Diaphorina citri psyllid: psy11356


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70
MSCSIVTKELLTECLTFETQMDYKTYLDFVLSLENKHEPQALQYLFRFLDIKHQGYLDTFTLFYFFKIDM
cHHHHHHHHHHHccccccccccHHHHHHHHHccccccccHHHHHHHHHHcccccccccHHHHHHHHHccc
**CSIVTKELLTECLTFETQMDYKTYLDFVLSLENKHEPQALQYLFRFLDIKHQGYLDTFTLFYFFKIDM
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSCSIVTKELLTECLTFETQMDYKTYLDFVLSLENKHEPQALQYLFRFLDIKHQGYLDTFTLFYFFKIDM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma Possible role in the regulation of cell death.confidentQ6DJ05
Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma May regulate MCM3AP phosphorylation through phosphatase recruitment. May play a role in the activation-induced cell death of B-cells.confidentQ6AXZ3
Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma May regulate MCM3AP phosphorylation through phosphatase recruitment. May play a role in the activation-induced cell death of B-cells.confidentQ5E9G1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005813 [CC]centrosomeprobableGO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3LL8, chain B
Confidence level:confident
Coverage over the Query: 4-68
View the alignment between query and template
View the model in PyMOL