.15  Aligned_cols=8  Identities=25%  Similarity=0.530  Sum_probs=4.2

Q ss_pred             eeeCCCCc
Q psy11352         51 FATCFVCG   58 (107)
Q Consensus        51 ~~~C~~C~   58 (107)
                      .|.|..|.
T Consensus        15 R~~C~~C~   22 (48)
T cd02341          15 RYHCSECD   22 (48)
T ss_pred             eEECCCCC
Confidence            35555554


No 250
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=33.49  E-value=60  Score=21.41  Aligned_cols=23  Identities=22%  Similarity=0.356  Sum_probs=14.7

Q ss_pred             CeeeCCCCcccccchhhHHHHHh
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHME   72 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~   72 (107)
                      ..|.|+.|-+-|.....|.+|+.
T Consensus        47 ~lyiCe~Clky~~~~~~l~~H~~   69 (290)
T PLN03238         47 KLYICEYCLKYMRKKKSLLRHLA   69 (290)
T ss_pred             eEEEcCCCcchhCCHHHHHHHHH
Confidence            45666666666666666666655


No 251
>KOG3352|consensus
Probab=33.42  E-value=19  Score=21.14  Aligned_cols=18  Identities=17%  Similarity=0.431  Sum_probs=13.9

Q ss_pred             hhCCCcccCCCCCCcccC
Q psy11352         73 THQNAFYACSSCSHVSRS   90 (107)
Q Consensus        73 ~h~~k~~~C~~C~~~f~~   90 (107)
                      .+-++.++|.+||..|.-
T Consensus       128 l~Kge~~rc~eCG~~fkL  145 (153)
T KOG3352|consen  128 LEKGETQRCPECGHYFKL  145 (153)
T ss_pred             EEcCCcccCCcccceEEe
Confidence            455678889999988753


No 252
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=33.21  E-value=45  Score=15.68  Aligned_cols=31  Identities=26%  Similarity=0.518  Sum_probs=18.2

Q ss_pred             eCCCCcccccchhhHHHHHhhhCC-CcccCCCCCCc
Q psy11352         53 TCFVCGKQLSNQYNLRVHMETHQN-AFYACSSCSHV   87 (107)
Q Consensus        53 ~C~~C~~~f~~~~~l~~H~~~h~~-k~~~C~~C~~~   87 (107)
                      .|..|+-..+....    ..+..+ ....|+.||+.
T Consensus        24 ~C~gC~~~l~~~~~----~~i~~~~~i~~Cp~CgRi   55 (56)
T PF02591_consen   24 TCSGCHMELPPQEL----NEIRKGDEIVFCPNCGRI   55 (56)
T ss_pred             ccCCCCEEcCHHHH----HHHHcCCCeEECcCCCcc
Confidence            67777766544322    223344 56788988863


No 253
>PRK00420 hypothetical protein; Validated
Probab=32.96  E-value=33  Score=19.13  Aligned_cols=9  Identities=44%  Similarity=0.674  Sum_probs=4.4

Q ss_pred             eeCCCCccc
Q psy11352         52 ATCFVCGKQ   60 (107)
Q Consensus        52 ~~C~~C~~~   60 (107)
                      ..|+.||..
T Consensus        41 ~~Cp~Cg~~   49 (112)
T PRK00420         41 VVCPVHGKV   49 (112)
T ss_pred             eECCCCCCe
Confidence            445555543


No 254
>PRK08222 hydrogenase 4 subunit H; Validated
Probab=32.60  E-value=38  Score=20.39  Aligned_cols=19  Identities=16%  Similarity=0.417  Sum_probs=14.9

Q ss_pred             CcccCCCCCCcccChHHHH
Q psy11352         77 AFYACSSCSHVSRSRDALR   95 (107)
Q Consensus        77 k~~~C~~C~~~f~~~~~l~   95 (107)
                      ....|..||+.|.....+.
T Consensus       113 ~~~~C~~Cg~~f~~~k~i~  131 (181)
T PRK08222        113 HLQRCSRCERPFAPQKTVA  131 (181)
T ss_pred             ccCcCcccCCccCcHhHHH
Confidence            5788999999998665443


No 255
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=32.23  E-value=35  Score=13.94  Aligned_cols=9  Identities=44%  Similarity=0.958  Sum_probs=4.6

Q ss_pred             eeCCCCccc
Q psy11352         52 ATCFVCGKQ   60 (107)
Q Consensus        52 ~~C~~C~~~   60 (107)
                      |.|..|+..
T Consensus        28 f~C~~C~~~   36 (39)
T smart00132       28 FKCSKCGKP   36 (39)
T ss_pred             CCCcccCCc
Confidence            455555544


No 256
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=32.02  E-value=20  Score=20.47  Aligned_cols=16  Identities=19%  Similarity=0.372  Sum_probs=10.5

Q ss_pred             CeeeCCCCcccccchh
Q psy11352         50 LFATCFVCGKQLSNQY   65 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~   65 (107)
                      .|--|..||..|++..
T Consensus        67 ~psfchncgs~fpwte   82 (160)
T COG4306          67 PPSFCHNCGSRFPWTE   82 (160)
T ss_pred             CcchhhcCCCCCCcHH
Confidence            4455777777777653


No 257
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=31.84  E-value=70  Score=21.46  Aligned_cols=23  Identities=22%  Similarity=0.311  Sum_probs=14.4

Q ss_pred             CcccCCCCCCcccChHHHHHHHH
Q psy11352         77 AFYACSSCSHVSRSRDALRKHVS   99 (107)
Q Consensus        77 k~~~C~~C~~~f~~~~~l~~H~~   99 (107)
                      -.|+|+.|...|...-+.-.|..
T Consensus       387 ~rY~Ce~CK~~FC~dCdvfiHe~  409 (421)
T COG5151         387 GRYQCELCKSTFCSDCDVFIHET  409 (421)
T ss_pred             cceechhhhhhhhhhhHHHHHHH
Confidence            46777777666666655555554


No 258
>PRK07591 threonine synthase; Validated
Probab=31.12  E-value=37  Score=23.36  Aligned_cols=9  Identities=22%  Similarity=0.368  Sum_probs=4.5

Q ss_pred             eeCCCCccc
Q psy11352         52 ATCFVCGKQ   60 (107)
Q Consensus        52 ~~C~~C~~~   60 (107)
                      +.|+.|+-.
T Consensus        34 ~~C~~cg~~   42 (421)
T PRK07591         34 HVCEECFGP   42 (421)
T ss_pred             ccCCCCCCe
Confidence            455555543


No 259
>PF10071 DUF2310:  Zn-ribbon-containing, possibly nucleic-acid-binding protein (DUF2310);  InterPro: IPR016908 This group represents uncharacterised conserved proteins.
Probab=31.02  E-value=26  Score=22.59  Aligned_cols=32  Identities=25%  Similarity=0.474  Sum_probs=21.7

Q ss_pred             CeeeCCCCcccccchhhHHHHHhhhCCCcccCCCCCCc
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHV   87 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~~h~~k~~~C~~C~~~   87 (107)
                      ..-.|+.||..+.....|      |.--.|+|+.|--.
T Consensus       219 ~~r~CP~Cg~~W~L~~pl------h~iFdFKCD~CRLV  250 (258)
T PF10071_consen  219 QARKCPSCGGDWRLKEPL------HDIFDFKCDPCRLV  250 (258)
T ss_pred             hCCCCCCCCCccccCCch------hhceeccCCcceee
Confidence            445799999887766655      12157889988543


No 260
>TIGR00319 desulf_FeS4 desulfoferrodoxin FeS4 iron-binding domain. Neelaredoxin, a monomeric blue non-heme iron protein, lacks this domain.
Probab=30.92  E-value=35  Score=14.22  Aligned_cols=12  Identities=33%  Similarity=0.728  Sum_probs=8.5

Q ss_pred             CeeeCCCCcccc
Q psy11352         50 LFATCFVCGKQL   61 (107)
Q Consensus        50 ~~~~C~~C~~~f   61 (107)
                      +.|+|+.||...
T Consensus         6 ~~ykC~~Cgniv   17 (34)
T TIGR00319         6 QVYKCEVCGNIV   17 (34)
T ss_pred             cEEEcCCCCcEE
Confidence            467888887654


No 261
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=30.77  E-value=48  Score=15.00  Aligned_cols=16  Identities=25%  Similarity=0.623  Sum_probs=11.2

Q ss_pred             eCCCCcccccchhhHH
Q psy11352         53 TCFVCGKQLSNQYNLR   68 (107)
Q Consensus        53 ~C~~C~~~f~~~~~l~   68 (107)
                      .|..|++.|.......
T Consensus        10 ~C~~C~rpf~WRKKW~   25 (42)
T PF10013_consen   10 ICPVCGRPFTWRKKWA   25 (42)
T ss_pred             cCcccCCcchHHHHHH
Confidence            5888888887765443


No 262
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=30.68  E-value=21  Score=17.60  Aligned_cols=37  Identities=16%  Similarity=0.134  Sum_probs=19.8

Q ss_pred             CeeeCCCCcccccchhhHHHHHhhhCCCcccCCCCCCccc
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHVSR   89 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~~h~~k~~~C~~C~~~f~   89 (107)
                      .++.|+.-+-.|.....+.   .+-...-..|+.|+..|.
T Consensus        23 ~~l~C~g~~~p~~HPrV~L---~mg~~gev~CPYC~t~y~   59 (62)
T COG4391          23 LPLMCPGPEPPNDHPRVFL---DMGDEGEVVCPYCSTRYR   59 (62)
T ss_pred             eeEEcCCCCCCCCCCEEEE---EcCCCCcEecCccccEEE
Confidence            6778876554443332211   110114567888888775


No 263
>PF14599 zinc_ribbon_6:  Zinc-ribbon; PDB: 2K2D_A.
Probab=30.64  E-value=17  Score=17.85  Aligned_cols=14  Identities=14%  Similarity=0.411  Sum_probs=7.2

Q ss_pred             eeCCCCcccccchh
Q psy11352         52 ATCFVCGKQLSNQY   65 (107)
Q Consensus        52 ~~C~~C~~~f~~~~   65 (107)
                      -.|+.|+.......
T Consensus        31 IlCNDC~~~s~v~f   44 (61)
T PF14599_consen   31 ILCNDCNAKSEVPF   44 (61)
T ss_dssp             EEESSS--EEEEE-
T ss_pred             EECCCCCCccceee
Confidence            45899988654433


No 264
>cd00974 DSRD Desulforedoxin (DSRD) domain; a small non-heme iron domain present in the desulforedoxin (rubredoxin oxidoreductase) and desulfoferrodoxin proteins of some archeael and bacterial methanogens and sulfate/sulfur reducers. Desulforedoxin is a small, single-domain homodimeric protein; each subunit contains an iron atom bound to four cysteinyl sulfur atoms, Fe(S-Cys)4, in a distorted tetrahedral coordination. Its metal center is similar to that found in rubredoxin type proteins. Desulforedoxin is regarded as a potential redox partner for rubredoxin. Desulfoferrodoxin forms a homodimeric protein, with each protomer comprised of two domains, the N-terminal DSRD domain and C-terminal superoxide reductase-like (SORL) domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].
Probab=30.31  E-value=37  Score=14.16  Aligned_cols=12  Identities=25%  Similarity=0.686  Sum_probs=8.1

Q ss_pred             CeeeCCCCcccc
Q psy11352         50 LFATCFVCGKQL   61 (107)
Q Consensus        50 ~~~~C~~C~~~f   61 (107)
                      +.|+|+.||...
T Consensus         3 ~~ykC~~CGniv   14 (34)
T cd00974           3 EVYKCEICGNIV   14 (34)
T ss_pred             cEEEcCCCCcEE
Confidence            457777777654


No 265
>KOG1994|consensus
Probab=30.27  E-value=24  Score=22.36  Aligned_cols=21  Identities=24%  Similarity=0.523  Sum_probs=18.5

Q ss_pred             CcccCCCCCCcccChHHHHHH
Q psy11352         77 AFYACSSCSHVSRSRDALRKH   97 (107)
Q Consensus        77 k~~~C~~C~~~f~~~~~l~~H   97 (107)
                      .-|.|-.||-.|.....|..|
T Consensus       238 eh~YC~fCG~~y~~~edl~eh  258 (268)
T KOG1994|consen  238 EHYYCFFCGIKYKDEEDLYEH  258 (268)
T ss_pred             cceEEEEeccccCCHHHHHHh
Confidence            578899999999999998877


No 266
>PRK06450 threonine synthase; Validated
Probab=30.12  E-value=38  Score=22.62  Aligned_cols=10  Identities=30%  Similarity=0.810  Sum_probs=5.5

Q ss_pred             eeCCCCcccc
Q psy11352         52 ATCFVCGKQL   61 (107)
Q Consensus        52 ~~C~~C~~~f   61 (107)
                      +.|+.|+..+
T Consensus        19 ~~C~~cg~~l   28 (338)
T PRK06450         19 IRCKKCGGPF   28 (338)
T ss_pred             ccCCcCCCEe
Confidence            5666665433


No 267
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=30.08  E-value=45  Score=18.65  Aligned_cols=31  Identities=26%  Similarity=0.416  Sum_probs=17.7

Q ss_pred             CeeeCCCCcccccchhhHHHHHhhhCCCcccCCCCCCcccCh
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHVSRSR   91 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~~h~~k~~~C~~C~~~f~~~   91 (107)
                      ...+|+.|++....           .|+...|..|+....-.
T Consensus        68 v~V~CP~C~K~TKm-----------LGr~D~CM~C~~pLTLd   98 (114)
T PF11023_consen   68 VQVECPNCGKQTKM-----------LGRVDACMHCKEPLTLD   98 (114)
T ss_pred             eeeECCCCCChHhh-----------hchhhccCcCCCcCccC
Confidence            45678888765321           23445677776554433


No 268
>KOG4118|consensus
Probab=29.69  E-value=27  Score=17.43  Aligned_cols=28  Identities=18%  Similarity=0.472  Sum_probs=16.9

Q ss_pred             cccCCCCCCcccChHHHHHHHHccCCCC
Q psy11352         78 FYACSSCSHVSRSRDALRKHVSYRHPHI  105 (107)
Q Consensus        78 ~~~C~~C~~~f~~~~~l~~H~~~~H~~e  105 (107)
                      .|.|.+|-..-.....+..|..+.|+.+
T Consensus        38 ~~kCtVC~~~mpdpktfkqhfe~kHpk~   65 (74)
T KOG4118|consen   38 HHKCTVCMVQMPDPKTFKQHFENKHPKE   65 (74)
T ss_pred             HhhhHhhHhhCCCCchHHHHHhhcCCCC
Confidence            3667777655555555666666656543


No 269
>PRK01343 zinc-binding protein; Provisional
Probab=29.34  E-value=37  Score=16.48  Aligned_cols=10  Identities=30%  Similarity=0.783  Sum_probs=5.2

Q ss_pred             ccCCCCCCcc
Q psy11352         79 YACSSCSHVS   88 (107)
Q Consensus        79 ~~C~~C~~~f   88 (107)
                      ..|+.|++.|
T Consensus        10 ~~CP~C~k~~   19 (57)
T PRK01343         10 RPCPECGKPS   19 (57)
T ss_pred             CcCCCCCCcC
Confidence            3455555544


No 270
>KOG1280|consensus
Probab=29.33  E-value=67  Score=21.83  Aligned_cols=37  Identities=24%  Similarity=0.415  Sum_probs=25.8

Q ss_pred             CCeeeCCCCcccccchhhHHHHHhh-hCCCccc--CCCCC
Q psy11352         49 KLFATCFVCGKQLSNQYNLRVHMET-HQNAFYA--CSSCS   85 (107)
Q Consensus        49 ~~~~~C~~C~~~f~~~~~l~~H~~~-h~~k~~~--C~~C~   85 (107)
                      ...|+|+.|+..-.+...|..|+.. |-..++.  |++|+
T Consensus        77 ~qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~  116 (381)
T KOG1280|consen   77 PQSFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCA  116 (381)
T ss_pred             cccccCCcccccccchhHHHHHhhhcCcccCcceeeeccc
Confidence            4578899999887788888888764 4444443  45664


No 271
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=29.19  E-value=29  Score=16.46  Aligned_cols=9  Identities=22%  Similarity=0.685  Sum_probs=5.9

Q ss_pred             cCCCCCCcc
Q psy11352         80 ACSSCSHVS   88 (107)
Q Consensus        80 ~C~~C~~~f   88 (107)
                      .|+.||..+
T Consensus         2 ~CPyCge~~   10 (52)
T PF14255_consen    2 QCPYCGEPI   10 (52)
T ss_pred             CCCCCCCee
Confidence            577777654


No 272
>PF11789 zf-Nse:  Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C.
Probab=29.15  E-value=61  Score=15.54  Aligned_cols=31  Identities=16%  Similarity=0.229  Sum_probs=14.6

Q ss_pred             CeeeCCCCcccccchhhHHHHHhhhCCCcccCCC
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHMETHQNAFYACSS   83 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~~h~~k~~~C~~   83 (107)
                      .|.....|+-.|.....+ ..+  .......|+.
T Consensus        23 ~PV~s~~C~H~fek~aI~-~~i--~~~~~~~CPv   53 (57)
T PF11789_consen   23 DPVKSKKCGHTFEKEAIL-QYI--QRNGSKRCPV   53 (57)
T ss_dssp             SEEEESSS--EEEHHHHH-HHC--TTTS-EE-SC
T ss_pred             CCcCcCCCCCeecHHHHH-HHH--HhcCCCCCCC
Confidence            566667777777665433 232  1125667776


No 273
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=29.15  E-value=26  Score=15.37  Aligned_cols=13  Identities=23%  Similarity=0.611  Sum_probs=9.3

Q ss_pred             eeeCCCCcccccc
Q psy11352         51 FATCFVCGKQLSN   63 (107)
Q Consensus        51 ~~~C~~C~~~f~~   63 (107)
                      -+.|+.||..+..
T Consensus        32 ~~~C~~CGE~~~~   44 (46)
T TIGR03831        32 ALVCPQCGEEYLD   44 (46)
T ss_pred             ccccccCCCEeeC
Confidence            3678999877654


No 274
>COG2995 PqiA Uncharacterized paraquat-inducible protein A [Function unknown]
Probab=28.94  E-value=84  Score=21.82  Aligned_cols=34  Identities=26%  Similarity=0.556  Sum_probs=19.8

Q ss_pred             cccccCCCCCCCCCccCCCCCCCCCCCCCCCCCCCCCCCCCeeeCCCCccccc
Q psy11352         10 LHFLISDHCLTSPLSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQLS   62 (107)
Q Consensus        10 ~~~~~C~~C~~~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~   62 (107)
                      .+...|++|   +..+.-+ .+..+               ..-.|+.||-...
T Consensus        16 ~~~~~C~eC---d~~~~~P-~l~~~---------------q~A~CPRC~~~l~   49 (418)
T COG2995          16 GHLILCPEC---DMLVSLP-RLDSG---------------QSAYCPRCGHTLT   49 (418)
T ss_pred             cceecCCCC---Cceeccc-cCCCC---------------CcccCCCCCCccc
Confidence            445678888   7766555 33333               3346777775443


No 275
>PRK14138 NAD-dependent deacetylase; Provisional
Probab=28.34  E-value=1e+02  Score=19.61  Aligned_cols=34  Identities=21%  Similarity=0.436  Sum_probs=20.3

Q ss_pred             CeeeCCCCcccccchhhHHHHHhhhCCCcccCCCCCC
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSH   86 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~~h~~k~~~C~~C~~   86 (107)
                      ....|..|++.|.....+.   .......-.|+.|+-
T Consensus       118 ~~~~C~~C~~~~~~~~~~~---~~~~~~~p~Cp~Cgg  151 (244)
T PRK14138        118 EEYYCVRCGKRYTVEDVIE---KLEKSDVPRCDDCSG  151 (244)
T ss_pred             CeeEECCCCCcccHHHHHH---HHhcCCCCCCCCCCC
Confidence            4567999998877644332   111223346888873


No 276
>KOG4727|consensus
Probab=28.25  E-value=49  Score=20.03  Aligned_cols=23  Identities=22%  Similarity=0.258  Sum_probs=19.4

Q ss_pred             CeeeCCCCcccccchhhHHHHHh
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHME   72 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~   72 (107)
                      --|-|++|+-++..+-++..|+.
T Consensus        74 ~GyyCdVCdcvvKDSinflDHiN   96 (193)
T KOG4727|consen   74 GGYYCDVCDCVVKDSINFLDHIN   96 (193)
T ss_pred             CceeeeecceeehhhHHHHHHhc
Confidence            45889999999999988888864


No 277
>PF14690 zf-ISL3:  zinc-finger of transposase IS204/IS1001/IS1096/IS1165
Probab=28.24  E-value=33  Score=15.24  Aligned_cols=10  Identities=20%  Similarity=0.517  Sum_probs=7.4

Q ss_pred             CcccCCCCCC
Q psy11352         77 AFYACSSCSH   86 (107)
Q Consensus        77 k~~~C~~C~~   86 (107)
                      +|..|+.||.
T Consensus         1 ~~~~Cp~Cg~   10 (47)
T PF14690_consen    1 KPPRCPHCGS   10 (47)
T ss_pred             CCccCCCcCC
Confidence            3667899984


No 278
>PF05876 Terminase_GpA:  Phage terminase large subunit (GpA);  InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This entry consists of several phage terminase large subunit proteins as well as related sequences from several bacterial species. The DNA packaging enzyme of bacteriophage lambda, terminase, is a heteromultimer composed of a small subunit, gpNu1, and a large subunit, gpA, products of the Nu1 and A genes, respectively. Terminase is involved in the site-specific binding and cutting of the DNA in the initial stages of packaging. It is now known that gpA is actively involved in late stages of packaging, including DNA translocation, and that this enzyme contains separate functional domains for its early and late packaging activities [].
Probab=28.15  E-value=80  Score=22.82  Aligned_cols=14  Identities=21%  Similarity=0.477  Sum_probs=9.2

Q ss_pred             CeeeCCCCcccccc
Q psy11352         50 LFATCFVCGKQLSN   63 (107)
Q Consensus        50 ~~~~C~~C~~~f~~   63 (107)
                      -.|.|+.||.....
T Consensus       228 a~y~C~~Cg~~i~e  241 (557)
T PF05876_consen  228 ARYVCPHCGCEIEE  241 (557)
T ss_pred             eEEECCCCcCCCCH
Confidence            45778777766544


No 279
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=27.92  E-value=16  Score=23.64  Aligned_cols=20  Identities=15%  Similarity=0.348  Sum_probs=13.7

Q ss_pred             CcccCCCCCCcccChHHHHH
Q psy11352         77 AFYACSSCSHVSRSRDALRK   96 (107)
Q Consensus        77 k~~~C~~C~~~f~~~~~l~~   96 (107)
                      +++.|+.||.....-..|..
T Consensus       208 k~~PCPKCg~et~eTkdLSm  227 (314)
T PF06524_consen  208 KPIPCPKCGYETQETKDLSM  227 (314)
T ss_pred             CCCCCCCCCCccccccccee
Confidence            68899999876555444443


No 280
>PF14447 Prok-RING_4:  Prokaryotic RING finger family 4
Probab=27.88  E-value=32  Score=16.58  Aligned_cols=11  Identities=18%  Similarity=0.431  Sum_probs=6.8

Q ss_pred             cCCCCCCcccC
Q psy11352         80 ACSSCSHVSRS   90 (107)
Q Consensus        80 ~C~~C~~~f~~   90 (107)
                      .|+.|++.|..
T Consensus        41 gCPfC~~~~~~   51 (55)
T PF14447_consen   41 GCPFCGTPFEF   51 (55)
T ss_pred             CCCCCCCcccC
Confidence            46677766643


No 281
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=27.81  E-value=20  Score=19.75  Aligned_cols=21  Identities=24%  Similarity=0.400  Sum_probs=11.0

Q ss_pred             ccCCCCCCcccChHHHHHHHH
Q psy11352         79 YACSSCSHVSRSRDALRKHVS   99 (107)
Q Consensus        79 ~~C~~C~~~f~~~~~l~~H~~   99 (107)
                      +.|.+|.+-|...-.|..|.+
T Consensus        56 hYCieCaryf~t~~aL~~Hkk   76 (126)
T COG5112          56 HYCIECARYFITEKALMEHKK   76 (126)
T ss_pred             eeeehhHHHHHHHHHHHHHhc
Confidence            445555555555555555543


No 282
>PF03833 PolC_DP2:  DNA polymerase II large subunit DP2;  InterPro: IPR016033 DP2 is the large subunit of a two-subunit novel archaebacterial replicative DNA polymerase first characterised for Pyrococcus furiosus. The structure of DP2 appears to be organised as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit. This entry represents the N-terminal ~950 residue component of DP2.; GO: 0003887 DNA-directed DNA polymerase activity; PDB: 3O59_X.
Probab=27.62  E-value=20  Score=27.14  Aligned_cols=7  Identities=29%  Similarity=1.165  Sum_probs=0.0

Q ss_pred             cCCCCCC
Q psy11352         80 ACSSCSH   86 (107)
Q Consensus        80 ~C~~C~~   86 (107)
                      .|+.|+.
T Consensus       694 ~C~~C~~  700 (900)
T PF03833_consen  694 ECPKCGR  700 (900)
T ss_dssp             -------
T ss_pred             ccccccc
Confidence            4455543


No 283
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=27.06  E-value=32  Score=14.55  Aligned_cols=10  Identities=30%  Similarity=1.099  Sum_probs=5.1

Q ss_pred             eeCCCCcccc
Q psy11352         52 ATCFVCGKQL   61 (107)
Q Consensus        52 ~~C~~C~~~f   61 (107)
                      +.|..|+..|
T Consensus        22 ~~C~~Cg~~~   31 (33)
T PF08792_consen   22 EVCIFCGSSF   31 (33)
T ss_pred             EEcccCCcEe
Confidence            4455555544


No 284
>COG4332 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=27.03  E-value=24  Score=21.51  Aligned_cols=44  Identities=16%  Similarity=0.175  Sum_probs=22.7

Q ss_pred             ccCCCCCCCCCccCCCCCCCCCCCCCCCCCCCCCCCCCeeeCCCCcccccc
Q psy11352         13 LISDHCLTSPLSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQLSN   63 (107)
Q Consensus        13 ~~C~~C~~~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~~   63 (107)
                      -.|+.||. -+.|..++-+...+.+......      -.|+|..|++++..
T Consensus        18 k~C~~Cg~-kr~f~cSg~fRvNAq~K~LDvW------lIYkC~~Cd~tWN~   61 (203)
T COG4332          18 KRCNSCGV-KRAFTCSGKFRVNAQGKVLDVW------LIYKCTHCDYTWNI   61 (203)
T ss_pred             hhCcccCC-cceeeecCcEEEcCCCcEEEEE------EEEEeeccCCccch
Confidence            46888821 1335555544444211111111      25889999987654


No 285
>PF04032 Rpr2:  RNAse P Rpr2/Rpp21/SNM1 subunit domain;  InterPro: IPR007175 This family contains a ribonuclease P subunit of human and yeast. Other members of the family include the probable archaeal homologues. This subunit possibly binds the precursor tRNA [].; PDB: 2K3R_A 2KI7_B 2ZAE_B 1X0T_A.
Probab=26.82  E-value=31  Score=17.61  Aligned_cols=9  Identities=22%  Similarity=0.578  Sum_probs=4.5

Q ss_pred             cccccCCCC
Q psy11352         10 LHFLISDHC   18 (107)
Q Consensus        10 ~~~~~C~~C   18 (107)
                      .+...|..|
T Consensus        44 ~kr~~Ck~C   52 (85)
T PF04032_consen   44 IKRTICKKC   52 (85)
T ss_dssp             CCCTB-TTT
T ss_pred             HhcccccCC
Confidence            455556666


No 286
>PF03145 Sina:  Seven in absentia protein family;  InterPro: IPR018121 The seven in absentia (sina) gene was first identified in Drosophila. The Drosophila Sina protein is essential for the determination of the R7 pathway in photoreceptor cell development: the loss of functional Sina results in the transformation of the R7 precursor cell to a non-neuronal cell type. The Sina protein contains an N-terminal RING finger domain C3HC4-type. Through this domain, Sina binds E2 ubiquitin-conjugating enzymes (UbcD1) Sina also interacts with Tramtrack (TTK88) via PHYL. Tramtrack is a transcriptional repressor that blocks photoreceptor determination, while PHYL down-regulates the activity of TTK88. In turn, the activity of PHYL requires the activation of the Sevenless receptor tyrosine kinase, a process essential for R7 determination. It is thought that Sina targets TTK88 for degradation, therefore promoting the R7 pathway. Murine and human homologues of Sina have also been identified. The human homologue Siah-1 [] also binds E2 enzymes (UbcH5) and through a series of physical interactions, targets beta-catenin for ubiquitin degradation. Siah-1 expression is enhanced by p53, itself promoted by DNA damage. Thus this pathway links DNA damage to beta-catenin degradation [, ]. Sina proteins, therefore, physically interact with a variety of proteins. The N-terminal RING finger domain that binds ubiquitin conjugating enzymes is a C3HC4-type, and does not form part of the alignment for this family. The remainder C-terminal part is involved in interactions with other proteins, and is included in this alignment. In addition to the Drosophila protein and mammalian homologues, whose similarity was noted previously, this family also includes putative homologues from Caenorhabditis elegans, Arabidopsis thaliana.; GO: 0006511 ubiquitin-dependent protein catabolic process, 0007275 multicellular organismal development, 0005634 nucleus; PDB: 2A25_A 1K2F_B 2AN6_C.
Probab=26.81  E-value=62  Score=19.61  Aligned_cols=53  Identities=21%  Similarity=0.317  Sum_probs=27.1

Q ss_pred             CeeeCCC----CcccccchhhHHHHHhhhCCCcccCCC----CCCcccChHHHHHHHHccCCC
Q psy11352         50 LFATCFV----CGKQLSNQYNLRVHMETHQNAFYACSS----CSHVSRSRDALRKHVSYRHPH  104 (107)
Q Consensus        50 ~~~~C~~----C~~~f~~~~~l~~H~~~h~~k~~~C~~----C~~~f~~~~~l~~H~~~~H~~  104 (107)
                      ..+.|..    |...+.. .....|.....-+|+.|+.    |+..= ....|..|....|..
T Consensus        13 ~~~pC~~~~~GC~~~~~~-~~~~~HE~~C~~~p~~CP~~~~~C~~~G-~~~~l~~Hl~~~H~~   73 (198)
T PF03145_consen   13 IKFPCKNAKYGCTETFPY-SEKREHEEECPFRPCSCPFPGSGCDWQG-SYKELLDHLRDKHSW   73 (198)
T ss_dssp             --EE-CCGGGT---EE-G-GGHHHHHHT-TTSEEE-SSSSTT---EE-ECCCHHHHHHHHTTT
T ss_pred             ceecCCCCCCCCcccccc-cChhhHhccCCCcCCcCCCCCCCccccC-CHHHHHHHHHHHCCC
Confidence            4567744    7777554 3566777655558999987    65432 344688898877754


No 287
>PF02150 RNA_POL_M_15KD:  RNA polymerases M/15 Kd subunit;  InterPro: IPR001529 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. In archaebacteria, there is generally a single form of RNA polymerase which also consist of an oligomeric assemblage of 10 to 13 polypeptides. It has recently been shown [], [] that small subunits of about 15 kDa, found in polymerase types I and II, are highly conserved. These proteins contain a probable zinc finger in their N-terminal region and a C-terminal zinc ribbon domain (see IPR001222 from INTERPRO).; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 3H0G_I 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I ....
Probab=26.63  E-value=13  Score=15.89  Aligned_cols=10  Identities=30%  Similarity=0.806  Sum_probs=6.2

Q ss_pred             eCCCCccccc
Q psy11352         53 TCFVCGKQLS   62 (107)
Q Consensus        53 ~C~~C~~~f~   62 (107)
                      .|..|+..+.
T Consensus        22 ~C~~C~Y~~~   31 (35)
T PF02150_consen   22 ACRTCGYEEP   31 (35)
T ss_dssp             EESSSS-EEE
T ss_pred             CCCCCCCccC
Confidence            6777776654


No 288
>TIGR03829 YokU_near_AblA uncharacterized protein, YokU family. Members of this protein family occur in various species of the genus Bacillus, always next to the gene (kamA or ablA) for lysine 2,3-aminomutase. Members have a pair of CXXC motifs, and share homology to the amino-terminal region of a family of putative transcription factors for which the C-terminal is modeled by pfam01381, a helix-turn-helix domain model. This family, however, is shorter and lacks the helix-turn-helix region. The function of this protein family is unknown, but a regulatory role in compatible solute biosynthesis is suggested by local genome context.
Probab=26.17  E-value=46  Score=17.77  Aligned_cols=22  Identities=14%  Similarity=0.395  Sum_probs=17.0

Q ss_pred             eeeCCCCcccccchhhHHHHHh
Q psy11352         51 FATCFVCGKQLSNQYNLRVHME   72 (107)
Q Consensus        51 ~~~C~~C~~~f~~~~~l~~H~~   72 (107)
                      ...|+.||..|.....+..-.+
T Consensus        35 a~~C~~CGe~y~~dev~~eIE~   56 (89)
T TIGR03829        35 SISCSHCGMEYQDDTTVKEIED   56 (89)
T ss_pred             cccccCCCcEeecHHHHHHHHh
Confidence            3679999999998877665544


No 289
>PF09332 Mcm10:  Mcm10 replication factor;  InterPro: IPR015411 Mcm10 is a eukaryotic DNA replication factor that regulates the stability and chromatin association of DNA polymerase alpha []. ; PDB: 2KWQ_A.
Probab=26.11  E-value=19  Score=24.23  Aligned_cols=14  Identities=21%  Similarity=0.285  Sum_probs=6.2

Q ss_pred             eeeCCCCcccccch
Q psy11352         51 FATCFVCGKQLSNQ   64 (107)
Q Consensus        51 ~~~C~~C~~~f~~~   64 (107)
                      .+.|..|.+++...
T Consensus       252 av~C~~C~yt~~~~  265 (344)
T PF09332_consen  252 AVTCKQCKYTAFKP  265 (344)
T ss_dssp             EEEETTT--EESS-
T ss_pred             EEEcCCCCCcccCc
Confidence            45566666554443


No 290
>COG1779 C4-type Zn-finger protein [General function prediction only]
Probab=26.05  E-value=15  Score=22.66  Aligned_cols=11  Identities=27%  Similarity=0.697  Sum_probs=5.3

Q ss_pred             eeCCCCccccc
Q psy11352         52 ATCFVCGKQLS   62 (107)
Q Consensus        52 ~~C~~C~~~f~   62 (107)
                      ..|..||+.+.
T Consensus        44 ~~C~~CgYR~~   54 (201)
T COG1779          44 GVCERCGYRST   54 (201)
T ss_pred             EEccccCCccc
Confidence            34555555443


No 291
>PLN03239 histone acetyltransferase; Provisional
Probab=25.77  E-value=47  Score=22.50  Aligned_cols=23  Identities=13%  Similarity=0.270  Sum_probs=20.3

Q ss_pred             CcccCCCCCCcccChHHHHHHHH
Q psy11352         77 AFYACSSCSHVSRSRDALRKHVS   99 (107)
Q Consensus        77 k~~~C~~C~~~f~~~~~l~~H~~   99 (107)
                      .-|.|+.|-+-|.....|.+|+.
T Consensus       105 ~lYiCE~Clky~~~~~~l~~H~~  127 (351)
T PLN03239        105 VLYVCEFSFGFFARKSELLRFQA  127 (351)
T ss_pred             eEEEeccchhhhcCHHHHHHHHH
Confidence            57999999999999999999975


No 292
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=25.35  E-value=66  Score=15.15  Aligned_cols=8  Identities=38%  Similarity=0.733  Sum_probs=4.0

Q ss_pred             eeCCCCcc
Q psy11352         52 ATCFVCGK   59 (107)
Q Consensus        52 ~~C~~C~~   59 (107)
                      +.|..||.
T Consensus        38 ~~CGkCgy   45 (51)
T COG1998          38 WACGKCGY   45 (51)
T ss_pred             eEeccccc
Confidence            45555554


No 293
>PF13901 DUF4206:  Domain of unknown function (DUF4206)
Probab=25.19  E-value=1.1e+02  Score=18.80  Aligned_cols=14  Identities=14%  Similarity=0.335  Sum_probs=10.3

Q ss_pred             CeeeCCCCcccccc
Q psy11352         50 LFATCFVCGKQLSN   63 (107)
Q Consensus        50 ~~~~C~~C~~~f~~   63 (107)
                      ....|+.|+..|-.
T Consensus       171 ~~~~C~~C~~v~H~  184 (202)
T PF13901_consen  171 TTVRCPKCKSVFHK  184 (202)
T ss_pred             CeeeCCcCccccch
Confidence            45789999877644


No 294
>PRK12387 formate hydrogenlyase complex iron-sulfur subunit; Provisional
Probab=25.06  E-value=52  Score=19.69  Aligned_cols=18  Identities=17%  Similarity=0.464  Sum_probs=14.3

Q ss_pred             CcccCCCCCCcccChHHH
Q psy11352         77 AFYACSSCSHVSRSRDAL   94 (107)
Q Consensus        77 k~~~C~~C~~~f~~~~~l   94 (107)
                      .++.|..||+.|.....+
T Consensus       113 ~~~~C~~CG~~f~~~~~i  130 (180)
T PRK12387        113 ALCNCRVCGRPFAVQKEI  130 (180)
T ss_pred             CcccchhhCCccccHHHH
Confidence            578999999999866543


No 295
>PLN00104 MYST -like histone acetyltransferase; Provisional
Probab=25.05  E-value=68  Score=22.59  Aligned_cols=23  Identities=22%  Similarity=0.700  Sum_probs=18.2

Q ss_pred             CcccCCCCCCcccChHHHHHHHH
Q psy11352         77 AFYACSSCSHVSRSRDALRKHVS   99 (107)
Q Consensus        77 k~~~C~~C~~~f~~~~~l~~H~~   99 (107)
                      .-|.|+.|-+-|.....|.+|+.
T Consensus       197 ~lyiCe~Cl~y~~~~~~~~~H~~  219 (450)
T PLN00104        197 KLYFCEFCLKFMKRKEQLQRHMK  219 (450)
T ss_pred             eEEEchhhhhhhcCHHHHHHHHh
Confidence            46788888888888888888876


No 296
>cd01327 KAZAL_PSTI Kazal-type pancreatic secretory trypsin inhibitors (PSTI) and related proteins, including the second domain of the ovomucoid turkey inhibitor and the C-terminal domain of the esophagus cancer-related gene-2 protein (ECRG-2), are members of the superfamily of kazal-type proteinase inhibitors and follistatin-like proteins.
Probab=24.91  E-value=41  Score=15.15  Aligned_cols=16  Identities=19%  Similarity=0.000  Sum_probs=11.0

Q ss_pred             CCCCCCCCccCCCCCC
Q psy11352         16 DHCLTSPLSSSIPGSS   31 (107)
Q Consensus        16 ~~C~~~~~~~~~~~~l   31 (107)
                      ++||+++.+|.+.-.|
T Consensus        11 PVCGsDg~TY~N~C~l   26 (45)
T cd01327          11 PVCGTDGVTYSNECLL   26 (45)
T ss_pred             ceeCCCCCEeCCHhHH
Confidence            5687777777666555


No 297
>PF06170 DUF983:  Protein of unknown function (DUF983);  InterPro: IPR009325 This family consists of several bacterial proteins of unknown function.
Probab=24.08  E-value=41  Score=17.72  Aligned_cols=12  Identities=17%  Similarity=0.357  Sum_probs=7.6

Q ss_pred             ccCCCCCCcccC
Q psy11352         79 YACSSCSHVSRS   90 (107)
Q Consensus        79 ~~C~~C~~~f~~   90 (107)
                      -.|+.||..|..
T Consensus         9 ~~C~~CG~d~~~   20 (86)
T PF06170_consen    9 PRCPHCGLDYSH   20 (86)
T ss_pred             CcccccCCcccc
Confidence            357777766654


No 298
>PF02146 SIR2:  Sir2 family;  InterPro: IPR003000 These sequences represent the Sirtuin (Sir2-related) family of NAD+-dependent deacetylases. This family of enzymes is broadly conserved from bacteria to humans. In yeast, Sir2 proteins form complexes with other proteins to silence chromatin by accessing histones and deacetylating them. Sir2 proteins have been proposed to play a role in silencing, chromosome stability and ageing []. The bacterial enzyme CobB, an homologue of Sir2, is a phosphoribosyltransferase []. An in vitro ADP ribosyltransferase activity has also been associated with human members of this family []. Sir2-like enzymes employ NAD+ as a cosubstrate in deacetylation reactions [] and catalyse a reaction in which the cleavage of NAD(+)and histone and/or protein deacetylation are coupled to the formation of O-acetyl-ADP-ribose, a novel metabolite. The dependence of the reaction on both NAD(+) and the generation of this potential second messenger offers new clues to understanding the function and regulation of nuclear, cytoplasmic and mitochondrial Sir2-like enzymes []. Silent Information Regulator protein of Saccharomyces cerevisiae (Sir2) is one of several factors critical for silencing at least three loci. Among them, it is unique because it silences the rDNA as well as the mating type loci and telomeres []. Sir2 interacts in a complex with itself and with Sir3 and Sir4, two proteins that are able to interact with nucleosomes. In addition Sir2 also interacts with ubiquitination factors and/or complexes [].  Homologues of Sir2 share a core domain including the GAG and NID motifs and a putative C4 Zinc finger. The regions containing these three conserved motifs are individually essential for Sir2 silencing function, as are the four cysteins []. In addition, the conserved residues HG next to the putative Zn finger have been shown to be essential for the ADP ribosyltransferase activity []. ; GO: 0008270 zinc ion binding, 0070403 NAD+ binding, 0006476 protein deacetylation; PDB: 1S5P_A 3PKI_E 3PKJ_F 3K35_A 1ICI_A 1M2K_A 1M2G_A 1M2N_B 1M2H_A 1M2J_A ....
Probab=23.72  E-value=1.1e+02  Score=18.21  Aligned_cols=35  Identities=17%  Similarity=0.431  Sum_probs=21.9

Q ss_pred             CeeeCCCCcccccchhhHHHHHhhhCCCcccCCCCCCc
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHV   87 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~~h~~k~~~C~~C~~~   87 (107)
                      ....|..|++.+.......   ....+.+-.|+.|+..
T Consensus       104 ~~~~C~~C~~~~~~~~~~~---~~~~~~~~~C~~C~~~  138 (178)
T PF02146_consen  104 FRLRCSKCGKEYDREDIVD---SIDEEEPPRCPKCGGL  138 (178)
T ss_dssp             EEEEETTTSBEEEGHHHHH---HHHTTSSCBCTTTSCB
T ss_pred             ceeeecCCCccccchhhcc---cccccccccccccCcc
Confidence            4578999999887644321   1222334489999863


No 299
>PF02891 zf-MIZ:  MIZ/SP-RING zinc finger;  InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents MIZ-type zinc finger domains. Miz1 (Msx-interacting-zinc finger) is a zinc finger-containing protein with homology to the yeast protein, Nfi-1. Miz1 is a sequence specific DNA binding protein that can function as a positive-acting transcription factor. Miz1 binds to the homeobox protein Msx2, enhancing the specific DNA-binding ability of Msx2 []. Other proteins containing this domain include the human pias family (protein inhibitor of activated STAT protein). More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3I2D_A.
Probab=23.66  E-value=34  Score=15.88  Aligned_cols=10  Identities=20%  Similarity=0.793  Sum_probs=3.7

Q ss_pred             CcccCCCCCC
Q psy11352         77 AFYACSSCSH   86 (107)
Q Consensus        77 k~~~C~~C~~   86 (107)
                      ..|.|++|++
T Consensus        40 ~~W~CPiC~~   49 (50)
T PF02891_consen   40 PKWKCPICNK   49 (50)
T ss_dssp             ---B-TTT--
T ss_pred             CCeECcCCcC
Confidence            4589999975


No 300
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=23.59  E-value=35  Score=16.37  Aligned_cols=12  Identities=17%  Similarity=0.589  Sum_probs=7.6

Q ss_pred             ccCCCCCCcccC
Q psy11352         79 YACSSCSHVSRS   90 (107)
Q Consensus        79 ~~C~~C~~~f~~   90 (107)
                      ..|..||+.|..
T Consensus         6 ~~C~~Cg~~~~~   17 (54)
T PF14446_consen    6 CKCPVCGKKFKD   17 (54)
T ss_pred             ccChhhCCcccC
Confidence            357777777753


No 301
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=23.26  E-value=55  Score=13.21  Aligned_cols=9  Identities=22%  Similarity=0.840  Sum_probs=4.7

Q ss_pred             ccCCCCCCc
Q psy11352         79 YACSSCSHV   87 (107)
Q Consensus        79 ~~C~~C~~~   87 (107)
                      |.|..|++.
T Consensus         1 ~~C~~C~~~    9 (30)
T PF03107_consen    1 FWCDVCRRK    9 (30)
T ss_pred             CCCCCCCCC
Confidence            345666544


No 302
>KOG2807|consensus
Probab=23.21  E-value=85  Score=21.22  Aligned_cols=19  Identities=26%  Similarity=0.350  Sum_probs=10.8

Q ss_pred             cccCCCCCCcccChHHHHH
Q psy11352         78 FYACSSCSHVSRSRDALRK   96 (107)
Q Consensus        78 ~~~C~~C~~~f~~~~~l~~   96 (107)
                      |..|+.|+-.......|.+
T Consensus       290 P~eCpiC~ltLVss~hLAR  308 (378)
T KOG2807|consen  290 PIECPICSLTLVSSPHLAR  308 (378)
T ss_pred             CccCCccceeEecchHHHH
Confidence            5566666655555555543


No 303
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=22.98  E-value=48  Score=14.63  Aligned_cols=10  Identities=40%  Similarity=0.760  Sum_probs=6.1

Q ss_pred             eeCCCCcccc
Q psy11352         52 ATCFVCGKQL   61 (107)
Q Consensus        52 ~~C~~C~~~f   61 (107)
                      +.|..||...
T Consensus        20 ~vC~~CG~Vl   29 (43)
T PF08271_consen   20 LVCPNCGLVL   29 (43)
T ss_dssp             EEETTT-BBE
T ss_pred             EECCCCCCEe
Confidence            6777777654


No 304
>PF14375 Cys_rich_CWC:  Cysteine-rich CWC
Probab=22.57  E-value=50  Score=15.25  Aligned_cols=9  Identities=22%  Similarity=0.689  Sum_probs=4.6

Q ss_pred             CCCCCCccc
Q psy11352         81 CSSCSHVSR   89 (107)
Q Consensus        81 C~~C~~~f~   89 (107)
                      |+.||..|.
T Consensus         1 CP~Cg~~f~    9 (50)
T PF14375_consen    1 CPRCGAPFE    9 (50)
T ss_pred             CCCCCCcCC
Confidence            455555553


No 305
>cd01410 SIRT7 SIRT7: Eukaryotic and prokaryotic group (class4) which includes human sirtuin SIRT6, SIRT7, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span.
Probab=22.40  E-value=1.4e+02  Score=18.45  Aligned_cols=34  Identities=15%  Similarity=0.420  Sum_probs=19.1

Q ss_pred             CeeeCCCCcccccchhhHHHHHhhhCC-CcccCCCCCC
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHMETHQN-AFYACSSCSH   86 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~~h~~-k~~~C~~C~~   86 (107)
                      ....|..|+..+.....+.   ..... ....|+.||.
T Consensus        94 ~~~~C~~C~~~~~~~~~~~---~~~~~~~~p~C~~Cgg  128 (206)
T cd01410          94 FIEVCKSCGPEYVRDDVVE---TRGDKETGRRCHACGG  128 (206)
T ss_pred             CcccCCCCCCccchHHHHH---HhhcCCCCCcCCCCcC
Confidence            4466888987766543321   11122 3456888874


No 306
>PTZ00064 histone acetyltransferase; Provisional
Probab=22.19  E-value=95  Score=22.37  Aligned_cols=24  Identities=25%  Similarity=0.384  Sum_probs=19.7

Q ss_pred             CcccCCCCCCcccChHHHHHHHHc
Q psy11352         77 AFYACSSCSHVSRSRDALRKHVSY  100 (107)
Q Consensus        77 k~~~C~~C~~~f~~~~~l~~H~~~  100 (107)
                      .-|.|+.|-+-|.....|.+|+..
T Consensus       279 ~LYICEfCLkY~~s~~~l~rH~~~  302 (552)
T PTZ00064        279 TLHFCEYCLDFFCFEDELIRHLSR  302 (552)
T ss_pred             eEEEccchhhhhCCHHHHHHHHhc
Confidence            468888888888888888888873


No 307
>PRK08270 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=22.16  E-value=65  Score=23.85  Aligned_cols=10  Identities=20%  Similarity=0.640  Sum_probs=6.5

Q ss_pred             CcccCCCCCC
Q psy11352         77 AFYACSSCSH   86 (107)
Q Consensus        77 k~~~C~~C~~   86 (107)
                      .-+.|+.||.
T Consensus       638 ~~~~CP~CG~  647 (656)
T PRK08270        638 EHEFCPKCGE  647 (656)
T ss_pred             CCCCCcCCcC
Confidence            3467777774


No 308
>PF14369 zf-RING_3:  zinc-finger
Probab=21.74  E-value=49  Score=14.11  Aligned_cols=8  Identities=25%  Similarity=0.646  Sum_probs=4.2

Q ss_pred             CCCCCCcc
Q psy11352         81 CSSCSHVS   88 (107)
Q Consensus        81 C~~C~~~f   88 (107)
                      |+.|+-.|
T Consensus        24 CP~C~~gF   31 (35)
T PF14369_consen   24 CPRCHGGF   31 (35)
T ss_pred             CcCCCCcE
Confidence            55555444


No 309
>KOG2857|consensus
Probab=21.72  E-value=50  Score=19.33  Aligned_cols=21  Identities=10%  Similarity=0.023  Sum_probs=18.1

Q ss_pred             cccCCCCCCCCCccCCCCCCCCCC
Q psy11352         12 FLISDHCLTSPLSSSIPGSSKTKA   35 (107)
Q Consensus        12 ~~~C~~C~~~~~~~~~~~~l~~h~   35 (107)
                      .|+|+.|   ...+-+...++.|.
T Consensus        17 KYKCpkC---~vPYCSl~CfKiHk   37 (157)
T KOG2857|consen   17 KYKCPKC---SVPYCSLPCFKIHK   37 (157)
T ss_pred             hccCCCC---CCccccchhhhhcc
Confidence            6999999   88888888888883


No 310
>PF12230 PRP21_like_P:  Pre-mRNA splicing factor PRP21 like protein;  InterPro: IPR022030  This domain family is found in eukaryotes, and is typically between 212 and 238 amino acids in length. The family is found in association with PF01805 from PFAM. There are two completely conserved residues (W and H) that may be functionally important. PRP21 is required for assembly of the prespliceosome and it interacts with U2 snRNP and/or pre-mRNA in the prespliceosome. This family also contains proteins similar to PRP21, such as the mammalian SF3a. SF3a also interacts with U2 snRNP from the prespliceosome, converting it to its active form. ; PDB: 4DGW_B.
Probab=21.53  E-value=31  Score=21.53  Aligned_cols=26  Identities=15%  Similarity=0.293  Sum_probs=0.0

Q ss_pred             CeeeCCCCcccccchhhHHHHHhhhCC
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHMETHQN   76 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~~h~~   76 (107)
                      ....|++||..... ..|..||++.+-
T Consensus       167 ~~~~cPitGe~IP~-~e~~eHmRi~Ll  192 (229)
T PF12230_consen  167 KMIICPITGEMIPA-DEMDEHMRIELL  192 (229)
T ss_dssp             ---------------------------
T ss_pred             cccccccccccccc-cccccccccccc
Confidence            34678888877654 557888887764


No 311
>cd01413 SIR2_Af2 SIR2_Af2: Archaeal and prokaryotic group which includes Archaeoglobus fulgidus Sir2-Af2, Sulfolobus solfataricus ssSir2, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. The Sir2 homolog from the archaea Sulfolobus solftaricus deacetylates the non-specific DNA protein Alba to mediate transcription repression.
Probab=21.46  E-value=1.4e+02  Score=18.64  Aligned_cols=33  Identities=18%  Similarity=0.434  Sum_probs=18.4

Q ss_pred             CeeeCCCCcccccchhhHHHHHhhhCCCcccCCCCCC
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSH   86 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~~h~~k~~~C~~C~~   86 (107)
                      ....|..|+..+..... .   ....+..-.|+.|+.
T Consensus       112 ~~~~C~~C~~~~~~~~~-~---~~~~~~~p~C~~Cgg  144 (222)
T cd01413         112 QTAYCVNCGSKYDLEEV-K---YAKKHEVPRCPKCGG  144 (222)
T ss_pred             CcceECCCCCCcchhHH-H---HhccCCCCcCCCCCC
Confidence            44678888887765432 1   111123346888864


No 312
>PF03966 Trm112p:  Trm112p-like protein;  InterPro: IPR005651 This family of short proteins have no known function. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The function of this family is uncertain. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The entry contains 2 families:  Trm112, which is required for tRNA methylation in Saccharomyces cerevisiae (Baker's yeast) and is found in complexes with 2 tRNA methylases (TRM9 and TRM11) also with putative methyltransferase YDR140W []. The zinc-finger protein Ynr046w is plurifunctional and a component of the eRF1 methyltransferase in yeast []. The crystal structure of Ynr046w has been determined to 1.7 A resolution. It comprises a zinc-binding domain built from both the N- and C-terminal sequences and an inserted domain, absent from bacterial and archaeal orthologs of the protein, composed of three alpha-helices []. UPF0434, which are proteins that are functionally uncharacterised.  ; PDB: 3Q87_A 2KPI_A 2K5R_A 2HF1_A 2JS4_A 2J6A_A 2JR6_A 2PK7_A 2JNY_A.
Probab=20.97  E-value=43  Score=16.52  Aligned_cols=14  Identities=21%  Similarity=0.377  Sum_probs=11.2

Q ss_pred             CeeeCCCCcccccc
Q psy11352         50 LFATCFVCGKQLSN   63 (107)
Q Consensus        50 ~~~~C~~C~~~f~~   63 (107)
                      -...|+.|+..|.-
T Consensus        52 g~L~Cp~c~r~YPI   65 (68)
T PF03966_consen   52 GELICPECGREYPI   65 (68)
T ss_dssp             TEEEETTTTEEEEE
T ss_pred             CEEEcCCCCCEEeC
Confidence            45889999998864


No 313
>COG2879 Uncharacterized small protein [Function unknown]
Probab=20.81  E-value=1.1e+02  Score=15.21  Aligned_cols=16  Identities=25%  Similarity=0.463  Sum_probs=11.1

Q ss_pred             ChHHHHHHHHccCCCC
Q psy11352         90 SRDALRKHVSYRHPHI  105 (107)
Q Consensus        90 ~~~~l~~H~~~~H~~e  105 (107)
                      .-++...||+.+|++.
T Consensus        24 dYdnYVehmr~~hPd~   39 (65)
T COG2879          24 DYDNYVEHMRKKHPDK   39 (65)
T ss_pred             cHHHHHHHHHHhCcCC
Confidence            4566778888767654


No 314
>PF02748 PyrI_C:  Aspartate carbamoyltransferase regulatory chain, metal binding domain;  InterPro: IPR020542 Aspartate carbamoyltransferase (aspartate transcarbamylase, ATCase) 2.1.3.2 from EC is an allosteric enzyme that plays a central role in the regulation of the pyrimidine pathway in bacteria. The holoenzyme is a dodecamer composed of six catalytic chains, each with an active site, and six regulatory chains lacking catalytic activity []. The catalytic subunits exist as a dimer of catalytic trimers, (c3)2, while the regulatory subunits exist as a trimer of regulatory dimers, (r2)3, therefore the complete holoenzyme can be represented as (c3)2(r2)3. The association of the catalytic subunits c3 with the regulatory subunits r2 is responsible for the establishment of positive co-operativity between catalytic sites for the binding of aspartate and it dictates the pattern of allosteric response toward nucleotide effectors. ATCase from Escherichia coli is the most extensively studied allosteric enzyme []. The crystal structure of the T-state, the T-state with CTP bound, the R-state with N-phosphonacetyl-L-aspartate (PALA) bound, and the R-state with phosphonoacetamide plus malonate bound have been used in interpreting kinetic and mutational studies. A high-resolution structure of E. coli ATCase in the presence of PALA (a bisubstrate analog) allows a detailed description of the binding at the active site of the enzyme and allows a detailed model of the tetrahedral intermediate to be constructed. The entire regulatory chain has been traced showing that the N-terminal regions of the regulatory chains R1 and R6 are located in close proximity to each other and to the regulatory site. This portion of the molecule may be involved in the observed asymmetry between the regulatory binding sites as well as in the heterotropic response of the enzyme []. The C-terminal domain of the regulatory chains have a rubredoxin-like zinc-bound fold.  ATCase from Enterobacter agglomerans (Erwinia herbicola) (Pantoea agglomerans) differs from the other investigated enterobacterial ATCases by its absence of homotropic co-operativity toward the substrate aspartate and its lack of response to ATP which is an allosteric effector (activator) of this family of enzymes. Nevertheless, the E. herbicola ATCase has the same quaternary structure, two trimers of catalytic chains with three dimers of regulatory chains, (c3)2(r2)3, as other enterobacterial ATCases and shows extensive primary structure conservation [].  This entry represents the C-terminal domain.; PDB: 2YWW_B 1SKU_D 1Q95_L 8ATC_B 3AT1_D 1RAI_D 4E2F_D 1NBE_B 6AT1_B 2FZC_D ....
Probab=20.68  E-value=70  Score=15.08  Aligned_cols=15  Identities=13%  Similarity=0.578  Sum_probs=9.6

Q ss_pred             CeeeCCCCcccccch
Q psy11352         50 LFATCFVCGKQLSNQ   64 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~   64 (107)
                      ..+.|..|++.+...
T Consensus        34 ~~~rC~YCe~~~~~~   48 (52)
T PF02748_consen   34 IKLRCHYCERIITED   48 (52)
T ss_dssp             CEEEETTT--EEEHH
T ss_pred             CEEEeeCCCCEeccc
Confidence            668899998877543


No 315
>COG1439 Predicted nucleic acid-binding protein, consists of a PIN domain and a Zn-ribbon module [General function prediction only]
Probab=20.66  E-value=61  Score=19.71  Aligned_cols=25  Identities=16%  Similarity=0.390  Sum_probs=16.7

Q ss_pred             CeeeCCCCcccccchhhHHHHHhhhCCCcccCCCCCCc
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHV   87 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~~h~~k~~~C~~C~~~   87 (107)
                      -.+.|..|++.|..             .--.|+.||-.
T Consensus       138 w~~rC~GC~~~f~~-------------~~~~Cp~CG~~  162 (177)
T COG1439         138 WRLRCHGCKRIFPE-------------PKDFCPICGSP  162 (177)
T ss_pred             eeEEEecCceecCC-------------CCCcCCCCCCc
Confidence            34778889888872             12358888854


No 316
>PF04328 DUF466:  Protein of unknown function (DUF466);  InterPro: IPR007423 This is a small bacterial protein of unknown function.
Probab=20.41  E-value=1e+02  Score=15.28  Aligned_cols=15  Identities=27%  Similarity=0.536  Sum_probs=9.5

Q ss_pred             HHHHHHHccCCCCCC
Q psy11352         93 ALRKHVSYRHPHISP  107 (107)
Q Consensus        93 ~l~~H~~~~H~~ekp  107 (107)
                      ....|++.+|+++.|
T Consensus        27 ~Yv~H~~~~HP~~p~   41 (65)
T PF04328_consen   27 RYVEHMRRHHPDEPP   41 (65)
T ss_pred             HHHHHHHHHCcCCCC
Confidence            344677777877654


No 317
>PF12773 DZR:  Double zinc ribbon
Probab=20.34  E-value=65  Score=14.52  Aligned_cols=10  Identities=20%  Similarity=0.527  Sum_probs=5.6

Q ss_pred             cccCCCCCCc
Q psy11352         78 FYACSSCSHV   87 (107)
Q Consensus        78 ~~~C~~C~~~   87 (107)
                      ...|+.|+..
T Consensus        29 ~~~C~~Cg~~   38 (50)
T PF12773_consen   29 KKICPNCGAE   38 (50)
T ss_pred             CCCCcCCcCC
Confidence            4556666654


No 318
>KOG4477|consensus
Probab=20.06  E-value=57  Score=19.99  Aligned_cols=23  Identities=26%  Similarity=0.535  Sum_probs=13.8

Q ss_pred             CeeeCCCCcccccchhhHHHHHhhhCCCcccCCCCC
Q psy11352         50 LFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCS   85 (107)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~H~~~h~~k~~~C~~C~   85 (107)
                      ..|.|..|.  |.+..           ..|.|.+|+
T Consensus        23 g~WdCsvCT--FrNsA-----------eAfkC~vCd   45 (228)
T KOG4477|consen   23 GKWDCSVCT--FRNSA-----------EAFKCFVCD   45 (228)
T ss_pred             Cceeeeeee--ecchh-----------hhhheeeec
Confidence            557777773  43322           367777776


No 319
>PF01844 HNH:  HNH endonuclease;  InterPro: IPR002711 HNH endonuclease is found in bacteria and viruses [, , ]. This family includes pyocins, colicins and anaredoxins.; GO: 0003676 nucleic acid binding, 0004519 endonuclease activity; PDB: 2QGP_C.
Probab=20.02  E-value=19  Score=15.90  Aligned_cols=11  Identities=45%  Similarity=0.896  Sum_probs=3.5

Q ss_pred             CCCCcccccch
Q psy11352         54 CFVCGKQLSNQ   64 (107)
Q Consensus        54 C~~C~~~f~~~   64 (107)
                      |..|++.+...
T Consensus         1 C~~C~~~~~~~   11 (47)
T PF01844_consen    1 CQYCGKPGSDN   11 (47)
T ss_dssp             -TTT--B--GG
T ss_pred             CCCCCCcCccC
Confidence            56666665554


No 320
>PRK11032 hypothetical protein; Provisional
Probab=20.01  E-value=41  Score=20.04  Aligned_cols=28  Identities=21%  Similarity=0.463  Sum_probs=16.1

Q ss_pred             eeeCCCCcccccchhhHHHHHhhhCCCcccCCCCCCc
Q psy11352         51 FATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHV   87 (107)
Q Consensus        51 ~~~C~~C~~~f~~~~~l~~H~~~h~~k~~~C~~C~~~   87 (107)
                      .+.|..||.....         .+.+.--.|+.||..
T Consensus       124 ~LvC~~Cg~~~~~---------~~p~~i~pCp~C~~~  151 (160)
T PRK11032        124 NLVCEKCHHHLAF---------YTPEVLPLCPKCGHD  151 (160)
T ss_pred             eEEecCCCCEEEe---------cCCCcCCCCCCCCCC
Confidence            4788888865321         233333368888753


Done!