Query         psy11364
Match_columns 101
No_of_seqs    123 out of 1662
Neff          9.9 
Searched_HMMs 46136
Date          Fri Aug 16 16:30:06 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy11364.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/11364hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus               99.8 4.6E-21   1E-25  121.9   2.9   76   24-100   187-263 (279)
  2 KOG2462|consensus               99.7 8.5E-18 1.8E-22  107.1   1.7   76   23-101   160-236 (279)
  3 KOG3623|consensus               99.6 2.3E-16   5E-21  111.3  -1.6   76   24-100   894-970 (1007)
  4 KOG3576|consensus               99.5 8.8E-16 1.9E-20   94.6  -4.1   78   22-100   115-193 (267)
  5 KOG3623|consensus               99.4 4.4E-14 9.6E-19  100.0  -1.7   78   23-100   239-329 (1007)
  6 PHA02768 hypothetical protein;  99.2 3.6E-12 7.7E-17   63.5   1.9   43   54-97      6-48  (55)
  7 PHA00733 hypothetical protein   99.1 2.2E-11 4.7E-16   71.3   0.7   78   22-100    38-119 (128)
  8 PF13465 zf-H2C2_2:  Zinc-finge  98.9 6.2E-10 1.3E-14   47.7   2.2   25   68-92      1-26  (26)
  9 KOG1074|consensus               98.9 1.2E-10 2.6E-15   83.8  -0.0   80   21-101   602-689 (958)
 10 KOG3576|consensus               98.9 2.9E-10 6.2E-15   70.5   0.6   76   24-100   145-232 (267)
 11 KOG1074|consensus               98.8 9.1E-10   2E-14   79.4   1.4   49   52-100   604-653 (958)
 12 KOG3608|consensus               98.6 1.5E-09 3.2E-14   72.2  -3.5   75   23-100   236-312 (467)
 13 PHA00732 hypothetical protein   98.5 8.5E-08 1.8E-12   51.6   2.4   38   53-92      1-39  (79)
 14 PHA00616 hypothetical protein   98.5 1.2E-07 2.6E-12   45.2   2.0   33   53-85      1-34  (44)
 15 KOG3608|consensus               98.4   5E-08 1.1E-12   65.1   0.0   54   24-77    263-316 (467)
 16 KOG3993|consensus               98.3   3E-08 6.5E-13   67.2  -2.6   76   24-100   267-376 (500)
 17 PHA02768 hypothetical protein;  98.2 4.3E-08 9.4E-13   48.9  -2.7   44   24-70      5-48  (55)
 18 PLN03086 PRLI-interacting fact  98.1 6.5E-07 1.4E-11   63.4   0.9   61   24-90    453-514 (567)
 19 PHA00733 hypothetical protein   98.1 2.2E-06 4.8E-11   50.2   1.7   52   23-77     72-123 (128)
 20 PLN03086 PRLI-interacting fact  98.0 4.3E-06 9.3E-11   59.4   2.6   69   23-94    477-555 (567)
 21 PF00096 zf-C2H2:  Zinc finger,  98.0 6.3E-06 1.4E-10   33.9   2.1   23   54-76      1-23  (23)
 22 COG5189 SFP1 Putative transcri  97.9   4E-06 8.7E-11   55.5   1.2   51   51-101   347-419 (423)
 23 PF00096 zf-C2H2:  Zinc finger,  97.9 3.2E-06   7E-11   34.8   0.0   21   81-101     1-21  (23)
 24 PF05605 zf-Di19:  Drought indu  97.8 1.8E-05 3.9E-10   39.5   2.6   45   53-100     2-49  (54)
 25 PF13912 zf-C2H2_6:  C2H2-type   97.7 1.4E-05   3E-10   34.1   0.9   22   80-101     1-22  (27)
 26 PHA00616 hypothetical protein   97.7 7.4E-06 1.6E-10   39.0  -0.3   22   80-101     1-22  (44)
 27 PF13912 zf-C2H2_6:  C2H2-type   97.5 6.2E-05 1.3E-09   32.0   1.3   25   53-77      1-25  (27)
 28 PF13894 zf-C2H2_4:  C2H2-type   97.4 0.00016 3.5E-09   29.4   2.3   23   54-76      1-23  (24)
 29 PRK04860 hypothetical protein;  97.4 7.7E-05 1.7E-09   45.3   1.5   39   52-94    118-157 (160)
 30 PHA00732 hypothetical protein   97.3 5.4E-05 1.2E-09   40.8  -0.1   48   24-77      1-48  (79)
 31 PF09237 GAGA:  GAGA factor;  I  97.3 0.00082 1.8E-08   32.9   3.9   33   48-80     19-52  (54)
 32 PF13894 zf-C2H2_4:  C2H2-type   97.3 0.00012 2.5E-09   29.9   0.7   20   81-100     1-20  (24)
 33 PF12756 zf-C2H2_2:  C2H2 type   97.2 0.00012 2.6E-09   40.4   0.6   23   53-75     50-72  (100)
 34 smart00355 ZnF_C2H2 zinc finge  97.1 0.00062 1.4E-08   28.0   2.2   24   54-77      1-24  (26)
 35 smart00355 ZnF_C2H2 zinc finge  96.9 0.00034 7.5E-09   28.8   0.6   21   81-101     1-21  (26)
 36 PF12171 zf-C2H2_jaz:  Zinc-fin  96.8  0.0011 2.3E-08   28.2   1.9   21   81-101     2-22  (27)
 37 KOG3993|consensus               96.8 0.00024 5.3E-09   48.8  -0.6   48   54-101   268-316 (500)
 38 PF12874 zf-met:  Zinc-finger o  96.7 0.00071 1.5E-08   28.1   0.7   20   81-100     1-20  (25)
 39 PF05605 zf-Di19:  Drought indu  96.6 0.00059 1.3E-08   34.0   0.2   50   24-76      2-52  (54)
 40 PF12874 zf-met:  Zinc-finger o  96.0  0.0049 1.1E-07   25.4   1.5   22   54-75      1-22  (25)
 41 KOG1146|consensus               95.8  0.0041 8.8E-08   48.2   1.3   52   50-101   462-539 (1406)
 42 PF09237 GAGA:  GAGA factor;  I  95.3  0.0068 1.5E-07   29.7   0.6   22   79-100    23-44  (54)
 43 smart00451 ZnF_U1 U1-like zinc  95.1   0.014   3E-07   26.0   1.2   19   81-99      4-22  (35)
 44 PF13909 zf-H2C2_5:  C2H2-type   95.0   0.033 7.2E-07   22.6   2.2   22   54-76      1-22  (24)
 45 PF13913 zf-C2HC_2:  zinc-finge  94.5   0.017 3.7E-07   24.1   0.7   17   55-72      4-20  (25)
 46 KOG2186|consensus               93.1   0.064 1.4E-06   34.9   1.7   38   54-92      4-41  (276)
 47 KOG2893|consensus               93.0   0.039 8.4E-07   35.8   0.7   38   56-96     13-50  (341)
 48 cd00350 rubredoxin_like Rubred  90.9    0.14   3E-06   22.7   1.0    8   80-87     17-24  (33)
 49 PF12756 zf-C2H2_2:  C2H2 type   90.8    0.28   6E-06   26.7   2.4   68   26-101     1-71  (100)
 50 COG5189 SFP1 Putative transcri  90.5   0.071 1.5E-06   36.0  -0.2   52   23-74    348-419 (423)
 51 PF09538 FYDLN_acid:  Protein o  89.8    0.27 5.8E-06   28.1   1.8   30   25-66     10-39  (108)
 52 COG5048 FOG: Zn-finger [Genera  89.6    0.22 4.7E-06   33.8   1.6   59   24-83    289-354 (467)
 53 PRK00464 nrdR transcriptional   89.5    0.27 5.7E-06   29.9   1.7   43   26-69      2-44  (154)
 54 COG2888 Predicted Zn-ribbon RN  88.7    0.28   6E-06   24.9   1.2   32   52-87     26-57  (61)
 55 COG4049 Uncharacterized protei  86.2    0.56 1.2E-05   23.5   1.4   26   50-75     14-39  (65)
 56 PRK04860 hypothetical protein;  85.4   0.087 1.9E-06   32.1  -2.0   38   23-65    118-155 (160)
 57 PHA00626 hypothetical protein   85.4     0.8 1.7E-05   22.9   1.7   17   51-67     21-37  (59)
 58 cd00729 rubredoxin_SM Rubredox  85.2    0.54 1.2E-05   21.0   1.0    8   80-87     18-25  (34)
 59 TIGR02300 FYDLN_acid conserved  83.3    0.96 2.1E-05   26.5   1.8   30   25-66     10-39  (129)
 60 TIGR00373 conserved hypothetic  80.9     1.1 2.3E-05   27.3   1.5   31   52-90    108-138 (158)
 61 PRK06266 transcription initiat  80.9       1 2.2E-05   28.0   1.3   32   52-91    116-147 (178)
 62 PF13719 zinc_ribbon_5:  zinc-r  80.1     1.2 2.6E-05   20.2   1.2    9   54-62     26-34  (37)
 63 PF13717 zinc_ribbon_4:  zinc-r  79.8     1.5 3.2E-05   19.8   1.4   10   80-89     25-34  (36)
 64 COG5048 FOG: Zn-finger [Genera  79.5    0.46   1E-05   32.2  -0.5   49   52-100   288-343 (467)
 65 smart00531 TFIIE Transcription  79.1     1.4   3E-05   26.4   1.5   36   52-90     98-133 (147)
 66 PRK14890 putative Zn-ribbon RN  78.8    0.96 2.1E-05   22.9   0.6   32   52-88     24-56  (59)
 67 COG1592 Rubrerythrin [Energy p  78.6     1.1 2.3E-05   27.6   0.9   23   53-87    134-156 (166)
 68 smart00659 RPOLCX RNA polymera  78.1     1.4   3E-05   20.9   1.0    8   80-87     19-26  (44)
 69 TIGR02098 MJ0042_CXXC MJ0042 f  77.7     1.5 3.2E-05   19.8   1.1    9   54-62     26-34  (38)
 70 PF09845 DUF2072:  Zn-ribbon co  76.2     1.4 3.1E-05   26.0   1.0   15   53-67      1-15  (131)
 71 smart00734 ZnF_Rad18 Rad18-lik  76.0     1.6 3.4E-05   18.2   0.8    8   83-90      4-11  (26)
 72 COG0068 HypF Hydrogenase matur  73.1     2.1 4.6E-05   32.1   1.4   60   26-91    125-184 (750)
 73 PF09986 DUF2225:  Uncharacteri  72.7     1.5 3.2E-05   28.0   0.4   44   23-66      4-61  (214)
 74 KOG2785|consensus               72.6     2.5 5.4E-05   29.4   1.5   22   79-100    67-88  (390)
 75 PF01927 Mut7-C:  Mut7-C RNAse   72.6     4.5 9.8E-05   24.2   2.5   20   52-71    123-142 (147)
 76 COG1198 PriA Primosomal protei  72.3     4.3 9.2E-05   30.8   2.8   47   24-89    435-484 (730)
 77 PRK09678 DNA-binding transcrip  72.1     2.6 5.6E-05   22.3   1.2   41   25-68      2-44  (72)
 78 smart00614 ZnF_BED BED zinc fi  71.8     1.5 3.3E-05   21.1   0.3   13   54-66     19-31  (50)
 79 COG3364 Zn-ribbon containing p  70.1     2.5 5.3E-05   23.9   0.9   12   54-65      3-14  (112)
 80 PRK00398 rpoP DNA-directed RNA  69.9    0.94   2E-05   21.5  -0.7   10   25-34      4-13  (46)
 81 PF10083 DUF2321:  Uncharacteri  69.3     3.3 7.1E-05   25.2   1.4   19   50-68     65-83  (158)
 82 PF12760 Zn_Tnp_IS1595:  Transp  69.3       5 0.00011   19.0   1.8   29   23-61     17-45  (46)
 83 KOG1146|consensus               68.1     2.7 5.8E-05   33.8   1.0   72   24-101  1260-1349(1406)
 84 smart00440 ZnF_C2C2 C2C2 Zinc   68.1     4.1 8.8E-05   18.8   1.3   12   52-63     27-38  (40)
 85 COG3357 Predicted transcriptio  67.9     1.7 3.7E-05   24.0  -0.0   12   53-64     58-69  (97)
 86 TIGR00244 transcriptional regu  67.9     4.4 9.6E-05   24.4   1.7   16   54-69     29-44  (147)
 87 PF02892 zf-BED:  BED zinc fing  67.8     6.5 0.00014   18.2   2.1   23   51-73     14-40  (45)
 88 COG1996 RPC10 DNA-directed RNA  66.9     1.9 4.1E-05   21.0   0.0   11   53-63      6-16  (49)
 89 PF07754 DUF1610:  Domain of un  66.4     2.7 5.9E-05   17.3   0.5    8   53-60     16-23  (24)
 90 COG1997 RPL43A Ribosomal prote  65.6     1.8 3.9E-05   23.7  -0.2   10   54-63     54-63  (89)
 91 PF14353 CpXC:  CpXC protein     65.5     2.6 5.7E-05   24.4   0.5   10   26-35      3-12  (128)
 92 PF04959 ARS2:  Arsenite-resist  65.4     2.8 6.1E-05   26.9   0.6   21   80-100    77-97  (214)
 93 COG1327 Predicted transcriptio  65.0     5.5 0.00012   24.2   1.8   16   53-68     28-43  (156)
 94 KOG4167|consensus               64.2     2.3 4.9E-05   32.2   0.0   26   52-77    791-816 (907)
 95 PF10571 UPF0547:  Uncharacteri  63.8       5 0.00011   16.7   1.0   13   23-35     13-25  (26)
 96 PF05443 ROS_MUCR:  ROS/MUCR tr  62.6     5.9 0.00013   23.5   1.6   25   51-78     70-94  (132)
 97 PLN02294 cytochrome c oxidase   62.4     3.6 7.8E-05   25.4   0.7   22   71-92    132-153 (174)
 98 PF03604 DNA_RNApol_7kD:  DNA d  62.0       3 6.5E-05   18.4   0.2    9   80-88     17-25  (32)
 99 smart00834 CxxC_CXXC_SSSS Puta  61.9     3.3 7.2E-05   18.7   0.4   11   81-91      6-16  (41)
100 PF15269 zf-C2H2_7:  Zinc-finge  61.0     3.9 8.4E-05   19.6   0.5   20   54-73     21-40  (54)
101 cd00924 Cyt_c_Oxidase_Vb Cytoc  60.2     3.9 8.5E-05   22.9   0.5   20   72-91     71-90  (97)
102 PF04959 ARS2:  Arsenite-resist  59.4     9.5 0.00021   24.5   2.2   25   51-75     75-99  (214)
103 PF09723 Zn-ribbon_8:  Zinc rib  58.6     3.9 8.4E-05   19.0   0.3   11   81-91      6-16  (42)
104 PF01096 TFIIS_C:  Transcriptio  58.6     2.4 5.1E-05   19.5  -0.5   12   52-63     27-38  (39)
105 KOG2785|consensus               57.4      13 0.00027   26.1   2.6   50   52-101   165-241 (390)
106 cd00730 rubredoxin Rubredoxin;  56.7      19 0.00041   17.5   2.6   13   25-37      2-14  (50)
107 TIGR00595 priA primosomal prot  56.7      11 0.00025   27.2   2.5   10   52-61    239-248 (505)
108 PF10537 WAC_Acf1_DNA_bd:  ATP-  56.0      21 0.00046   20.1   3.0   38   52-89      2-39  (102)
109 PF08790 zf-LYAR:  LYAR-type C2  55.5     3.3 7.2E-05   17.7  -0.2    8   83-90      3-10  (28)
110 smart00154 ZnF_AN1 AN1-like Zi  52.2     7.1 0.00015   17.9   0.6   14   80-93     12-25  (39)
111 KOG2593|consensus               52.1     9.9 0.00021   27.0   1.5   18   79-96    127-144 (436)
112 TIGR02605 CxxC_CxxC_SSSS putat  51.6     6.1 0.00013   19.0   0.3   11   81-91      6-16  (52)
113 PRK04023 DNA polymerase II lar  51.4      21 0.00045   28.4   3.1   11   23-33    625-635 (1121)
114 KOG4173|consensus               51.4     6.3 0.00014   25.3   0.5   46   55-100   108-166 (253)
115 PF07282 OrfB_Zn_ribbon:  Putat  51.3      18  0.0004   18.3   2.2   34   24-68     28-61  (69)
116 PHA02998 RNA polymerase subuni  51.0     9.9 0.00021   23.8   1.2   14   53-66    171-184 (195)
117 PF08274 PhnA_Zn_Ribbon:  PhnA   50.9     7.1 0.00015   16.9   0.5    9   53-61     19-27  (30)
118 PF01428 zf-AN1:  AN1-like Zinc  49.5       5 0.00011   18.7  -0.1   15   79-93     12-26  (43)
119 PRK00432 30S ribosomal protein  49.3      15 0.00032   17.9   1.5   10   53-62     37-46  (50)
120 PRK14873 primosome assembly pr  49.1      14  0.0003   27.8   2.0   46   24-89    383-431 (665)
121 PF01155 HypA:  Hydrogenase exp  48.8     9.6 0.00021   21.8   0.9   26   53-89     70-95  (113)
122 PRK03824 hypA hydrogenase nick  48.3     5.8 0.00013   23.5  -0.0   14   52-65     69-82  (135)
123 TIGR01562 FdhE formate dehydro  47.0      22 0.00048   24.2   2.5   10   24-33    184-193 (305)
124 COG4306 Uncharacterized protei  46.1      19  0.0004   21.3   1.8   17   51-67     66-82  (160)
125 KOG2907|consensus               45.2     8.2 0.00018   22.2   0.3   37   54-92     75-114 (116)
126 COG1594 RPB9 DNA-directed RNA   44.6      13 0.00029   21.3   1.1   13   79-91     99-111 (113)
127 COG4530 Uncharacterized protei  44.5      15 0.00032   21.2   1.2   13   51-63     24-36  (129)
128 PF10013 DUF2256:  Uncharacteri  43.5      13 0.00029   17.4   0.8   12   82-93     10-21  (42)
129 PTZ00255 60S ribosomal protein  43.4     4.3 9.3E-05   22.4  -1.0   10   54-63     55-64  (90)
130 PF09963 DUF2197:  Uncharacteri  43.4     6.8 0.00015   19.7  -0.2    7   54-60     32-38  (56)
131 PF13451 zf-trcl:  Probable zin  42.5     8.9 0.00019   18.7   0.1   15   79-93      3-17  (49)
132 PF10071 DUF2310:  Zn-ribbon-co  42.4      34 0.00073   22.8   2.8   51    4-62    198-250 (258)
133 PF13878 zf-C2H2_3:  zinc-finge  41.5      34 0.00074   15.7   2.0   24   54-77     14-39  (41)
134 PF11672 DUF3268:  Protein of u  41.5      36 0.00078   19.3   2.5   37   24-60      2-38  (102)
135 PRK12496 hypothetical protein;  41.2      15 0.00033   22.4   1.0   29   52-91    126-154 (164)
136 COG3091 SprT Zn-dependent meta  41.2      12 0.00027   22.7   0.6   34   52-89    116-149 (156)
137 PF12013 DUF3505:  Protein of u  41.1      31 0.00066   19.3   2.2   24   54-77     81-108 (109)
138 PTZ00043 cytochrome c oxidase   41.0      13 0.00028   24.2   0.7   18   75-92    176-193 (268)
139 KOG2071|consensus               40.9      19 0.00042   26.6   1.6   27   51-77    416-442 (579)
140 smart00661 RPOL9 RNA polymeras  40.4      36 0.00078   16.0   2.2   12   53-64     20-31  (52)
141 PRK05580 primosome assembly pr  40.4      29 0.00063   26.2   2.5    8   53-60    408-415 (679)
142 PRK12380 hydrogenase nickel in  40.1      14  0.0003   21.2   0.7   25   53-88     70-94  (113)
143 COG1656 Uncharacterized conser  39.4      30 0.00064   21.4   2.0   20   53-72    130-149 (165)
144 PF04423 Rad50_zn_hook:  Rad50   39.2      11 0.00024   18.4   0.2   12   82-93     22-33  (54)
145 KOG3408|consensus               39.2      12 0.00025   21.9   0.3   23   51-73     55-77  (129)
146 TIGR00622 ssl1 transcription f  39.1      52  0.0011   19.0   2.9   12   80-91     81-92  (112)
147 PLN02748 tRNA dimethylallyltra  39.0      18 0.00038   26.1   1.2   22   79-100   417-439 (468)
148 PRK00564 hypA hydrogenase nick  37.9      16 0.00035   21.0   0.7   26   53-89     71-97  (117)
149 KOG2636|consensus               37.8      22 0.00047   25.6   1.4   25   75-99    395-421 (497)
150 PF02176 zf-TRAF:  TRAF-type zi  37.5      17 0.00037   17.7   0.7   39   52-91      8-53  (60)
151 PF01215 COX5B:  Cytochrome c o  37.0     9.9 0.00021   22.7  -0.2   18   74-91    106-123 (136)
152 PF10263 SprT-like:  SprT-like   37.0     7.1 0.00015   23.2  -0.9   33   52-91    122-154 (157)
153 TIGR00280 L37a ribosomal prote  36.3     4.9 0.00011   22.2  -1.5   10   54-63     54-63  (91)
154 TIGR00143 hypF [NiFe] hydrogen  36.1      16 0.00034   27.8   0.6   59   26-90     92-150 (711)
155 PRK03564 formate dehydrogenase  36.1      42 0.00092   22.9   2.6   11   23-33    186-196 (309)
156 TIGR01206 lysW lysine biosynth  36.0      35 0.00075   16.9   1.6   10   25-34      3-12  (54)
157 TIGR01384 TFS_arch transcripti  35.3      25 0.00054   19.5   1.2   13   79-91     89-101 (104)
158 PRK05978 hypothetical protein;  34.5      37  0.0008   20.6   1.9   11   24-34     33-43  (148)
159 PF01363 FYVE:  FYVE zinc finge  34.2      25 0.00054   17.8   1.1   12   52-63     24-35  (69)
160 KOG2482|consensus               34.1      27 0.00059   24.3   1.4   23   53-75    195-217 (423)
161 TIGR00100 hypA hydrogenase nic  33.5      21 0.00045   20.5   0.7   26   53-89     70-95  (115)
162 TIGR00515 accD acetyl-CoA carb  33.3      30 0.00065   23.3   1.5   30   54-91     27-56  (285)
163 PF01286 XPA_N:  XPA protein N-  33.1      18 0.00038   16.2   0.3   11   82-92      5-15  (34)
164 PF14803 Nudix_N_2:  Nudix N-te  32.9      16 0.00035   16.2   0.2   11   51-61     20-30  (34)
165 COG4888 Uncharacterized Zn rib  32.8     2.9 6.2E-05   23.6  -2.8    9   52-60     21-29  (104)
166 COG4957 Predicted transcriptio  32.5      21 0.00046   21.3   0.7   24   52-78     75-98  (148)
167 TIGR02159 PA_CoA_Oxy4 phenylac  32.2      15 0.00032   22.1  -0.0    9   25-33    106-114 (146)
168 KOG3497|consensus               32.1      22 0.00047   18.2   0.6   15   80-94      4-18  (69)
169 PF07975 C1_4:  TFIIH C1-like d  31.7     7.2 0.00016   19.1  -1.2   27   51-77     19-45  (51)
170 KOG0717|consensus               31.1      23  0.0005   25.6   0.7   20   81-100   293-312 (508)
171 COG1675 TFA1 Transcription ini  30.8      44 0.00094   20.9   1.8   30   52-89    112-141 (176)
172 COG4338 Uncharacterized protei  30.6      16 0.00034   17.8  -0.1   12   82-93     14-25  (54)
173 COG3677 Transposase and inacti  30.1      22 0.00048   20.9   0.5   12   80-91     53-64  (129)
174 TIGR01385 TFSII transcription   30.1      44 0.00095   22.7   1.9   41   22-63    256-296 (299)
175 COG0675 Transposase and inacti  30.0      50  0.0011   21.8   2.2   32   23-70    308-339 (364)
176 PRK03681 hypA hydrogenase nick  29.6      25 0.00055   20.1   0.6   27   53-89     70-96  (114)
177 CHL00174 accD acetyl-CoA carbo  29.6      39 0.00085   22.9   1.6   32   53-92     38-69  (296)
178 PF01194 RNA_pol_N:  RNA polyme  29.4      34 0.00074   17.4   1.0   14   80-93      4-17  (60)
179 TIGR00686 phnA alkylphosphonat  28.7      51  0.0011   18.9   1.7   12   24-35     19-30  (109)
180 cd00065 FYVE FYVE domain; Zinc  28.6      32 0.00069   16.5   0.8   27   26-65      4-30  (57)
181 PF04780 DUF629:  Protein of un  28.6      52  0.0011   23.9   2.1   29   50-78     54-83  (466)
182 PRK03976 rpl37ae 50S ribosomal  28.5     8.6 0.00019   21.3  -1.3   10   54-63     55-64  (90)
183 PF06397 Desulfoferrod_N:  Desu  28.1      23 0.00049   16.1   0.2   11   79-89      5-15  (36)
184 PF07503 zf-HYPF:  HypF finger;  28.0     5.4 0.00012   17.9  -1.9   12   80-91     21-32  (35)
185 PF06524 NOA36:  NOA36 protein;  27.7      20 0.00043   24.0  -0.0   11   79-89    208-218 (314)
186 KOG3507|consensus               27.0      36 0.00078   17.3   0.8   13   51-63     35-47  (62)
187 smart00064 FYVE Protein presen  26.9      36 0.00078   17.1   0.9   28   25-65     11-38  (68)
188 PF13453 zf-TFIIB:  Transcripti  26.6      76  0.0017   14.3   2.2   20   52-71     18-37  (41)
189 PRK04351 hypothetical protein;  26.0      24 0.00052   21.3   0.1   35   52-93    111-145 (149)
190 PRK05654 acetyl-CoA carboxylas  25.8      46   0.001   22.5   1.4   30   54-91     28-57  (292)
191 PF13824 zf-Mss51:  Zinc-finger  25.8      49  0.0011   16.5   1.2   12   51-62     12-23  (55)
192 PRK14559 putative protein seri  25.5      91   0.002   23.7   3.0   11   24-34     15-25  (645)
193 COG1773 Rubredoxin [Energy pro  25.0      31 0.00068   17.2   0.4   10   81-90      4-13  (55)
194 PF12156 ATPase-cat_bd:  Putati  24.6      50  0.0011   17.9   1.2   35   26-63      2-36  (88)
195 PRK14714 DNA polymerase II lar  24.5   2E+02  0.0044   24.0   4.7   10   53-62    692-701 (1337)
196 PF11931 DUF3449:  Domain of un  24.3      25 0.00055   22.3   0.0    9   79-87    100-108 (196)
197 PF10621 FpoO:  F420H2 dehydrog  24.3      39 0.00084   19.5   0.7   60   27-89      4-69  (119)
198 PRK08222 hydrogenase 4 subunit  24.2      50  0.0011   20.5   1.3   18   79-96    113-130 (181)
199 KOG0978|consensus               24.1      35 0.00077   26.0   0.7   21   79-99    677-697 (698)
200 smart00731 SprT SprT homologue  24.0      30 0.00066   20.5   0.3   32   53-91    112-144 (146)
201 PF10276 zf-CHCC:  Zinc-finger   23.9      27 0.00058   16.2   0.0   10   53-62     29-38  (40)
202 PRK10220 hypothetical protein;  23.3 1.1E+02  0.0025   17.6   2.5   14   24-37     20-33  (111)
203 PF14311 DUF4379:  Domain of un  23.1      65  0.0014   15.6   1.4   15   53-67     28-42  (55)
204 PF14369 zf-RING_3:  zinc-finge  22.6      49  0.0011   14.7   0.8   10   26-35     23-32  (35)
205 PF00301 Rubredoxin:  Rubredoxi  22.6      33 0.00072   16.4   0.2   10   81-90      2-11  (47)
206 PF04606 Ogr_Delta:  Ogr/Delta-  22.4      30 0.00064   16.4   0.0    8   27-34      2-9   (47)
207 KOG1280|consensus               22.3      78  0.0017   22.2   2.0   37   51-87     77-116 (381)
208 KOG0782|consensus               22.2      23 0.00049   26.6  -0.6   17   24-40    253-269 (1004)
209 PRK04016 DNA-directed RNA poly  21.7      42 0.00091   17.2   0.5   13   80-92      4-16  (62)
210 COG2331 Uncharacterized protei  21.6      29 0.00064   18.6  -0.1   11   80-90     12-22  (82)
211 KOG4124|consensus               21.3      18 0.00039   25.2  -1.1   21   79-99    397-417 (442)
212 PF05191 ADK_lid:  Adenylate ki  21.2      34 0.00073   15.4   0.1    9   82-90      3-11  (36)
213 PF14690 zf-ISL3:  zinc-finger   20.6      54  0.0012   15.0   0.8   10   80-89      2-11  (47)
214 PRK06260 threonine synthase; V  20.6      54  0.0012   22.9   1.0   25   25-62      4-28  (397)
215 PF12773 DZR:  Double zinc ribb  20.5      98  0.0021   14.4   1.7    6   82-87     31-36  (50)
216 PF14787 zf-CCHC_5:  GAG-polypr  20.0      50  0.0011   15.0   0.5   14   82-95      4-17  (36)

No 1  
>KOG2462|consensus
Probab=99.82  E-value=4.6e-21  Score=121.90  Aligned_cols=76  Identities=25%  Similarity=0.394  Sum_probs=73.6

Q ss_pred             CCCCCCCCCCCccCCCCCCCCCCCCCCCcceecccchhhcCCHHHHHHHHHhhCC-CCcccccCccccCChHHHhccc
Q psy11364         24 PLSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQLSNQYNLRVHMETHQN-AFYACSSCSHVSRSRDALRKHD  100 (101)
Q Consensus        24 ~~~c~~c~~~~~~~~~~~~~~~~~~~~~~~~~C~~c~~~~~~~~~l~~h~~~h~~-kp~~C~~C~k~f~~~~~l~~H~  100 (101)
                      +++|.+||+.|..+.-|+.|.+.+. +|+||.|..|+++|..+++|+.||++|.+ |+|.|..|+|.|...+.|.+|.
T Consensus       187 ~c~C~iCGKaFSRPWLLQGHiRTHT-GEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~  263 (279)
T KOG2462|consen  187 PCECGICGKAFSRPWLLQGHIRTHT-GEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHS  263 (279)
T ss_pred             CcccccccccccchHHhhccccccc-CCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhh
Confidence            8999999999999999999999988 69999999999999999999999999999 9999999999999999999985


No 2  
>KOG2462|consensus
Probab=99.68  E-value=8.5e-18  Score=107.15  Aligned_cols=76  Identities=24%  Similarity=0.416  Sum_probs=67.1

Q ss_pred             CCCCCCCCCCCCccCCCCCCCCCCCCCCCcceecccchhhcCCHHHHHHHHHhhCC-CCcccccCccccCChHHHhcccC
Q psy11364         23 SPLSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQLSNQYNLRVHMETHQN-AFYACSSCSHVSRSRDALRKHDK  101 (101)
Q Consensus        23 ~~~~c~~c~~~~~~~~~~~~~~~~~~~~~~~~~C~~c~~~~~~~~~l~~h~~~h~~-kp~~C~~C~k~f~~~~~l~~H~~  101 (101)
                      ..+.|+.||+.+.....+..|++.+.   -+++|..|||+|..+.-|+.|+|.|+| |||.|..|+|+|.-+++|..||+
T Consensus       160 ka~~C~~C~K~YvSmpALkMHirTH~---l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQ  236 (279)
T KOG2462|consen  160 KAFSCKYCGKVYVSMPALKMHIRTHT---LPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQ  236 (279)
T ss_pred             ccccCCCCCceeeehHHHhhHhhccC---CCcccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHH
Confidence            36778888888777777777877654   478999999999999999999999999 99999999999999999999974


No 3  
>KOG3623|consensus
Probab=99.55  E-value=2.3e-16  Score=111.27  Aligned_cols=76  Identities=14%  Similarity=0.235  Sum_probs=70.7

Q ss_pred             CCCCCCCCCCCccCCCCCCCCCCCCCCCcceecccchhhcCCHHHHHHHHHhhCC-CCcccccCccccCChHHHhccc
Q psy11364         24 PLSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQLSNQYNLRVHMETHQN-AFYACSSCSHVSRSRDALRKHD  100 (101)
Q Consensus        24 ~~~c~~c~~~~~~~~~~~~~~~~~~~~~~~~~C~~c~~~~~~~~~l~~h~~~h~~-kp~~C~~C~k~f~~~~~l~~H~  100 (101)
                      .|.|+.|.+.|.-.++|..|.=-+. +.|||.|..|.|+|..+-.|..|+|+|.| |||.|+.|+|+|+...+..+||
T Consensus       894 myaCDqCDK~FqKqSSLaRHKYEHs-GqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKPfQCdKClKRFSHSGSYSQHM  970 (1007)
T KOG3623|consen  894 MYACDQCDKAFQKQSSLARHKYEHS-GQRPYQCIICKKAFKHKHHLTEHKRLHSGEKPFQCDKCLKRFSHSGSYSQHM  970 (1007)
T ss_pred             cchHHHHHHHHHhhHHHHHhhhhhc-CCCCcccchhhHhhhhhhhhhhhhhhccCCCcchhhhhhhhcccccchHhhh
Confidence            8999999999999999877755444 69999999999999999999999999999 9999999999999999999997


No 4  
>KOG3576|consensus
Probab=99.46  E-value=8.8e-16  Score=94.62  Aligned_cols=78  Identities=21%  Similarity=0.343  Sum_probs=69.4

Q ss_pred             CCCCCCCCCCCCCccCCCCCCCCCCCCCCCcceecccchhhcCCHHHHHHHHHhhCC-CCcccccCccccCChHHHhccc
Q psy11364         22 TSPLSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQLSNQYNLRVHMETHQN-AFYACSSCSHVSRSRDALRKHD  100 (101)
Q Consensus        22 ~~~~~c~~c~~~~~~~~~~~~~~~~~~~~~~~~~C~~c~~~~~~~~~l~~h~~~h~~-kp~~C~~C~k~f~~~~~l~~H~  100 (101)
                      .+.+.|..||+.|.-+.-+..|..-+.. -+.|.|..|||.|.....|++|++.|+| +||+|..|+|+|.+.-+|..|+
T Consensus       115 ~d~ftCrvCgK~F~lQRmlnrh~kch~~-vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsleshl  193 (267)
T KOG3576|consen  115 QDSFTCRVCGKKFGLQRMLNRHLKCHSD-VKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHL  193 (267)
T ss_pred             CCeeeeehhhhhhhHHHHHHHHhhhccH-HHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHHH
Confidence            3589999999999888777777776654 6679999999999999999999999999 9999999999999998887775


No 5  
>KOG3623|consensus
Probab=99.36  E-value=4.4e-14  Score=100.00  Aligned_cols=78  Identities=14%  Similarity=0.206  Sum_probs=62.9

Q ss_pred             CCCCCCCCCCCCccCCCCCCCCCCC------------CCCCcceecccchhhcCCHHHHHHHHHhhCC-CCcccccCccc
Q psy11364         23 SPLSSSIPGSSKTKASGSGTTGGSS------------NHSKLFATCFVCGKQLSNQYNLRVHMETHQN-AFYACSSCSHV   89 (101)
Q Consensus        23 ~~~~c~~c~~~~~~~~~~~~~~~~~------------~~~~~~~~C~~c~~~~~~~~~l~~h~~~h~~-kp~~C~~C~k~   89 (101)
                      ..+.|..|...|.....+..|..++            ....|.|+|.+|+|+|..+-.|+.|+|+|.| |||+|+.|+|+
T Consensus       239 ~nfsC~lCsytFAyRtQLErhm~~hkpg~dqa~sltqsa~lRKFKCtECgKAFKfKHHLKEHlRIHSGEKPfeCpnCkKR  318 (1007)
T KOG3623|consen  239 PNFSCMLCSYTFAYRTQLERHMQLHKPGGDQAISLTQSALLRKFKCTECGKAFKFKHHLKEHLRIHSGEKPFECPNCKKR  318 (1007)
T ss_pred             CCCcchhhhhhhhhHHHHHHHHHhhcCCCcccccccchhhhccccccccchhhhhHHHHHhhheeecCCCCcCCcccccc
Confidence            4788999999886555443221111            1123679999999999999999999999999 99999999999


Q ss_pred             cCChHHHhccc
Q psy11364         90 SRSRDALRKHD  100 (101)
Q Consensus        90 f~~~~~l~~H~  100 (101)
                      |+...+...||
T Consensus       319 FSHSGSySSHm  329 (1007)
T KOG3623|consen  319 FSHSGSYSSHM  329 (1007)
T ss_pred             cccCCcccccc
Confidence            99999988886


No 6  
>PHA02768 hypothetical protein; Provisional
Probab=99.24  E-value=3.6e-12  Score=63.50  Aligned_cols=43  Identities=19%  Similarity=0.411  Sum_probs=40.5

Q ss_pred             eecccchhhcCCHHHHHHHHHhhCCCCcccccCccccCChHHHh
Q psy11364         54 ATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHVSRSRDALR   97 (101)
Q Consensus        54 ~~C~~c~~~~~~~~~l~~h~~~h~~kp~~C~~C~k~f~~~~~l~   97 (101)
                      |.|+.||+.|....+|..|++.|+ +|+.|..|++.|.+.+.|+
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~-k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHN-TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcC-CcccCCcccceecccceeE
Confidence            789999999999999999999999 8999999999999888775


No 7  
>PHA00733 hypothetical protein
Probab=99.09  E-value=2.2e-11  Score=71.29  Aligned_cols=78  Identities=14%  Similarity=0.169  Sum_probs=62.8

Q ss_pred             CCCCCCCCCCCCCccCCCCCCC----CCCCCCCCcceecccchhhcCCHHHHHHHHHhhCCCCcccccCccccCChHHHh
Q psy11364         22 TSPLSSSIPGSSKTKASGSGTT----GGSSNHSKLFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHVSRSRDALR   97 (101)
Q Consensus        22 ~~~~~c~~c~~~~~~~~~~~~~----~~~~~~~~~~~~C~~c~~~~~~~~~l~~h~~~h~~kp~~C~~C~k~f~~~~~l~   97 (101)
                      +.++.|.+|.+.+.....+..+    ........++|.|..|++.|.....|..|++.+. .+|.|..|++.|.....|.
T Consensus        38 ~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h~-~~~~C~~CgK~F~~~~sL~  116 (128)
T PHA00733         38 QKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYTE-HSKVCPVCGKEFRNTDSTL  116 (128)
T ss_pred             hhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcCC-cCccCCCCCCccCCHHHHH
Confidence            3588899998887766555443    1123334789999999999999999999998764 6899999999999999999


Q ss_pred             ccc
Q psy11364         98 KHD  100 (101)
Q Consensus        98 ~H~  100 (101)
                      .|+
T Consensus       117 ~H~  119 (128)
T PHA00733        117 DHV  119 (128)
T ss_pred             HHH
Confidence            886


No 8  
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.95  E-value=6.2e-10  Score=47.74  Aligned_cols=25  Identities=40%  Similarity=0.703  Sum_probs=22.8

Q ss_pred             HHHHHHHhhCC-CCcccccCccccCC
Q psy11364         68 NLRVHMETHQN-AFYACSSCSHVSRS   92 (101)
Q Consensus        68 ~l~~h~~~h~~-kp~~C~~C~k~f~~   92 (101)
                      +|..|+++|++ +||.|+.|+++|.+
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEESS
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeCc
Confidence            47899999999 99999999999963


No 9  
>KOG1074|consensus
Probab=98.95  E-value=1.2e-10  Score=83.79  Aligned_cols=80  Identities=20%  Similarity=0.316  Sum_probs=65.5

Q ss_pred             CCCCCCCCCCCCCCccCCCCCCCCCCCCCCCcceecccchhhcCCHHHHHHHHHhhCC-----CCcccc---cCccccCC
Q psy11364         21 LTSPLSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQLSNQYNLRVHMETHQN-----AFYACS---SCSHVSRS   92 (101)
Q Consensus        21 ~~~~~~c~~c~~~~~~~~~~~~~~~~~~~~~~~~~C~~c~~~~~~~~~l~~h~~~h~~-----kp~~C~---~C~k~f~~   92 (101)
                      .++|.+|.+|-+....++.|..|-+.+. ++|||+|..||++|.++.+|+.|+.+|-.     .++.|+   +|.+.|..
T Consensus       602 ~TdPNqCiiC~rVlSC~saLqmHyrtHt-GERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~ic~~kftn  680 (958)
T KOG1074|consen  602 RTDPNQCIICLRVLSCPSALQMHYRTHT-GERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTFICQKKFTN  680 (958)
T ss_pred             cCCccceeeeeecccchhhhhhhhhccc-CcCccccccccchhccccchhhcccccccCccccccccCCchhhhcccccc
Confidence            3568889999988888888888888877 58899999999999999999999888864     367788   88888888


Q ss_pred             hHHHhcccC
Q psy11364         93 RDALRKHDK  101 (101)
Q Consensus        93 ~~~l~~H~~  101 (101)
                      .-.|.+|++
T Consensus       681 ~V~lpQhIr  689 (958)
T KOG1074|consen  681 AVTLPQHIR  689 (958)
T ss_pred             cccccceEE
Confidence            777777753


No 10 
>KOG3576|consensus
Probab=98.91  E-value=2.9e-10  Score=70.53  Aligned_cols=76  Identities=16%  Similarity=0.294  Sum_probs=63.8

Q ss_pred             CCCCCCCCCCCccCCCCCCCCCCCCCCCcceecccchhhcCCHHHHHHHHH-hhC----------C-CCcccccCccccC
Q psy11364         24 PLSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQLSNQYNLRVHME-THQ----------N-AFYACSSCSHVSR   91 (101)
Q Consensus        24 ~~~c~~c~~~~~~~~~~~~~~~~~~~~~~~~~C~~c~~~~~~~~~l~~h~~-~h~----------~-kp~~C~~C~k~f~   91 (101)
                      .+.|..||++|.+.-.+..|.+.+. +-+||+|..|+|+|.++..|..|.+ +|.          . |-|.|+.||..-.
T Consensus       145 r~lct~cgkgfndtfdlkrh~rtht-gvrpykc~~c~kaftqrcsleshl~kvhgv~~~yaykerr~kl~vcedcg~t~~  223 (267)
T KOG3576|consen  145 RHLCTFCGKGFNDTFDLKRHTRTHT-GVRPYKCSLCEKAFTQRCSLESHLKKVHGVQHQYAYKERRAKLYVCEDCGYTSE  223 (267)
T ss_pred             HHHHhhccCcccchhhhhhhhcccc-CccccchhhhhHHHHhhccHHHHHHHHcCchHHHHHHHhhhheeeecccCCCCC
Confidence            6789999999999999999999887 5899999999999999999999976 454          3 7899999998766


Q ss_pred             ChHHHhccc
Q psy11364         92 SRDALRKHD  100 (101)
Q Consensus        92 ~~~~l~~H~  100 (101)
                      ....+..|+
T Consensus       224 ~~e~~~~h~  232 (267)
T KOG3576|consen  224 RPEVYYLHL  232 (267)
T ss_pred             ChhHHHHHH
Confidence            665554443


No 11 
>KOG1074|consensus
Probab=98.85  E-value=9.1e-10  Score=79.45  Aligned_cols=49  Identities=24%  Similarity=0.497  Sum_probs=46.7

Q ss_pred             cceecccchhhcCCHHHHHHHHHhhCC-CCcccccCccccCChHHHhccc
Q psy11364         52 LFATCFVCGKQLSNQYNLRVHMETHQN-AFYACSSCSHVSRSRDALRKHD  100 (101)
Q Consensus        52 ~~~~C~~c~~~~~~~~~l~~h~~~h~~-kp~~C~~C~k~f~~~~~l~~H~  100 (101)
                      .|-.|..|.++...++.|+-|.|.|+| +||+|++||++|.++.+|..|+
T Consensus       604 dPNqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~  653 (958)
T KOG1074|consen  604 DPNQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHM  653 (958)
T ss_pred             CccceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcc
Confidence            467899999999999999999999999 9999999999999999999986


No 12 
>KOG3608|consensus
Probab=98.59  E-value=1.5e-09  Score=72.15  Aligned_cols=75  Identities=15%  Similarity=0.177  Sum_probs=48.8

Q ss_pred             CCCCCCCCCCCCccCCCCCCCCCCCCCCCcceecccchhhcCCHHHHHHHHHh-hCC-CCcccccCccccCChHHHhccc
Q psy11364         23 SPLSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQLSNQYNLRVHMET-HQN-AFYACSSCSHVSRSRDALRKHD  100 (101)
Q Consensus        23 ~~~~c~~c~~~~~~~~~~~~~~~~~~~~~~~~~C~~c~~~~~~~~~l~~h~~~-h~~-kp~~C~~C~k~f~~~~~l~~H~  100 (101)
                      .+|+|..|-+.|.++..+..|...+   -+-|+|+.|......++.|.+|++. |.. |||+|+.|++.|.+.+.|.+|.
T Consensus       236 n~fqC~~C~KrFaTeklL~~Hv~rH---vn~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~  312 (467)
T KOG3608|consen  236 NSFQCAQCFKRFATEKLLKSHVVRH---VNCYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHV  312 (467)
T ss_pred             CchHHHHHHHHHhHHHHHHHHHHHh---hhcccccccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHH
Confidence            3566666666665555555444332   2346667777667777777777664 555 7888888888888888887774


No 13 
>PHA00732 hypothetical protein
Probab=98.51  E-value=8.5e-08  Score=51.65  Aligned_cols=38  Identities=24%  Similarity=0.600  Sum_probs=27.9

Q ss_pred             ceecccchhhcCCHHHHHHHHHh-hCCCCcccccCccccCC
Q psy11364         53 FATCFVCGKQLSNQYNLRVHMET-HQNAFYACSSCSHVSRS   92 (101)
Q Consensus        53 ~~~C~~c~~~~~~~~~l~~h~~~-h~~kp~~C~~C~k~f~~   92 (101)
                      ||.|..|++.|.....|..|++. |.  ++.|+.||+.|.+
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~--~~~C~~CgKsF~~   39 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT--LTKCPVCNKSYRR   39 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC--CCccCCCCCEeCC
Confidence            46788888888888888888763 54  4568888888774


No 14 
>PHA00616 hypothetical protein
Probab=98.46  E-value=1.2e-07  Score=45.17  Aligned_cols=33  Identities=12%  Similarity=0.281  Sum_probs=30.8

Q ss_pred             ceecccchhhcCCHHHHHHHHHhhCC-CCccccc
Q psy11364         53 FATCFVCGKQLSNQYNLRVHMETHQN-AFYACSS   85 (101)
Q Consensus        53 ~~~C~~c~~~~~~~~~l~~h~~~h~~-kp~~C~~   85 (101)
                      ||.|..||+.|.....+..|++.|++ +|+.|+.
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~~   34 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLEY   34 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCccceeE
Confidence            58999999999999999999999999 9998875


No 15 
>KOG3608|consensus
Probab=98.41  E-value=5e-08  Score=65.07  Aligned_cols=54  Identities=15%  Similarity=0.134  Sum_probs=40.3

Q ss_pred             CCCCCCCCCCCccCCCCCCCCCCCCCCCcceecccchhhcCCHHHHHHHHHhhC
Q psy11364         24 PLSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQLSNQYNLRVHMETHQ   77 (101)
Q Consensus        24 ~~~c~~c~~~~~~~~~~~~~~~~~~~~~~~~~C~~c~~~~~~~~~l~~h~~~h~   77 (101)
                      .|.|+.|.-+-...+++..|.+..+...+||+|..|.+.+...+.|+.|..+|.
T Consensus       263 ~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS  316 (467)
T KOG3608|consen  263 CYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHS  316 (467)
T ss_pred             cccccccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhcc
Confidence            677777777777777777777666666777888888887777777777777766


No 16 
>KOG3993|consensus
Probab=98.32  E-value=3e-08  Score=67.25  Aligned_cols=76  Identities=21%  Similarity=0.298  Sum_probs=58.4

Q ss_pred             CCCCCCCCCCCccCCCCCCCCCCCCCCCcceecccchhhcCCHHHHHHHHHhhC--------C-C---------------
Q psy11364         24 PLSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQLSNQYNLRVHMETHQ--------N-A---------------   79 (101)
Q Consensus        24 ~~~c~~c~~~~~~~~~~~~~~~~~~~~~~~~~C~~c~~~~~~~~~l~~h~~~h~--------~-k---------------   79 (101)
                      -|.|..|-..+-+.-.|.+|.=... -..-|.|.+|+|+|....+|..|.|+|-        + .               
T Consensus       267 dyiCqLCK~kYeD~F~LAQHrC~RI-V~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea  345 (500)
T KOG3993|consen  267 DYICQLCKEKYEDAFALAQHRCPRI-VHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEA  345 (500)
T ss_pred             HHHHHHHHHhhhhHHHHhhccCCee-EEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhc
Confidence            5677777777777767766642211 1234899999999999999999999984        1 2               


Q ss_pred             ----------CcccccCccccCChHHHhccc
Q psy11364         80 ----------FYACSSCSHVSRSRDALRKHD  100 (101)
Q Consensus        80 ----------p~~C~~C~k~f~~~~~l~~H~  100 (101)
                                -|.|..|+|.|.+...|..|+
T Consensus       346 ~rsg~dss~gi~~C~~C~KkFrRqAYLrKHq  376 (500)
T KOG3993|consen  346 ERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQ  376 (500)
T ss_pred             cccCCcccCceeecHHhhhhhHHHHHHHHhH
Confidence                      378999999999999999984


No 17 
>PHA02768 hypothetical protein; Provisional
Probab=98.22  E-value=4.3e-08  Score=48.89  Aligned_cols=44  Identities=14%  Similarity=-0.074  Sum_probs=38.2

Q ss_pred             CCCCCCCCCCCccCCCCCCCCCCCCCCCcceecccchhhcCCHHHHH
Q psy11364         24 PLSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQLSNQYNLR   70 (101)
Q Consensus        24 ~~~c~~c~~~~~~~~~~~~~~~~~~~~~~~~~C~~c~~~~~~~~~l~   70 (101)
                      .|.|+.||+.|...+.+..|.+++.   ++++|..|++.|...+.|.
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~---k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN---TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC---CcccCCcccceecccceeE
Confidence            5899999999999999999998865   5889999999998776653


No 18 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.15  E-value=6.5e-07  Score=63.42  Aligned_cols=61  Identities=13%  Similarity=0.188  Sum_probs=28.1

Q ss_pred             CCCCCCCCCCCccCCCCCCCCCCCCCCCcceecccchhhcCCHHHHHHHHHhhCC-CCcccccCcccc
Q psy11364         24 PLSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQLSNQYNLRVHMETHQN-AFYACSSCSHVS   90 (101)
Q Consensus        24 ~~~c~~c~~~~~~~~~~~~~~~~~~~~~~~~~C~~c~~~~~~~~~l~~h~~~h~~-kp~~C~~C~k~f   90 (101)
                      .+.|+.|++.|. .+.+..|..+.+   .++.|+ |++.+ .+..|..|+..|.. +|+.|..|++.+
T Consensus       453 H~~C~~Cgk~f~-~s~LekH~~~~H---kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v  514 (567)
T PLN03086        453 HVHCEKCGQAFQ-QGEMEKHMKVFH---EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMV  514 (567)
T ss_pred             CccCCCCCCccc-hHHHHHHHHhcC---CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCcc
Confidence            445555555553 233333333321   344554 55432 33445555555554 555555555544


No 19 
>PHA00733 hypothetical protein
Probab=98.05  E-value=2.2e-06  Score=50.24  Aligned_cols=52  Identities=17%  Similarity=0.175  Sum_probs=44.4

Q ss_pred             CCCCCCCCCCCCccCCCCCCCCCCCCCCCcceecccchhhcCCHHHHHHHHHhhC
Q psy11364         23 SPLSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQLSNQYNLRVHMETHQ   77 (101)
Q Consensus        23 ~~~~c~~c~~~~~~~~~~~~~~~~~~~~~~~~~C~~c~~~~~~~~~l~~h~~~h~   77 (101)
                      .|+.|+.||+.|...+.+..|...+   ..++.|..|++.|.....|..|+....
T Consensus        72 kPy~C~~Cgk~Fss~s~L~~H~r~h---~~~~~C~~CgK~F~~~~sL~~H~~~~h  123 (128)
T PHA00733         72 SPYVCPLCLMPFSSSVSLKQHIRYT---EHSKVCPVCGKEFRNTDSTLDHVCKKH  123 (128)
T ss_pred             CCccCCCCCCcCCCHHHHHHHHhcC---CcCccCCCCCCccCCHHHHHHHHHHhc
Confidence            4899999999999999888777653   346899999999999999999987543


No 20 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.00  E-value=4.3e-06  Score=59.39  Aligned_cols=69  Identities=17%  Similarity=0.271  Sum_probs=53.8

Q ss_pred             CCCCCCCCCCCCccCCCCCCCCCCCCCCCcceecccchhhcCC----------HHHHHHHHHhhCCCCcccccCccccCC
Q psy11364         23 SPLSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQLSN----------QYNLRVHMETHQNAFYACSSCSHVSRS   92 (101)
Q Consensus        23 ~~~~c~~c~~~~~~~~~~~~~~~~~~~~~~~~~C~~c~~~~~~----------~~~l~~h~~~h~~kp~~C~~C~k~f~~   92 (101)
                      .++.|+ ||..+ ....+..|...+.. .+++.|..|++.+..          ...|..|......+++.|..||+.+..
T Consensus       477 kpv~Cp-Cg~~~-~R~~L~~H~~thCp-~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~CG~rt~~C~~Cgk~Vrl  553 (567)
T PLN03086        477 EPLQCP-CGVVL-EKEQMVQHQASTCP-LRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESICGSRTAPCDSCGRSVML  553 (567)
T ss_pred             CCccCC-CCCCc-chhHHHhhhhccCC-CCceeCCCCCCccccCccccchhhhhhhHHHHHHhcCCcceEccccCCeeee
Confidence            478999 99755 45667778776654 789999999998852          357999998873399999999998876


Q ss_pred             hH
Q psy11364         93 RD   94 (101)
Q Consensus        93 ~~   94 (101)
                      +.
T Consensus       554 rd  555 (567)
T PLN03086        554 KE  555 (567)
T ss_pred             hh
Confidence            53


No 21 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.00  E-value=6.3e-06  Score=33.86  Aligned_cols=23  Identities=43%  Similarity=0.868  Sum_probs=15.2

Q ss_pred             eecccchhhcCCHHHHHHHHHhh
Q psy11364         54 ATCFVCGKQLSNQYNLRVHMETH   76 (101)
Q Consensus        54 ~~C~~c~~~~~~~~~l~~h~~~h   76 (101)
                      |.|+.|++.|..+..|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            45667777777777777776653


No 22 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.92  E-value=4e-06  Score=55.49  Aligned_cols=51  Identities=29%  Similarity=0.503  Sum_probs=43.2

Q ss_pred             Ccceecc--cchhhcCCHHHHHHHHHh-h------------------CC-CCcccccCccccCChHHHhcccC
Q psy11364         51 KLFATCF--VCGKQLSNQYNLRVHMET-H------------------QN-AFYACSSCSHVSRSRDALRKHDK  101 (101)
Q Consensus        51 ~~~~~C~--~c~~~~~~~~~l~~h~~~-h------------------~~-kp~~C~~C~k~f~~~~~l~~H~~  101 (101)
                      ++||+|+  .|.|.|.....|+-|+.. |                  .. |||+|++|+|++.....|..|++
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceeccc
Confidence            5999996  599999999999999753 2                  04 89999999999999999988863


No 23 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.86  E-value=3.2e-06  Score=34.77  Aligned_cols=21  Identities=29%  Similarity=0.733  Sum_probs=19.3

Q ss_pred             cccccCccccCChHHHhcccC
Q psy11364         81 YACSSCSHVSRSRDALRKHDK  101 (101)
Q Consensus        81 ~~C~~C~k~f~~~~~l~~H~~  101 (101)
                      |.|+.|++.|.....|.+|++
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~   21 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMR   21 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHh
Confidence            689999999999999999974


No 24 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=97.84  E-value=1.8e-05  Score=39.52  Aligned_cols=45  Identities=33%  Similarity=0.470  Sum_probs=33.8

Q ss_pred             ceecccchhhcCCHHHHHHHHH-hhCC--CCcccccCccccCChHHHhccc
Q psy11364         53 FATCFVCGKQLSNQYNLRVHME-THQN--AFYACSSCSHVSRSRDALRKHD  100 (101)
Q Consensus        53 ~~~C~~c~~~~~~~~~l~~h~~-~h~~--kp~~C~~C~k~f~~~~~l~~H~  100 (101)
                      .|.|+.|++ ......|..|.. .|..  +.+.|++|...+.  .+|..|+
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl   49 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHL   49 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHH
Confidence            478999999 556677889965 4665  6899999987644  3777775


No 25 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.72  E-value=1.4e-05  Score=34.15  Aligned_cols=22  Identities=32%  Similarity=0.682  Sum_probs=14.0

Q ss_pred             CcccccCccccCChHHHhcccC
Q psy11364         80 FYACSSCSHVSRSRDALRKHDK  101 (101)
Q Consensus        80 p~~C~~C~k~f~~~~~l~~H~~  101 (101)
                      ||.|..|++.|.....|..|++
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~   22 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKR   22 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHC
T ss_pred             CCCCCccCCccCChhHHHHHhH
Confidence            4566666666666666666653


No 26 
>PHA00616 hypothetical protein
Probab=97.68  E-value=7.4e-06  Score=39.05  Aligned_cols=22  Identities=23%  Similarity=0.572  Sum_probs=20.4

Q ss_pred             CcccccCccccCChHHHhcccC
Q psy11364         80 FYACSSCSHVSRSRDALRKHDK  101 (101)
Q Consensus        80 p~~C~~C~k~f~~~~~l~~H~~  101 (101)
                      ||.|+.||+.|...++|.+|++
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r   22 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLL   22 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHH
Confidence            7999999999999999999974


No 27 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.48  E-value=6.2e-05  Score=32.03  Aligned_cols=25  Identities=36%  Similarity=0.513  Sum_probs=22.5

Q ss_pred             ceecccchhhcCCHHHHHHHHHhhC
Q psy11364         53 FATCFVCGKQLSNQYNLRVHMETHQ   77 (101)
Q Consensus        53 ~~~C~~c~~~~~~~~~l~~h~~~h~   77 (101)
                      +|.|..|++.|.....|..|++.|.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            5899999999999999999997664


No 28 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.44  E-value=0.00016  Score=29.45  Aligned_cols=23  Identities=43%  Similarity=0.863  Sum_probs=14.8

Q ss_pred             eecccchhhcCCHHHHHHHHHhh
Q psy11364         54 ATCFVCGKQLSNQYNLRVHMETH   76 (101)
Q Consensus        54 ~~C~~c~~~~~~~~~l~~h~~~h   76 (101)
                      |.|+.|++.|.....+..|+..|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            46777777777777777777654


No 29 
>PRK04860 hypothetical protein; Provisional
Probab=97.41  E-value=7.7e-05  Score=45.32  Aligned_cols=39  Identities=23%  Similarity=0.494  Sum_probs=33.0

Q ss_pred             cceecccchhhcCCHHHHHHHHHhhCC-CCcccccCccccCChH
Q psy11364         52 LFATCFVCGKQLSNQYNLRVHMETHQN-AFYACSSCSHVSRSRD   94 (101)
Q Consensus        52 ~~~~C~~c~~~~~~~~~l~~h~~~h~~-kp~~C~~C~k~f~~~~   94 (101)
                      -+|.|. |++   ....+.+|.++|++ ++|.|..|++.|....
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~~  157 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVFKG  157 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEEec
Confidence            468997 987   56678899999999 9999999999887543


No 30 
>PHA00732 hypothetical protein
Probab=97.29  E-value=5.4e-05  Score=40.78  Aligned_cols=48  Identities=17%  Similarity=0.270  Sum_probs=37.0

Q ss_pred             CCCCCCCCCCCccCCCCCCCCCCCCCCCcceecccchhhcCCHHHHHHHHHhhC
Q psy11364         24 PLSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQLSNQYNLRVHMETHQ   77 (101)
Q Consensus        24 ~~~c~~c~~~~~~~~~~~~~~~~~~~~~~~~~C~~c~~~~~~~~~l~~h~~~h~   77 (101)
                      |+.|..||+.|...+.+..|......   ++.|..|++.|..   +..|.....
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~---~~~C~~CgKsF~~---l~~H~~~~~   48 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT---LTKCPVCNKSYRR---LNQHFYSQY   48 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC---CCccCCCCCEeCC---hhhhhcccC
Confidence            57899999999999998888763221   3579999999984   778875544


No 31 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.27  E-value=0.00082  Score=32.93  Aligned_cols=33  Identities=33%  Similarity=0.511  Sum_probs=22.8

Q ss_pred             CCCCcceecccchhhcCCHHHHHHHHHhhCC-CC
Q psy11364         48 NHSKLFATCFVCGKQLSNQYNLRVHMETHQN-AF   80 (101)
Q Consensus        48 ~~~~~~~~C~~c~~~~~~~~~l~~h~~~h~~-kp   80 (101)
                      ...+.|..|+.|+..+.+..+|.+|+.++.+ ||
T Consensus        19 ~~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   19 SQSEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             CTTS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             hccCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            3346789999999999999999999987766 65


No 32 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.25  E-value=0.00012  Score=29.90  Aligned_cols=20  Identities=35%  Similarity=0.783  Sum_probs=16.7

Q ss_pred             cccccCccccCChHHHhccc
Q psy11364         81 YACSSCSHVSRSRDALRKHD  100 (101)
Q Consensus        81 ~~C~~C~k~f~~~~~l~~H~  100 (101)
                      |.|+.|++.|.....|..|+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~   20 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHM   20 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHH
Confidence            67999999999999999996


No 33 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.18  E-value=0.00012  Score=40.37  Aligned_cols=23  Identities=26%  Similarity=0.485  Sum_probs=12.9

Q ss_pred             ceecccchhhcCCHHHHHHHHHh
Q psy11364         53 FATCFVCGKQLSNQYNLRVHMET   75 (101)
Q Consensus        53 ~~~C~~c~~~~~~~~~l~~h~~~   75 (101)
                      .+.|..|++.|.....|..|++.
T Consensus        50 ~~~C~~C~~~f~s~~~l~~Hm~~   72 (100)
T PF12756_consen   50 SFRCPYCNKTFRSREALQEHMRS   72 (100)
T ss_dssp             SEEBSSSS-EESSHHHHHHHHHH
T ss_pred             CCCCCccCCCCcCHHHHHHHHcC
Confidence            35566666666666666666554


No 34 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.08  E-value=0.00062  Score=27.98  Aligned_cols=24  Identities=38%  Similarity=0.688  Sum_probs=17.8

Q ss_pred             eecccchhhcCCHHHHHHHHHhhC
Q psy11364         54 ATCFVCGKQLSNQYNLRVHMETHQ   77 (101)
Q Consensus        54 ~~C~~c~~~~~~~~~l~~h~~~h~   77 (101)
                      |.|..|++.|.....+..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            457778888888888888877554


No 35 
>smart00355 ZnF_C2H2 zinc finger.
Probab=96.91  E-value=0.00034  Score=28.81  Aligned_cols=21  Identities=38%  Similarity=0.896  Sum_probs=18.7

Q ss_pred             cccccCccccCChHHHhcccC
Q psy11364         81 YACSSCSHVSRSRDALRKHDK  101 (101)
Q Consensus        81 ~~C~~C~k~f~~~~~l~~H~~  101 (101)
                      |.|..|++.|.....|..|++
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~   21 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMR   21 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHH
Confidence            579999999999999998863


No 36 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.85  E-value=0.0011  Score=28.19  Aligned_cols=21  Identities=29%  Similarity=0.691  Sum_probs=16.7

Q ss_pred             cccccCccccCChHHHhcccC
Q psy11364         81 YACSSCSHVSRSRDALRKHDK  101 (101)
Q Consensus        81 ~~C~~C~k~f~~~~~l~~H~~  101 (101)
                      |-|..|++.|.....+..|++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~   22 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMK   22 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTT
T ss_pred             CCcccCCCCcCCHHHHHHHHc
Confidence            568888888888888888864


No 37 
>KOG3993|consensus
Probab=96.77  E-value=0.00024  Score=48.82  Aligned_cols=48  Identities=21%  Similarity=0.465  Sum_probs=41.9

Q ss_pred             eecccchhhcCCHHHHHHHHHhhCC-CCcccccCccccCChHHHhcccC
Q psy11364         54 ATCFVCGKQLSNQYNLRVHMETHQN-AFYACSSCSHVSRSRDALRKHDK  101 (101)
Q Consensus        54 ~~C~~c~~~~~~~~~l~~h~~~h~~-kp~~C~~C~k~f~~~~~l~~H~~  101 (101)
                      |.|..|...|.....|.+|.-.--. .-|+|++|+|.|.-..+|..|.|
T Consensus       268 yiCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRR  316 (500)
T KOG3993|consen  268 YICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRR  316 (500)
T ss_pred             HHHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhhc
Confidence            7899999999999999999754444 57999999999999999988875


No 38 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.69  E-value=0.00071  Score=28.07  Aligned_cols=20  Identities=30%  Similarity=0.670  Sum_probs=11.6

Q ss_pred             cccccCccccCChHHHhccc
Q psy11364         81 YACSSCSHVSRSRDALRKHD  100 (101)
Q Consensus        81 ~~C~~C~k~f~~~~~l~~H~  100 (101)
                      |.|.+|++.|.....+..|+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~   20 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHL   20 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHH
T ss_pred             CCCCCCCCCcCCHHHHHHHH
Confidence            34556666666666665554


No 39 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=96.59  E-value=0.00059  Score=33.99  Aligned_cols=50  Identities=14%  Similarity=0.251  Sum_probs=33.6

Q ss_pred             CCCCCCCCCCCccCCCCCCCCCCCC-CCCcceecccchhhcCCHHHHHHHHHhh
Q psy11364         24 PLSSSIPGSSKTKASGSGTTGGSSN-HSKLFATCFVCGKQLSNQYNLRVHMETH   76 (101)
Q Consensus        24 ~~~c~~c~~~~~~~~~~~~~~~~~~-~~~~~~~C~~c~~~~~~~~~l~~h~~~h   76 (101)
                      .|.|+.||+.+. ...|..|....+ ...+.+.|+.|...+.  .++..|+..+
T Consensus         2 ~f~CP~C~~~~~-~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~   52 (54)
T PF05605_consen    2 SFTCPYCGKGFS-ESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQ   52 (54)
T ss_pred             CcCCCCCCCccC-HHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHh
Confidence            578999999544 455655543332 2345689999997644  4888888754


No 40 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.02  E-value=0.0049  Score=25.41  Aligned_cols=22  Identities=32%  Similarity=0.688  Sum_probs=19.8

Q ss_pred             eecccchhhcCCHHHHHHHHHh
Q psy11364         54 ATCFVCGKQLSNQYNLRVHMET   75 (101)
Q Consensus        54 ~~C~~c~~~~~~~~~l~~h~~~   75 (101)
                      |.|..|++.|..+..+..|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            6799999999999999999864


No 41 
>KOG1146|consensus
Probab=95.83  E-value=0.0041  Score=48.25  Aligned_cols=52  Identities=23%  Similarity=0.366  Sum_probs=45.2

Q ss_pred             CCcceecccchhhcCCHHHHHHHHHh-hC------------------------C-CCcccccCccccCChHHHhcccC
Q psy11364         50 SKLFATCFVCGKQLSNQYNLRVHMET-HQ------------------------N-AFYACSSCSHVSRSRDALRKHDK  101 (101)
Q Consensus        50 ~~~~~~C~~c~~~~~~~~~l~~h~~~-h~------------------------~-kp~~C~~C~k~f~~~~~l~~H~~  101 (101)
                      ..+.+.|+.|+..|.....|..|+|. |.                        + +||.|..|...+....+|..|++
T Consensus       462 ~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p~~C~~C~~stttng~Lsihlq  539 (1406)
T KOG1146|consen  462 FFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKPYPCRACNYSTTTNGNLSIHLQ  539 (1406)
T ss_pred             ccccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCcccceeeeeeeecchHHHHHHH
Confidence            35779999999999999999999997 11                        3 79999999999999999998863


No 42 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=95.34  E-value=0.0068  Score=29.73  Aligned_cols=22  Identities=32%  Similarity=0.526  Sum_probs=16.3

Q ss_pred             CCcccccCccccCChHHHhccc
Q psy11364         79 AFYACSSCSHVSRSRDALRKHD  100 (101)
Q Consensus        79 kp~~C~~C~k~f~~~~~l~~H~  100 (101)
                      .|..|++|+..+.+..+|.+|+
T Consensus        23 ~PatCP~C~a~~~~srnLrRHl   44 (54)
T PF09237_consen   23 QPATCPICGAVIRQSRNLRRHL   44 (54)
T ss_dssp             --EE-TTT--EESSHHHHHHHH
T ss_pred             CCCCCCcchhhccchhhHHHHH
Confidence            7999999999999999999996


No 43 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=95.05  E-value=0.014  Score=26.01  Aligned_cols=19  Identities=16%  Similarity=0.454  Sum_probs=9.1

Q ss_pred             cccccCccccCChHHHhcc
Q psy11364         81 YACSSCSHVSRSRDALRKH   99 (101)
Q Consensus        81 ~~C~~C~k~f~~~~~l~~H   99 (101)
                      |-|+.|++.|.....+..|
T Consensus         4 ~~C~~C~~~~~~~~~~~~H   22 (35)
T smart00451        4 FYCKLCNVTFTDEISVEAH   22 (35)
T ss_pred             eEccccCCccCCHHHHHHH
Confidence            4455555555544444444


No 44 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=94.98  E-value=0.033  Score=22.65  Aligned_cols=22  Identities=32%  Similarity=0.582  Sum_probs=15.0

Q ss_pred             eecccchhhcCCHHHHHHHHHhh
Q psy11364         54 ATCFVCGKQLSNQYNLRVHMETH   76 (101)
Q Consensus        54 ~~C~~c~~~~~~~~~l~~h~~~h   76 (101)
                      |.|..|..... +..|..|++.+
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~   22 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRH   22 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhh
Confidence            56888887776 77888887764


No 45 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=94.52  E-value=0.017  Score=24.10  Aligned_cols=17  Identities=35%  Similarity=0.882  Sum_probs=7.9

Q ss_pred             ecccchhhcCCHHHHHHH
Q psy11364         55 TCFVCGKQLSNQYNLRVH   72 (101)
Q Consensus        55 ~C~~c~~~~~~~~~l~~h   72 (101)
                      .|+.|++.| ....|..|
T Consensus         4 ~C~~CgR~F-~~~~l~~H   20 (25)
T PF13913_consen    4 PCPICGRKF-NPDRLEKH   20 (25)
T ss_pred             cCCCCCCEE-CHHHHHHH
Confidence            355555555 33334444


No 46 
>KOG2186|consensus
Probab=93.06  E-value=0.064  Score=34.92  Aligned_cols=38  Identities=29%  Similarity=0.710  Sum_probs=18.0

Q ss_pred             eecccchhhcCCHHHHHHHHHhhCCCCcccccCccccCC
Q psy11364         54 ATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHVSRS   92 (101)
Q Consensus        54 ~~C~~c~~~~~~~~~l~~h~~~h~~kp~~C~~C~k~f~~   92 (101)
                      |.|..||....-+. +..|+....+.-|.|.-|++.|..
T Consensus         4 FtCnvCgEsvKKp~-vekH~srCrn~~fSCIDC~k~F~~   41 (276)
T KOG2186|consen    4 FTCNVCGESVKKPQ-VEKHMSRCRNAYFSCIDCGKTFER   41 (276)
T ss_pred             Eehhhhhhhccccc-hHHHHHhccCCeeEEeeccccccc
Confidence            44555554443332 334554444444555555555554


No 47 
>KOG2893|consensus
Probab=93.03  E-value=0.039  Score=35.78  Aligned_cols=38  Identities=21%  Similarity=0.547  Sum_probs=28.3

Q ss_pred             cccchhhcCCHHHHHHHHHhhCCCCcccccCccccCChHHH
Q psy11364         56 CFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHVSRSRDAL   96 (101)
Q Consensus        56 C~~c~~~~~~~~~l~~h~~~h~~kp~~C~~C~k~f~~~~~l   96 (101)
                      |..|++.|....-|..|++.   |.|+|-+|.|..-.-..|
T Consensus        13 cwycnrefddekiliqhqka---khfkchichkkl~sgpgl   50 (341)
T KOG2893|consen   13 CWYCNREFDDEKILIQHQKA---KHFKCHICHKKLFSGPGL   50 (341)
T ss_pred             eeecccccchhhhhhhhhhh---ccceeeeehhhhccCCCc
Confidence            67889999998888877654   778999998765444333


No 48 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=90.94  E-value=0.14  Score=22.74  Aligned_cols=8  Identities=25%  Similarity=0.966  Sum_probs=4.3

Q ss_pred             CcccccCc
Q psy11364         80 FYACSSCS   87 (101)
Q Consensus        80 p~~C~~C~   87 (101)
                      |+.|++||
T Consensus        17 ~~~CP~Cg   24 (33)
T cd00350          17 PWVCPVCG   24 (33)
T ss_pred             CCcCcCCC
Confidence            45555554


No 49 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=90.80  E-value=0.28  Score=26.66  Aligned_cols=68  Identities=18%  Similarity=0.203  Sum_probs=18.3

Q ss_pred             CCCCCCCCCccCCCCCCCCCCCCCCCcceecccchhhcCCHHHHHHHHH---hhCCCCcccccCccccCChHHHhcccC
Q psy11364         26 SSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQLSNQYNLRVHME---THQNAFYACSSCSHVSRSRDALRKHDK  101 (101)
Q Consensus        26 ~c~~c~~~~~~~~~~~~~~~~~~~~~~~~~C~~c~~~~~~~~~l~~h~~---~h~~kp~~C~~C~k~f~~~~~l~~H~~  101 (101)
                      +|..|+..|.....+..|....+.-..+ ..    ..+.....+..+.+   ...   +.|..|++.|.....|..|++
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~~-~~----~~l~~~~~~~~~~~~~~~~~---~~C~~C~~~f~s~~~l~~Hm~   71 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDIP-DQ----KYLVDPNRLLNYLRKKVKES---FRCPYCNKTFRSREALQEHMR   71 (100)
T ss_dssp             -----------------------------------------------------SS---EEBSSSS-EESSHHHHHHHHH
T ss_pred             Cccccccccccccccccccccccccccc-cc----cccccccccccccccccCCC---CCCCccCCCCcCHHHHHHHHc
Confidence            4888999998888887776544321111 00    00111111111111   113   479999999999999999873


No 50 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=90.52  E-value=0.071  Score=35.97  Aligned_cols=52  Identities=17%  Similarity=0.236  Sum_probs=34.0

Q ss_pred             CCCCCCC--CCCCCccCCCCCC-----CCC-------------CCCCCCcceecccchhhcCCHHHHHHHHH
Q psy11364         23 SPLSSSI--PGSSKTKASGSGT-----TGG-------------SSNHSKLFATCFVCGKQLSNQYNLRVHME   74 (101)
Q Consensus        23 ~~~~c~~--c~~~~~~~~~~~~-----~~~-------------~~~~~~~~~~C~~c~~~~~~~~~l~~h~~   74 (101)
                      .||.|++  |.+.+...-.|.-     |..             +-....+||.|++|+|.|..--.|+-|+.
T Consensus       348 KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         348 KPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             ceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceeccc
Confidence            4899987  6666655544431     100             01112489999999999999888877753


No 51 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=89.78  E-value=0.27  Score=28.08  Aligned_cols=30  Identities=17%  Similarity=0.229  Sum_probs=17.1

Q ss_pred             CCCCCCCCCCccCCCCCCCCCCCCCCCcceecccchhhcCCH
Q psy11364         25 LSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQLSNQ   66 (101)
Q Consensus        25 ~~c~~c~~~~~~~~~~~~~~~~~~~~~~~~~C~~c~~~~~~~   66 (101)
                      ..|+.||+.|..   |         ++.|..|+.||..|...
T Consensus        10 R~Cp~CG~kFYD---L---------nk~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   10 RTCPSCGAKFYD---L---------NKDPIVCPKCGTEFPPE   39 (108)
T ss_pred             ccCCCCcchhcc---C---------CCCCccCCCCCCccCcc
Confidence            456666766632   1         23555667777666554


No 52 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=89.58  E-value=0.22  Score=33.79  Aligned_cols=59  Identities=20%  Similarity=0.214  Sum_probs=36.9

Q ss_pred             CCCCCCCCCCCccCCCCCCCCC--CCCCCC--cceecc--cchhhcCCHHHHHHHHHhhCC-CCccc
Q psy11364         24 PLSSSIPGSSKTKASGSGTTGG--SSNHSK--LFATCF--VCGKQLSNQYNLRVHMETHQN-AFYAC   83 (101)
Q Consensus        24 ~~~c~~c~~~~~~~~~~~~~~~--~~~~~~--~~~~C~--~c~~~~~~~~~l~~h~~~h~~-kp~~C   83 (101)
                      +..|..|...+.....+..+..  .+. .+  +++.|.  .|++.+.....+..|...|++ .++.+
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~~~~~h~-~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  354 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHLRSVNHS-GESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKE  354 (467)
T ss_pred             CCCCccccCCccccccccccccccccc-cccCCceeeeccCCCccccccccccCCcccccCCCcccc
Confidence            4556666666666666666665  333 34  666666  577777777777777666666 54544


No 53 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=89.45  E-value=0.27  Score=29.87  Aligned_cols=43  Identities=16%  Similarity=0.334  Sum_probs=22.3

Q ss_pred             CCCCCCCCCccCCCCCCCCCCCCCCCcceecccchhhcCCHHHH
Q psy11364         26 SSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQLSNQYNL   69 (101)
Q Consensus        26 ~c~~c~~~~~~~~~~~~~~~~~~~~~~~~~C~~c~~~~~~~~~l   69 (101)
                      .||.||.....--........... .+.+.|+.||..|.....+
T Consensus         2 ~cp~c~~~~~~~~~s~~~~~~~~~-~~~~~c~~c~~~f~~~e~~   44 (154)
T PRK00464          2 RCPFCGHPDTRVIDSRPAEDGNAI-RRRRECLACGKRFTTFERV   44 (154)
T ss_pred             cCCCCCCCCCEeEeccccCCCCce-eeeeeccccCCcceEeEec
Confidence            588888755332221111111111 2337888888887765543


No 54 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=88.69  E-value=0.28  Score=24.86  Aligned_cols=32  Identities=19%  Similarity=0.378  Sum_probs=20.0

Q ss_pred             cceecccchhhcCCHHHHHHHHHhhCCCCcccccCc
Q psy11364         52 LFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCS   87 (101)
Q Consensus        52 ~~~~C~~c~~~~~~~~~l~~h~~~h~~kp~~C~~C~   87 (101)
                      -.|.|+.||++.-.+..-=    --.+.+|.|+.||
T Consensus        26 v~F~CPnCGe~~I~Rc~~C----Rk~g~~Y~Cp~CG   57 (61)
T COG2888          26 VKFPCPNCGEVEIYRCAKC----RKLGNPYRCPKCG   57 (61)
T ss_pred             eEeeCCCCCceeeehhhhH----HHcCCceECCCcC
Confidence            4488999996544433211    1123799999998


No 55 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=86.20  E-value=0.56  Score=23.49  Aligned_cols=26  Identities=19%  Similarity=0.427  Sum_probs=22.8

Q ss_pred             CCcceecccchhhcCCHHHHHHHHHh
Q psy11364         50 SKLFATCFVCGKQLSNQYNLRVHMET   75 (101)
Q Consensus        50 ~~~~~~C~~c~~~~~~~~~l~~h~~~   75 (101)
                      ++..+.|+.|+..|.....+.+|...
T Consensus        14 GE~~lrCPRC~~~FR~~K~Y~RHVNK   39 (65)
T COG4049          14 GEEFLRCPRCGMVFRRRKDYIRHVNK   39 (65)
T ss_pred             CceeeeCCchhHHHHHhHHHHHHhhH
Confidence            57778999999999999999999764


No 56 
>PRK04860 hypothetical protein; Provisional
Probab=85.41  E-value=0.087  Score=32.13  Aligned_cols=38  Identities=13%  Similarity=0.150  Sum_probs=28.3

Q ss_pred             CCCCCCCCCCCCccCCCCCCCCCCCCCCCcceecccchhhcCC
Q psy11364         23 SPLSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQLSN   65 (101)
Q Consensus        23 ~~~~c~~c~~~~~~~~~~~~~~~~~~~~~~~~~C~~c~~~~~~   65 (101)
                      .+|.|. |+.   ....+..|.+++. ++++|.|..|+..+..
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~ri~~-g~~~YrC~~C~~~l~~  155 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHNRVVR-GEAVYRCRRCGETLVF  155 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHHHHhc-CCccEECCCCCceeEE
Confidence            478997 887   4455556777766 4788999999987754


No 57 
>PHA00626 hypothetical protein
Probab=85.38  E-value=0.8  Score=22.94  Aligned_cols=17  Identities=24%  Similarity=0.229  Sum_probs=11.8

Q ss_pred             CcceecccchhhcCCHH
Q psy11364         51 KLFATCFVCGKQLSNQY   67 (101)
Q Consensus        51 ~~~~~C~~c~~~~~~~~   67 (101)
                      ...|.|..||..|+...
T Consensus        21 snrYkCkdCGY~ft~~~   37 (59)
T PHA00626         21 SDDYVCCDCGYNDSKDA   37 (59)
T ss_pred             CcceEcCCCCCeechhh
Confidence            35588888887776544


No 58 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=85.17  E-value=0.54  Score=21.00  Aligned_cols=8  Identities=25%  Similarity=0.630  Sum_probs=4.5

Q ss_pred             CcccccCc
Q psy11364         80 FYACSSCS   87 (101)
Q Consensus        80 p~~C~~C~   87 (101)
                      |..|++||
T Consensus        18 p~~CP~Cg   25 (34)
T cd00729          18 PEKCPICG   25 (34)
T ss_pred             CCcCcCCC
Confidence            45555555


No 59 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=83.35  E-value=0.96  Score=26.54  Aligned_cols=30  Identities=17%  Similarity=0.050  Sum_probs=17.5

Q ss_pred             CCCCCCCCCCccCCCCCCCCCCCCCCCcceecccchhhcCCH
Q psy11364         25 LSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQLSNQ   66 (101)
Q Consensus        25 ~~c~~c~~~~~~~~~~~~~~~~~~~~~~~~~C~~c~~~~~~~   66 (101)
                      ..|+.||+.|..   |         ++.|..|+.||..|...
T Consensus        10 r~Cp~cg~kFYD---L---------nk~p~vcP~cg~~~~~~   39 (129)
T TIGR02300        10 RICPNTGSKFYD---L---------NRRPAVSPYTGEQFPPE   39 (129)
T ss_pred             ccCCCcCccccc---c---------CCCCccCCCcCCccCcc
Confidence            456777766633   1         23556677777666544


No 60 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=80.95  E-value=1.1  Score=27.28  Aligned_cols=31  Identities=13%  Similarity=0.370  Sum_probs=20.6

Q ss_pred             cceecccchhhcCCHHHHHHHHHhhCCCCcccccCcccc
Q psy11364         52 LFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHVS   90 (101)
Q Consensus        52 ~~~~C~~c~~~~~~~~~l~~h~~~h~~kp~~C~~C~k~f   90 (101)
                      .-|.|+.|+..|+....+.        --|.|+.||...
T Consensus       108 ~~Y~Cp~c~~r~tf~eA~~--------~~F~Cp~Cg~~L  138 (158)
T TIGR00373       108 MFFICPNMCVRFTFNEAME--------LNFTCPRCGAML  138 (158)
T ss_pred             CeEECCCCCcEeeHHHHHH--------cCCcCCCCCCEe
Confidence            4467777777777666654        257788887653


No 61 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=80.89  E-value=1  Score=27.99  Aligned_cols=32  Identities=16%  Similarity=0.451  Sum_probs=19.6

Q ss_pred             cceecccchhhcCCHHHHHHHHHhhCCCCcccccCccccC
Q psy11364         52 LFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHVSR   91 (101)
Q Consensus        52 ~~~~C~~c~~~~~~~~~l~~h~~~h~~kp~~C~~C~k~f~   91 (101)
                      .-|.|+.|+..|+....+.        --|.|+.||....
T Consensus       116 ~~Y~Cp~C~~rytf~eA~~--------~~F~Cp~Cg~~L~  147 (178)
T PRK06266        116 MFFFCPNCHIRFTFDEAME--------YGFRCPQCGEMLE  147 (178)
T ss_pred             CEEECCCCCcEEeHHHHhh--------cCCcCCCCCCCCe
Confidence            3466777777766665542        2577777775443


No 62 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=80.15  E-value=1.2  Score=20.18  Aligned_cols=9  Identities=33%  Similarity=0.855  Sum_probs=4.0

Q ss_pred             eecccchhh
Q psy11364         54 ATCFVCGKQ   62 (101)
Q Consensus        54 ~~C~~c~~~   62 (101)
                      ..|..|+..
T Consensus        26 vrC~~C~~~   34 (37)
T PF13719_consen   26 VRCPKCGHV   34 (37)
T ss_pred             EECCCCCcE
Confidence            344444443


No 63 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=79.84  E-value=1.5  Score=19.81  Aligned_cols=10  Identities=50%  Similarity=1.002  Sum_probs=4.4

Q ss_pred             CcccccCccc
Q psy11364         80 FYACSSCSHV   89 (101)
Q Consensus        80 p~~C~~C~k~   89 (101)
                      -..|..|+..
T Consensus        25 ~v~C~~C~~~   34 (36)
T PF13717_consen   25 KVRCSKCGHV   34 (36)
T ss_pred             EEECCCCCCE
Confidence            3444444443


No 64 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=79.47  E-value=0.46  Score=32.18  Aligned_cols=49  Identities=24%  Similarity=0.455  Sum_probs=42.8

Q ss_pred             cceecccchhhcCCHHHHHHHHH--hhCC---CCcccc--cCccccCChHHHhccc
Q psy11364         52 LFATCFVCGKQLSNQYNLRVHME--THQN---AFYACS--SCSHVSRSRDALRKHD  100 (101)
Q Consensus        52 ~~~~C~~c~~~~~~~~~l~~h~~--~h~~---kp~~C~--~C~k~f~~~~~l~~H~  100 (101)
                      .++.|..|...+.....+..|.+  .|.+   +|+.|+  .|++.|.+...+..|.
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~  343 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHI  343 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCc
Confidence            36889999999999999999999  7876   499999  7999999999887774


No 65 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=79.07  E-value=1.4  Score=26.42  Aligned_cols=36  Identities=11%  Similarity=0.351  Sum_probs=20.0

Q ss_pred             cceecccchhhcCCHHHHHHHHHhhCCCCcccccCcccc
Q psy11364         52 LFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHVS   90 (101)
Q Consensus        52 ~~~~C~~c~~~~~~~~~l~~h~~~h~~kp~~C~~C~k~f   90 (101)
                      ..|.|+.|+..|.....+..   .....-|.|+.||...
T Consensus        98 ~~Y~Cp~C~~~y~~~ea~~~---~d~~~~f~Cp~Cg~~l  133 (147)
T smart00531       98 AYYKCPNCQSKYTFLEANQL---LDMDGTFTCPRCGEEL  133 (147)
T ss_pred             cEEECcCCCCEeeHHHHHHh---cCCCCcEECCCCCCEE
Confidence            34778888777765433221   0112237788887654


No 66 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=78.77  E-value=0.96  Score=22.91  Aligned_cols=32  Identities=25%  Similarity=0.574  Sum_probs=19.0

Q ss_pred             cceecccchhhcCCHH-HHHHHHHhhCCCCcccccCcc
Q psy11364         52 LFATCFVCGKQLSNQY-NLRVHMETHQNAFYACSSCSH   88 (101)
Q Consensus        52 ~~~~C~~c~~~~~~~~-~l~~h~~~h~~kp~~C~~C~k   88 (101)
                      -.|.|+.||+..-.+- ...     -.+.+|.|+.||-
T Consensus        24 ~~F~CPnCG~~~I~RC~~CR-----k~~~~Y~CP~CGF   56 (59)
T PRK14890         24 VKFLCPNCGEVIIYRCEKCR-----KQSNPYTCPKCGF   56 (59)
T ss_pred             CEeeCCCCCCeeEeechhHH-----hcCCceECCCCCC
Confidence            3488999987622221 111     1126999999983


No 67 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=78.57  E-value=1.1  Score=27.60  Aligned_cols=23  Identities=30%  Similarity=0.546  Sum_probs=13.6

Q ss_pred             ceecccchhhcCCHHHHHHHHHhhCCCCcccccCc
Q psy11364         53 FATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCS   87 (101)
Q Consensus        53 ~~~C~~c~~~~~~~~~l~~h~~~h~~kp~~C~~C~   87 (101)
                      .|.|.+||..... .           -|-.|++||
T Consensus       134 ~~vC~vCGy~~~g-e-----------~P~~CPiCg  156 (166)
T COG1592         134 VWVCPVCGYTHEG-E-----------APEVCPICG  156 (166)
T ss_pred             EEEcCCCCCcccC-C-----------CCCcCCCCC
Confidence            5777777643322 0           477777776


No 68 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=78.07  E-value=1.4  Score=20.94  Aligned_cols=8  Identities=25%  Similarity=0.908  Sum_probs=3.9

Q ss_pred             CcccccCc
Q psy11364         80 FYACSSCS   87 (101)
Q Consensus        80 p~~C~~C~   87 (101)
                      +..|+.||
T Consensus        19 ~irC~~CG   26 (44)
T smart00659       19 VVRCRECG   26 (44)
T ss_pred             ceECCCCC
Confidence            44455554


No 69 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=77.71  E-value=1.5  Score=19.76  Aligned_cols=9  Identities=33%  Similarity=0.803  Sum_probs=4.0

Q ss_pred             eecccchhh
Q psy11364         54 ATCFVCGKQ   62 (101)
Q Consensus        54 ~~C~~c~~~   62 (101)
                      ..|+.|+..
T Consensus        26 v~C~~C~~~   34 (38)
T TIGR02098        26 VRCGKCGHV   34 (38)
T ss_pred             EECCCCCCE
Confidence            344444443


No 70 
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=76.22  E-value=1.4  Score=25.96  Aligned_cols=15  Identities=20%  Similarity=0.530  Sum_probs=7.8

Q ss_pred             ceecccchhhcCCHH
Q psy11364         53 FATCFVCGKQLSNQY   67 (101)
Q Consensus        53 ~~~C~~c~~~~~~~~   67 (101)
                      |+.|..||+.|...+
T Consensus         1 PH~Ct~Cg~~f~dgs   15 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGS   15 (131)
T ss_pred             CcccCcCCCCcCCCc
Confidence            345555555555433


No 71 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=76.01  E-value=1.6  Score=18.23  Aligned_cols=8  Identities=25%  Similarity=0.721  Sum_probs=4.1

Q ss_pred             cccCcccc
Q psy11364         83 CSSCSHVS   90 (101)
Q Consensus        83 C~~C~k~f   90 (101)
                      |++|++.+
T Consensus         4 CPiC~~~v   11 (26)
T smart00734        4 CPVCFREV   11 (26)
T ss_pred             CCCCcCcc
Confidence            55555544


No 72 
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=73.06  E-value=2.1  Score=32.12  Aligned_cols=60  Identities=20%  Similarity=0.270  Sum_probs=39.5

Q ss_pred             CCCCCCCCCccCCCCCCCCCCCCCCCcceecccchhhcCCHHHHHHHHHhhCCCCcccccCccccC
Q psy11364         26 SSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHVSR   91 (101)
Q Consensus        26 ~c~~c~~~~~~~~~~~~~~~~~~~~~~~~~C~~c~~~~~~~~~l~~h~~~h~~kp~~C~~C~k~f~   91 (101)
                      .|..||-.|+--..+.-...... ...--.|+.|.+.|..+.+-+-|    . .|..|+.||-...
T Consensus       125 ~CT~CGPRfTIi~alPYDR~nTs-M~~F~lC~~C~~EY~dP~nRRfH----A-Qp~aCp~CGP~~~  184 (750)
T COG0068         125 NCTNCGPRFTIIEALPYDRENTS-MADFPLCPFCDKEYKDPLNRRFH----A-QPIACPKCGPHLF  184 (750)
T ss_pred             ccCCCCcceeeeccCCCCcccCc-cccCcCCHHHHHHhcCccccccc----c-ccccCcccCCCeE
Confidence            57889988877666654433322 22223599999988887764433    3 6899999996443


No 73 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=72.65  E-value=1.5  Score=28.04  Aligned_cols=44  Identities=9%  Similarity=0.068  Sum_probs=25.2

Q ss_pred             CCCCCCCCCCCCccCCCCCCCCCC---------CCCCC-----cceecccchhhcCCH
Q psy11364         23 SPLSSSIPGSSKTKASGSGTTGGS---------SNHSK-----LFATCFVCGKQLSNQ   66 (101)
Q Consensus        23 ~~~~c~~c~~~~~~~~~~~~~~~~---------~~~~~-----~~~~C~~c~~~~~~~   66 (101)
                      ....||.|++.|..+.......+.         .-.+.     ....|+.||.++...
T Consensus         4 k~~~CPvC~~~F~~~~vrs~~~r~~~~d~D~~~~Y~~vnP~~Y~V~vCP~CgyA~~~~   61 (214)
T PF09986_consen    4 KKITCPVCGKEFKTKKVRSGKIRVIRRDSDFCPRYKGVNPLFYEVWVCPHCGYAAFEE   61 (214)
T ss_pred             CceECCCCCCeeeeeEEEcCCceEeeecCCCccccCCCCCeeeeEEECCCCCCccccc
Confidence            356899999999776444332221         11111     235688888665543


No 74 
>KOG2785|consensus
Probab=72.59  E-value=2.5  Score=29.37  Aligned_cols=22  Identities=23%  Similarity=0.377  Sum_probs=17.7

Q ss_pred             CCcccccCccccCChHHHhccc
Q psy11364         79 AFYACSSCSHVSRSRDALRKHD  100 (101)
Q Consensus        79 kp~~C~~C~k~f~~~~~l~~H~  100 (101)
                      -++.|.+|.+.|........|+
T Consensus        67 ~~~~c~~c~k~~~s~~a~~~hl   88 (390)
T KOG2785|consen   67 SVVYCEACNKSFASPKAHENHL   88 (390)
T ss_pred             cceehHHhhccccChhhHHHHH
Confidence            4788999999998887776664


No 75 
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=72.58  E-value=4.5  Score=24.16  Aligned_cols=20  Identities=30%  Similarity=0.369  Sum_probs=11.5

Q ss_pred             cceecccchhhcCCHHHHHH
Q psy11364         52 LFATCFVCGKQLSNQYNLRV   71 (101)
Q Consensus        52 ~~~~C~~c~~~~~~~~~l~~   71 (101)
                      ..+.|+.|++.|..-++..+
T Consensus       123 ~f~~C~~C~kiyW~GsH~~~  142 (147)
T PF01927_consen  123 EFWRCPGCGKIYWEGSHWRR  142 (147)
T ss_pred             eEEECCCCCCEecccccHHH
Confidence            34566666666666555443


No 76 
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=72.27  E-value=4.3  Score=30.80  Aligned_cols=47  Identities=17%  Similarity=0.146  Sum_probs=26.8

Q ss_pred             CCCCCCCCCCCccCCC---CCCCCCCCCCCCcceecccchhhcCCHHHHHHHHHhhCCCCcccccCccc
Q psy11364         24 PLSSSIPGSSKTKASG---SGTTGGSSNHSKLFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHV   89 (101)
Q Consensus        24 ~~~c~~c~~~~~~~~~---~~~~~~~~~~~~~~~~C~~c~~~~~~~~~l~~h~~~h~~kp~~C~~C~k~   89 (101)
                      -..|..||..+..+..   +.-|.     ..+...|..||..-              ..|..|+.||..
T Consensus       435 ~l~C~~Cg~v~~Cp~Cd~~lt~H~-----~~~~L~CH~Cg~~~--------------~~p~~Cp~Cgs~  484 (730)
T COG1198         435 LLLCRDCGYIAECPNCDSPLTLHK-----ATGQLRCHYCGYQE--------------PIPQSCPECGSE  484 (730)
T ss_pred             eeecccCCCcccCCCCCcceEEec-----CCCeeEeCCCCCCC--------------CCCCCCCCCCCC
Confidence            4556777766544322   22232     23556788887431              158888888854


No 77 
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=72.13  E-value=2.6  Score=22.28  Aligned_cols=41  Identities=7%  Similarity=0.143  Sum_probs=23.9

Q ss_pred             CCCCCCCCCCccCCCCCCCCCCCCCCCcceecc--cchhhcCCHHH
Q psy11364         25 LSSSIPGSSKTKASGSGTTGGSSNHSKLFATCF--VCGKQLSNQYN   68 (101)
Q Consensus        25 ~~c~~c~~~~~~~~~~~~~~~~~~~~~~~~~C~--~c~~~~~~~~~   68 (101)
                      ..|+.||......++-.....   ..++.+.|.  .||..|..-..
T Consensus         2 m~CP~Cg~~a~irtSr~~s~~---~~~~Y~qC~N~eCg~tF~t~es   44 (72)
T PRK09678          2 FHCPLCQHAAHARTSRYITDT---TKERYHQCQNVNCSATFITYES   44 (72)
T ss_pred             ccCCCCCCccEEEEChhcChh---hheeeeecCCCCCCCEEEEEEE
Confidence            358888876533333222211   236667887  89888766543


No 78 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=71.77  E-value=1.5  Score=21.13  Aligned_cols=13  Identities=54%  Similarity=1.002  Sum_probs=8.1

Q ss_pred             eecccchhhcCCH
Q psy11364         54 ATCFVCGKQLSNQ   66 (101)
Q Consensus        54 ~~C~~c~~~~~~~   66 (101)
                      -.|..|++.+...
T Consensus        19 a~C~~C~~~l~~~   31 (50)
T smart00614       19 AKCKYCGKKLSRS   31 (50)
T ss_pred             EEecCCCCEeeeC
Confidence            4577777766544


No 79 
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=70.11  E-value=2.5  Score=23.92  Aligned_cols=12  Identities=25%  Similarity=0.805  Sum_probs=6.5

Q ss_pred             eecccchhhcCC
Q psy11364         54 ATCFVCGKQLSN   65 (101)
Q Consensus        54 ~~C~~c~~~~~~   65 (101)
                      +.|..||..|..
T Consensus         3 H~CtrCG~vf~~   14 (112)
T COG3364           3 HQCTRCGEVFDD   14 (112)
T ss_pred             ceeccccccccc
Confidence            455555555554


No 80 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=69.88  E-value=0.94  Score=21.49  Aligned_cols=10  Identities=10%  Similarity=0.026  Sum_probs=5.3

Q ss_pred             CCCCCCCCCC
Q psy11364         25 LSSSIPGSSK   34 (101)
Q Consensus        25 ~~c~~c~~~~   34 (101)
                      |.|+.||..+
T Consensus         4 y~C~~CG~~~   13 (46)
T PRK00398          4 YKCARCGREV   13 (46)
T ss_pred             EECCCCCCEE
Confidence            4555566543


No 81 
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=69.31  E-value=3.3  Score=25.23  Aligned_cols=19  Identities=26%  Similarity=0.382  Sum_probs=13.3

Q ss_pred             CCcceecccchhhcCCHHH
Q psy11364         50 SKLFATCFVCGKQLSNQYN   68 (101)
Q Consensus        50 ~~~~~~C~~c~~~~~~~~~   68 (101)
                      .+.|..|..||+.|.+-..
T Consensus        65 ~~~PsYC~~CGkpyPWt~~   83 (158)
T PF10083_consen   65 YEAPSYCHNCGKPYPWTEN   83 (158)
T ss_pred             CCCChhHHhCCCCCchHHH
Confidence            3567778888888776543


No 82 
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=69.30  E-value=5  Score=18.96  Aligned_cols=29  Identities=21%  Similarity=0.227  Sum_probs=16.1

Q ss_pred             CCCCCCCCCCCCccCCCCCCCCCCCCCCCcceecccchh
Q psy11364         23 SPLSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGK   61 (101)
Q Consensus        23 ~~~~c~~c~~~~~~~~~~~~~~~~~~~~~~~~~C~~c~~   61 (101)
                      +.+.|+.||..-  ...+        .....|.|..|++
T Consensus        17 ~g~~CP~Cg~~~--~~~~--------~~~~~~~C~~C~~   45 (46)
T PF12760_consen   17 DGFVCPHCGSTK--HYRL--------KTRGRYRCKACRK   45 (46)
T ss_pred             CCCCCCCCCCee--eEEe--------CCCCeEECCCCCC
Confidence            467788888541  1111        1145578887764


No 83 
>KOG1146|consensus
Probab=68.13  E-value=2.7  Score=33.76  Aligned_cols=72  Identities=18%  Similarity=0.244  Sum_probs=51.3

Q ss_pred             CCCCCCCCCCCccCCCCCCCCCCCCCCCcceecccchhhcCCHHHHHHHHHhhC-----------------C-CCccccc
Q psy11364         24 PLSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQLSNQYNLRVHMETHQ-----------------N-AFYACSS   85 (101)
Q Consensus        24 ~~~c~~c~~~~~~~~~~~~~~~~~~~~~~~~~C~~c~~~~~~~~~l~~h~~~h~-----------------~-kp~~C~~   85 (101)
                      .+.|..|...+...-.+. +.    ....+|.|..|...|.....|..|.+...                 . ++| |..
T Consensus      1260 e~~c~~~~~~~~~~~~~~-~l----~~~~~~~~~~~~~~~~~~~~l~~~~~k~~~~~~~~~~~~~~~l~~~d~~~~-c~~ 1333 (1406)
T KOG1146|consen 1260 EGECGAVDELLTPSFGIS-TL----DVTHRYLCRQCKMAFDGEAPLTAHQRKFCFAGRGSGGSMPPPLRVPDCTYH-CLA 1333 (1406)
T ss_pred             cchhhhccccccCcccee-ec----ccchhHHHHHHHhhhcchhHHHHHHHHHHhccCccccCCCCcccCcccccc-chH
Confidence            455666665555544433 22    23567899999999999999998885332                 2 567 999


Q ss_pred             CccccCChHHHhcccC
Q psy11364         86 CSHVSRSRDALRKHDK  101 (101)
Q Consensus        86 C~k~f~~~~~l~~H~~  101 (101)
                      |...|.....|+.|++
T Consensus      1334 c~~~~~~~~alqihm~ 1349 (1406)
T KOG1146|consen 1334 CEVLLSGREALQIHMR 1349 (1406)
T ss_pred             HHhhcchhHHHHHHHH
Confidence            9999999999988874


No 84 
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=68.07  E-value=4.1  Score=18.79  Aligned_cols=12  Identities=33%  Similarity=0.935  Sum_probs=7.9

Q ss_pred             cceecccchhhc
Q psy11364         52 LFATCFVCGKQL   63 (101)
Q Consensus        52 ~~~~C~~c~~~~   63 (101)
                      .-|.|..|+..+
T Consensus        27 ~fy~C~~C~~~w   38 (40)
T smart00440       27 VFYVCTKCGHRW   38 (40)
T ss_pred             EEEEeCCCCCEe
Confidence            347787777654


No 85 
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=67.94  E-value=1.7  Score=24.01  Aligned_cols=12  Identities=33%  Similarity=0.645  Sum_probs=5.8

Q ss_pred             ceecccchhhcC
Q psy11364         53 FATCFVCGKQLS   64 (101)
Q Consensus        53 ~~~C~~c~~~~~   64 (101)
                      |-.|..||..|.
T Consensus        58 Pa~CkkCGfef~   69 (97)
T COG3357          58 PARCKKCGFEFR   69 (97)
T ss_pred             ChhhcccCcccc
Confidence            344555554443


No 86 
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=67.87  E-value=4.4  Score=24.45  Aligned_cols=16  Identities=13%  Similarity=0.449  Sum_probs=10.4

Q ss_pred             eecccchhhcCCHHHH
Q psy11364         54 ATCFVCGKQLSNQYNL   69 (101)
Q Consensus        54 ~~C~~c~~~~~~~~~l   69 (101)
                      -.|..|++.|++-..+
T Consensus        29 ReC~~C~~RFTTyErv   44 (147)
T TIGR00244        29 RECLECHERFTTFERA   44 (147)
T ss_pred             ccCCccCCccceeeec
Confidence            4677777777665543


No 87 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=67.84  E-value=6.5  Score=18.15  Aligned_cols=23  Identities=39%  Similarity=0.642  Sum_probs=13.2

Q ss_pred             CcceecccchhhcCCH----HHHHHHH
Q psy11364         51 KLFATCFVCGKQLSNQ----YNLRVHM   73 (101)
Q Consensus        51 ~~~~~C~~c~~~~~~~----~~l~~h~   73 (101)
                      .....|..|++.+...    +.|.+|+
T Consensus        14 ~~~a~C~~C~~~~~~~~~~ts~l~~HL   40 (45)
T PF02892_consen   14 KKKAKCKYCGKVIKYSSGGTSNLKRHL   40 (45)
T ss_dssp             SS-EEETTTTEE-----SSTHHHHHHH
T ss_pred             cCeEEeCCCCeEEeeCCCcHHHHHHhh
Confidence            4456788888877664    5677776


No 88 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=66.86  E-value=1.9  Score=21.02  Aligned_cols=11  Identities=27%  Similarity=0.773  Sum_probs=7.0

Q ss_pred             ceecccchhhc
Q psy11364         53 FATCFVCGKQL   63 (101)
Q Consensus        53 ~~~C~~c~~~~   63 (101)
                      .|.|..||+.+
T Consensus         6 ~Y~C~~Cg~~~   16 (49)
T COG1996           6 EYKCARCGREV   16 (49)
T ss_pred             EEEhhhcCCee
Confidence            36666676665


No 89 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=66.39  E-value=2.7  Score=17.29  Aligned_cols=8  Identities=38%  Similarity=0.733  Sum_probs=4.2

Q ss_pred             ceecccch
Q psy11364         53 FATCFVCG   60 (101)
Q Consensus        53 ~~~C~~c~   60 (101)
                      .|.|+.||
T Consensus        16 ~f~CPnCG   23 (24)
T PF07754_consen   16 PFPCPNCG   23 (24)
T ss_pred             eEeCCCCC
Confidence            45555554


No 90 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=65.57  E-value=1.8  Score=23.74  Aligned_cols=10  Identities=30%  Similarity=0.810  Sum_probs=5.5

Q ss_pred             eecccchhhc
Q psy11364         54 ATCFVCGKQL   63 (101)
Q Consensus        54 ~~C~~c~~~~   63 (101)
                      |.|..|+..|
T Consensus        54 W~C~kCg~~f   63 (89)
T COG1997          54 WKCRKCGAKF   63 (89)
T ss_pred             EEcCCCCCee
Confidence            5565665544


No 91 
>PF14353 CpXC:  CpXC protein
Probab=65.46  E-value=2.6  Score=24.43  Aligned_cols=10  Identities=10%  Similarity=-0.001  Sum_probs=6.6

Q ss_pred             CCCCCCCCCc
Q psy11364         26 SSSIPGSSKT   35 (101)
Q Consensus        26 ~c~~c~~~~~   35 (101)
                      .|+.||..|.
T Consensus         3 tCP~C~~~~~   12 (128)
T PF14353_consen    3 TCPHCGHEFE   12 (128)
T ss_pred             CCCCCCCeeE
Confidence            5777777653


No 92 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=65.42  E-value=2.8  Score=26.89  Aligned_cols=21  Identities=24%  Similarity=0.572  Sum_probs=15.0

Q ss_pred             CcccccCccccCChHHHhccc
Q psy11364         80 FYACSSCSHVSRSRDALRKHD  100 (101)
Q Consensus        80 p~~C~~C~k~f~~~~~l~~H~  100 (101)
                      -|.|.+|+|.|.-...+.+|+
T Consensus        77 K~~C~lc~KlFkg~eFV~KHI   97 (214)
T PF04959_consen   77 KWRCPLCGKLFKGPEFVRKHI   97 (214)
T ss_dssp             EEEE-SSS-EESSHHHHHHHH
T ss_pred             EECCCCCCcccCChHHHHHHH
Confidence            488888888888887777775


No 93 
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=64.98  E-value=5.5  Score=24.18  Aligned_cols=16  Identities=19%  Similarity=0.573  Sum_probs=10.5

Q ss_pred             ceecccchhhcCCHHH
Q psy11364         53 FATCFVCGKQLSNQYN   68 (101)
Q Consensus        53 ~~~C~~c~~~~~~~~~   68 (101)
                      .-.|..|+..|.+-..
T Consensus        28 RReC~~C~~RFTTfE~   43 (156)
T COG1327          28 RRECLECGERFTTFER   43 (156)
T ss_pred             hhcccccccccchhhe
Confidence            3467777777766554


No 94 
>KOG4167|consensus
Probab=64.16  E-value=2.3  Score=32.16  Aligned_cols=26  Identities=31%  Similarity=0.478  Sum_probs=23.4

Q ss_pred             cceecccchhhcCCHHHHHHHHHhhC
Q psy11364         52 LFATCFVCGKQLSNQYNLRVHMETHQ   77 (101)
Q Consensus        52 ~~~~C~~c~~~~~~~~~l~~h~~~h~   77 (101)
                      --|.|..|+|.|.....+..||+.|.
T Consensus       791 giFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  791 GIFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             ceeehHHHHHHHHHHhhhhHHHHHHH
Confidence            34899999999999999999999886


No 95 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=63.78  E-value=5  Score=16.74  Aligned_cols=13  Identities=15%  Similarity=-0.136  Sum_probs=9.3

Q ss_pred             CCCCCCCCCCCCc
Q psy11364         23 SPLSSSIPGSSKT   35 (101)
Q Consensus        23 ~~~~c~~c~~~~~   35 (101)
                      ..-.|+.||..|.
T Consensus        13 ~~~~Cp~CG~~F~   25 (26)
T PF10571_consen   13 SAKFCPHCGYDFE   25 (26)
T ss_pred             hcCcCCCCCCCCc
Confidence            3557888888774


No 96 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=62.57  E-value=5.9  Score=23.47  Aligned_cols=25  Identities=32%  Similarity=0.801  Sum_probs=16.3

Q ss_pred             CcceecccchhhcCCHHHHHHHHHhhCC
Q psy11364         51 KLFATCFVCGKQLSNQYNLRVHMETHQN   78 (101)
Q Consensus        51 ~~~~~C~~c~~~~~~~~~l~~h~~~h~~   78 (101)
                      +....|-.||+.|..   |++|++.|.|
T Consensus        70 ~d~i~clecGk~~k~---LkrHL~~~~g   94 (132)
T PF05443_consen   70 PDYIICLECGKKFKT---LKRHLRTHHG   94 (132)
T ss_dssp             SS-EE-TBT--EESB---HHHHHHHTT-
T ss_pred             cCeeEEccCCcccch---HHHHHHHccC
Confidence            455789999999987   5899998854


No 97 
>PLN02294 cytochrome c oxidase subunit Vb
Probab=62.39  E-value=3.6  Score=25.45  Aligned_cols=22  Identities=14%  Similarity=0.339  Sum_probs=16.3

Q ss_pred             HHHHhhCCCCcccccCccccCC
Q psy11364         71 VHMETHQNAFYACSSCSHVSRS   92 (101)
Q Consensus        71 ~h~~~h~~kp~~C~~C~k~f~~   92 (101)
                      .++.++.++|++|++||..|.-
T Consensus       132 ~Wf~L~kGkp~RCpeCG~~fkL  153 (174)
T PLN02294        132 VWFWLEKGKSFECPVCTQYFEL  153 (174)
T ss_pred             EEEEecCCCceeCCCCCCEEEE
Confidence            3444555699999999988753


No 98 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=62.03  E-value=3  Score=18.38  Aligned_cols=9  Identities=33%  Similarity=0.922  Sum_probs=3.9

Q ss_pred             CcccccCcc
Q psy11364         80 FYACSSCSH   88 (101)
Q Consensus        80 p~~C~~C~k   88 (101)
                      +..|..||.
T Consensus        17 ~irC~~CG~   25 (32)
T PF03604_consen   17 PIRCPECGH   25 (32)
T ss_dssp             TSSBSSSS-
T ss_pred             cEECCcCCC
Confidence            344555543


No 99 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=61.93  E-value=3.3  Score=18.70  Aligned_cols=11  Identities=36%  Similarity=1.056  Sum_probs=7.8

Q ss_pred             cccccCccccC
Q psy11364         81 YACSSCSHVSR   91 (101)
Q Consensus        81 ~~C~~C~k~f~   91 (101)
                      |.|..||..|.
T Consensus         6 y~C~~Cg~~fe   16 (41)
T smart00834        6 YRCEDCGHTFE   16 (41)
T ss_pred             EEcCCCCCEEE
Confidence            67777877664


No 100
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=61.03  E-value=3.9  Score=19.57  Aligned_cols=20  Identities=30%  Similarity=0.526  Sum_probs=11.9

Q ss_pred             eecccchhhcCCHHHHHHHH
Q psy11364         54 ATCFVCGKQLSNQYNLRVHM   73 (101)
Q Consensus        54 ~~C~~c~~~~~~~~~l~~h~   73 (101)
                      |.|-.|.-....++.|-.||
T Consensus        21 ykcfqcpftc~~kshl~nhm   40 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHM   40 (54)
T ss_pred             ceeecCCcccchHHHHHHHH
Confidence            45666665555566666555


No 101
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=60.19  E-value=3.9  Score=22.89  Aligned_cols=20  Identities=25%  Similarity=0.445  Sum_probs=15.0

Q ss_pred             HHHhhCCCCcccccCccccC
Q psy11364         72 HMETHQNAFYACSSCSHVSR   91 (101)
Q Consensus        72 h~~~h~~kp~~C~~C~k~f~   91 (101)
                      ++.++.++|++|..||..|.
T Consensus        71 W~~l~~g~~~rC~eCG~~fk   90 (97)
T cd00924          71 WMWLEKGKPKRCPECGHVFK   90 (97)
T ss_pred             EEEEeCCCceeCCCCCcEEE
Confidence            34445568999999998875


No 102
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=59.45  E-value=9.5  Score=24.52  Aligned_cols=25  Identities=24%  Similarity=0.344  Sum_probs=20.4

Q ss_pred             CcceecccchhhcCCHHHHHHHHHh
Q psy11364         51 KLFATCFVCGKQLSNQYNLRVHMET   75 (101)
Q Consensus        51 ~~~~~C~~c~~~~~~~~~l~~h~~~   75 (101)
                      +..|.|..|+|.|....-+..|+..
T Consensus        75 ~~K~~C~lc~KlFkg~eFV~KHI~n   99 (214)
T PF04959_consen   75 EDKWRCPLCGKLFKGPEFVRKHIFN   99 (214)
T ss_dssp             SEEEEE-SSS-EESSHHHHHHHHHH
T ss_pred             CCEECCCCCCcccCChHHHHHHHhh
Confidence            5569999999999999999999875


No 103
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=58.62  E-value=3.9  Score=19.00  Aligned_cols=11  Identities=36%  Similarity=0.990  Sum_probs=7.4

Q ss_pred             cccccCccccC
Q psy11364         81 YACSSCSHVSR   91 (101)
Q Consensus        81 ~~C~~C~k~f~   91 (101)
                      |.|..||..|.
T Consensus         6 y~C~~Cg~~fe   16 (42)
T PF09723_consen    6 YRCEECGHEFE   16 (42)
T ss_pred             EEeCCCCCEEE
Confidence            66777776664


No 104
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=58.59  E-value=2.4  Score=19.47  Aligned_cols=12  Identities=42%  Similarity=1.021  Sum_probs=8.1

Q ss_pred             cceecccchhhc
Q psy11364         52 LFATCFVCGKQL   63 (101)
Q Consensus        52 ~~~~C~~c~~~~   63 (101)
                      .-|.|..|+..|
T Consensus        27 ~fy~C~~C~~~w   38 (39)
T PF01096_consen   27 LFYVCCNCGHRW   38 (39)
T ss_dssp             EEEEESSSTEEE
T ss_pred             EEEEeCCCCCee
Confidence            347788887654


No 105
>KOG2785|consensus
Probab=57.37  E-value=13  Score=26.06  Aligned_cols=50  Identities=22%  Similarity=0.378  Sum_probs=39.8

Q ss_pred             cceecccchhhcCCHHHHHHHHHhhC------------------------CCCcccccCc---cccCChHHHhcccC
Q psy11364         52 LFATCFVCGKQLSNQYNLRVHMETHQ------------------------NAFYACSSCS---HVSRSRDALRKHDK  101 (101)
Q Consensus        52 ~~~~C~~c~~~~~~~~~l~~h~~~h~------------------------~kp~~C~~C~---k~f~~~~~l~~H~~  101 (101)
                      .|-.|-.|++.+..-..-..||-.+.                        +.-+.|..|.   +.|......+.||.
T Consensus       165 ~Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~  241 (390)
T KOG2785|consen  165 IPTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMR  241 (390)
T ss_pred             CCcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHh
Confidence            45678889998888888888887654                        2467898998   89999999998873


No 106
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=56.73  E-value=19  Score=17.51  Aligned_cols=13  Identities=23%  Similarity=0.094  Sum_probs=8.6

Q ss_pred             CCCCCCCCCCccC
Q psy11364         25 LSSSIPGSSKTKA   37 (101)
Q Consensus        25 ~~c~~c~~~~~~~   37 (101)
                      |.|..||..+...
T Consensus         2 y~C~~CgyiYd~~   14 (50)
T cd00730           2 YECRICGYIYDPA   14 (50)
T ss_pred             cCCCCCCeEECCC
Confidence            5677777766544


No 107
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=56.67  E-value=11  Score=27.19  Aligned_cols=10  Identities=30%  Similarity=0.574  Sum_probs=5.8

Q ss_pred             cceecccchh
Q psy11364         52 LFATCFVCGK   61 (101)
Q Consensus        52 ~~~~C~~c~~   61 (101)
                      +...|..||.
T Consensus       239 ~~l~Ch~Cg~  248 (505)
T TIGR00595       239 GKLRCHYCGY  248 (505)
T ss_pred             CeEEcCCCcC
Confidence            3456666663


No 108
>PF10537 WAC_Acf1_DNA_bd:  ATP-utilising chromatin assembly and remodelling N-terminal;  InterPro: IPR013136 ACF (for ATP-utilising chromatin assembly and remodeling factor) is a chromatin-remodeling complex that catalyzes the ATP-dependent assembly of periodic nucleosome arrays. This reaction utilises the energy of ATP hydrolysis by ISWI, the smaller of the two subunits of ACF. Acf1, the large subunit of ACF, is essential for the full activity of the complex. The WAC (WSTF/Acf1/cbp146) domain is an ~110-residue module present at the N-termini of Acf1-related proteins in a variety of organisms. It is found in association with other domains such as the bromodomain, the PHD-type zinc finger, DDT or WAKS. The DNA-binding region of Acf1 includes the WAC domain, which is necessary for the efficient binding of ACF complex to DNA. It seems probable that the WAC domain will be involved in DNA binding in other related factors [, ].   Some proteins known to contain a WAC domain are the Drosophila melanogaster (Fruit fly) ATP-dependent chromatin assembly factor large subunit Acf1, human WSTF (Williams syndrome transcription factor), mouse cbp146, yeast imitation switch two complex protein 1 (ITC1 or YGL133w), and yeast protein YPL216w. 
Probab=55.98  E-value=21  Score=20.12  Aligned_cols=38  Identities=8%  Similarity=0.037  Sum_probs=25.9

Q ss_pred             cceecccchhhcCCHHHHHHHHHhhCCCCcccccCccc
Q psy11364         52 LFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHV   89 (101)
Q Consensus        52 ~~~~C~~c~~~~~~~~~l~~h~~~h~~kp~~C~~C~k~   89 (101)
                      ..|.|+.-+..|..-......+.....+-+.|...|+.
T Consensus         2 eVf~i~~T~EiF~dYe~Y~~R~~~y~~~vwtC~~TGk~   39 (102)
T PF10537_consen    2 EVFYIPFTGEIFRDYEEYLKRMILYNQRVWTCEITGKS   39 (102)
T ss_pred             ceEEeCCCCcccCCHHHHHHHHHHHhCCeeEEecCCCC
Confidence            34667777777777777766666555567777777764


No 109
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=55.46  E-value=3.3  Score=17.70  Aligned_cols=8  Identities=38%  Similarity=0.783  Sum_probs=3.7

Q ss_pred             cccCcccc
Q psy11364         83 CSSCSHVS   90 (101)
Q Consensus        83 C~~C~k~f   90 (101)
                      |..|++.|
T Consensus         3 CiDC~~~F   10 (28)
T PF08790_consen    3 CIDCSKDF   10 (28)
T ss_dssp             ETTTTEEE
T ss_pred             eecCCCCc
Confidence            44444444


No 110
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=52.25  E-value=7.1  Score=17.89  Aligned_cols=14  Identities=14%  Similarity=0.508  Sum_probs=10.0

Q ss_pred             CcccccCccccCCh
Q psy11364         80 FYACSSCSHVSRSR   93 (101)
Q Consensus        80 p~~C~~C~k~f~~~   93 (101)
                      |+.|..|++.|-..
T Consensus        12 ~f~C~~C~~~FC~~   25 (39)
T smart00154       12 GFKCRHCGNLFCGE   25 (39)
T ss_pred             CeECCccCCccccc
Confidence            77788887777543


No 111
>KOG2593|consensus
Probab=52.11  E-value=9.9  Score=27.01  Aligned_cols=18  Identities=39%  Similarity=0.658  Sum_probs=11.3

Q ss_pred             CCcccccCccccCChHHH
Q psy11364         79 AFYACSSCSHVSRSRDAL   96 (101)
Q Consensus        79 kp~~C~~C~k~f~~~~~l   96 (101)
                      ..|.|+.|.+.|.....+
T Consensus       127 ~~Y~Cp~C~kkyt~Lea~  144 (436)
T KOG2593|consen  127 AGYVCPNCQKKYTSLEAL  144 (436)
T ss_pred             ccccCCccccchhhhHHH
Confidence            567777777766655443


No 112
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=51.63  E-value=6.1  Score=18.98  Aligned_cols=11  Identities=36%  Similarity=1.053  Sum_probs=7.2

Q ss_pred             cccccCccccC
Q psy11364         81 YACSSCSHVSR   91 (101)
Q Consensus        81 ~~C~~C~k~f~   91 (101)
                      |.|..||..|.
T Consensus         6 y~C~~Cg~~fe   16 (52)
T TIGR02605         6 YRCTACGHRFE   16 (52)
T ss_pred             EEeCCCCCEeE
Confidence            56777776554


No 113
>PRK04023 DNA polymerase II large subunit; Validated
Probab=51.42  E-value=21  Score=28.43  Aligned_cols=11  Identities=9%  Similarity=-0.000  Sum_probs=6.9

Q ss_pred             CCCCCCCCCCC
Q psy11364         23 SPLSSSIPGSS   33 (101)
Q Consensus        23 ~~~~c~~c~~~   33 (101)
                      ....|+.||..
T Consensus       625 g~RfCpsCG~~  635 (1121)
T PRK04023        625 GRRKCPSCGKE  635 (1121)
T ss_pred             cCccCCCCCCc
Confidence            35667777764


No 114
>KOG4173|consensus
Probab=51.38  E-value=6.3  Score=25.28  Aligned_cols=46  Identities=20%  Similarity=0.512  Sum_probs=26.2

Q ss_pred             ecccchhhcCCHHHHHHHHH-hhC---------C-CCccc--ccCccccCChHHHhccc
Q psy11364         55 TCFVCGKQLSNQYNLRVHME-THQ---------N-AFYAC--SSCSHVSRSRDALRKHD  100 (101)
Q Consensus        55 ~C~~c~~~~~~~~~l~~h~~-~h~---------~-kp~~C--~~C~k~f~~~~~l~~H~  100 (101)
                      .|..|.++|.+..-|..|+- +|.         | --|.|  +.|+-.|.+......|+
T Consensus       108 sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~KFkT~r~RkdH~  166 (253)
T KOG4173|consen  108 SCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEKFKTSRDRKDHM  166 (253)
T ss_pred             hhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhhhhhhhhhhhHH
Confidence            56667777766666666643 232         3 34666  33666666655555443


No 115
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=51.29  E-value=18  Score=18.31  Aligned_cols=34  Identities=24%  Similarity=0.343  Sum_probs=20.2

Q ss_pred             CCCCCCCCCCCccCCCCCCCCCCCCCCCcceecccchhhcCCHHH
Q psy11364         24 PLSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQLSNQYN   68 (101)
Q Consensus        24 ~~~c~~c~~~~~~~~~~~~~~~~~~~~~~~~~C~~c~~~~~~~~~   68 (101)
                      +-.|+.||..-..           ....+.|.|+.||......-+
T Consensus        28 Sq~C~~CG~~~~~-----------~~~~r~~~C~~Cg~~~~rD~n   61 (69)
T PF07282_consen   28 SQTCPRCGHRNKK-----------RRSGRVFTCPNCGFEMDRDVN   61 (69)
T ss_pred             ccCccCccccccc-----------ccccceEEcCCCCCEECcHHH
Confidence            4557777753322           123566888888877655443


No 116
>PHA02998 RNA polymerase subunit; Provisional
Probab=50.97  E-value=9.9  Score=23.80  Aligned_cols=14  Identities=21%  Similarity=0.425  Sum_probs=8.7

Q ss_pred             ceecccchhhcCCH
Q psy11364         53 FATCFVCGKQLSNQ   66 (101)
Q Consensus        53 ~~~C~~c~~~~~~~   66 (101)
                      .|.|..|++.|..+
T Consensus       171 FYkC~~CG~~wkpp  184 (195)
T PHA02998        171 RHACRDCKKHFKPP  184 (195)
T ss_pred             EEEcCCCCCccCCc
Confidence            36677777666543


No 117
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=50.91  E-value=7.1  Score=16.91  Aligned_cols=9  Identities=33%  Similarity=0.936  Sum_probs=4.7

Q ss_pred             ceecccchh
Q psy11364         53 FATCFVCGK   61 (101)
Q Consensus        53 ~~~C~~c~~   61 (101)
                      .+.|+.|+.
T Consensus        19 ~~vCp~C~~   27 (30)
T PF08274_consen   19 LLVCPECGH   27 (30)
T ss_dssp             SEEETTTTE
T ss_pred             EEeCCcccc
Confidence            355555543


No 118
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=49.48  E-value=5  Score=18.68  Aligned_cols=15  Identities=13%  Similarity=0.406  Sum_probs=8.0

Q ss_pred             CCcccccCccccCCh
Q psy11364         79 AFYACSSCSHVSRSR   93 (101)
Q Consensus        79 kp~~C~~C~k~f~~~   93 (101)
                      .|+.|..|++.|-..
T Consensus        12 ~~~~C~~C~~~FC~~   26 (43)
T PF01428_consen   12 LPFKCKHCGKSFCLK   26 (43)
T ss_dssp             SHEE-TTTS-EE-TT
T ss_pred             CCeECCCCCcccCcc
Confidence            367777777777543


No 119
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=49.30  E-value=15  Score=17.88  Aligned_cols=10  Identities=30%  Similarity=0.451  Sum_probs=6.1

Q ss_pred             ceecccchhh
Q psy11364         53 FATCFVCGKQ   62 (101)
Q Consensus        53 ~~~C~~c~~~   62 (101)
                      .+.|..|+..
T Consensus        37 r~~C~~Cgyt   46 (50)
T PRK00432         37 RWHCGKCGYT   46 (50)
T ss_pred             cEECCCcCCE
Confidence            4667777643


No 120
>PRK14873 primosome assembly protein PriA; Provisional
Probab=49.14  E-value=14  Score=27.84  Aligned_cols=46  Identities=15%  Similarity=0.277  Sum_probs=25.0

Q ss_pred             CCCCCCCCCCCccCCC---CCCCCCCCCCCCcceecccchhhcCCHHHHHHHHHhhCCCCcccccCccc
Q psy11364         24 PLSSSIPGSSKTKASG---SGTTGGSSNHSKLFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHV   89 (101)
Q Consensus        24 ~~~c~~c~~~~~~~~~---~~~~~~~~~~~~~~~~C~~c~~~~~~~~~l~~h~~~h~~kp~~C~~C~k~   89 (101)
                      -..|..||........   +..|.     ..+...|..||...               .|..|+.||..
T Consensus       383 ~l~C~~Cg~~~~C~~C~~~L~~h~-----~~~~l~Ch~CG~~~---------------~p~~Cp~Cgs~  431 (665)
T PRK14873        383 SLACARCRTPARCRHCTGPLGLPS-----AGGTPRCRWCGRAA---------------PDWRCPRCGSD  431 (665)
T ss_pred             eeEhhhCcCeeECCCCCCceeEec-----CCCeeECCCCcCCC---------------cCccCCCCcCC
Confidence            3466666665544322   22221     23456788887421               26678888754


No 121
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=48.80  E-value=9.6  Score=21.76  Aligned_cols=26  Identities=23%  Similarity=0.571  Sum_probs=16.7

Q ss_pred             ceecccchhhcCCHHHHHHHHHhhCCCCcccccCccc
Q psy11364         53 FATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHV   89 (101)
Q Consensus        53 ~~~C~~c~~~~~~~~~l~~h~~~h~~kp~~C~~C~k~   89 (101)
                      ...|..|+..|.....           .+.|+.||..
T Consensus        70 ~~~C~~Cg~~~~~~~~-----------~~~CP~Cgs~   95 (113)
T PF01155_consen   70 RARCRDCGHEFEPDEF-----------DFSCPRCGSP   95 (113)
T ss_dssp             EEEETTTS-EEECHHC-----------CHH-SSSSSS
T ss_pred             cEECCCCCCEEecCCC-----------CCCCcCCcCC
Confidence            3679999988866442           3568888864


No 122
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=48.33  E-value=5.8  Score=23.48  Aligned_cols=14  Identities=29%  Similarity=0.548  Sum_probs=8.8

Q ss_pred             cceecccchhhcCC
Q psy11364         52 LFATCFVCGKQLSN   65 (101)
Q Consensus        52 ~~~~C~~c~~~~~~   65 (101)
                      ..+.|..||..|..
T Consensus        69 ~~~~C~~CG~~~~~   82 (135)
T PRK03824         69 AVLKCRNCGNEWSL   82 (135)
T ss_pred             eEEECCCCCCEEec
Confidence            34677777766654


No 123
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Probab=47.05  E-value=22  Score=24.16  Aligned_cols=10  Identities=20%  Similarity=0.052  Sum_probs=7.5

Q ss_pred             CCCCCCCCCC
Q psy11364         24 PLSSSIPGSS   33 (101)
Q Consensus        24 ~~~c~~c~~~   33 (101)
                      .-.|+.||..
T Consensus       184 ~~~CPvCGs~  193 (305)
T TIGR01562       184 RTLCPACGSP  193 (305)
T ss_pred             CCcCCCCCCh
Confidence            4579999963


No 124
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=46.06  E-value=19  Score=21.31  Aligned_cols=17  Identities=18%  Similarity=0.374  Sum_probs=11.9

Q ss_pred             CcceecccchhhcCCHH
Q psy11364         51 KLFATCFVCGKQLSNQY   67 (101)
Q Consensus        51 ~~~~~C~~c~~~~~~~~   67 (101)
                      +-|-.|.-||+.|..-.
T Consensus        66 e~psfchncgs~fpwte   82 (160)
T COG4306          66 EPPSFCHNCGSRFPWTE   82 (160)
T ss_pred             CCcchhhcCCCCCCcHH
Confidence            45567888888876644


No 125
>KOG2907|consensus
Probab=45.21  E-value=8.2  Score=22.23  Aligned_cols=37  Identities=19%  Similarity=0.556  Sum_probs=22.7

Q ss_pred             eecccchhhcCCHHHHHHHHHh-hCC--CCcccccCccccCC
Q psy11364         54 ATCFVCGKQLSNQYNLRVHMET-HQN--AFYACSSCSHVSRS   92 (101)
Q Consensus        54 ~~C~~c~~~~~~~~~l~~h~~~-h~~--kp~~C~~C~k~f~~   92 (101)
                      ..|+.||..-..-..  ..+|. ..|  .-|.|+.|+..|..
T Consensus        75 ~kCpkCghe~m~Y~T--~QlRSADEGQTVFYTC~kC~~k~~e  114 (116)
T KOG2907|consen   75 HKCPKCGHEEMSYHT--LQLRSADEGQTVFYTCPKCKYKFTE  114 (116)
T ss_pred             ccCcccCCchhhhhh--hhcccccCCceEEEEcCccceeeec
Confidence            679999843222222  22333 334  68999999988864


No 126
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=44.63  E-value=13  Score=21.30  Aligned_cols=13  Identities=38%  Similarity=0.914  Sum_probs=9.1

Q ss_pred             CCcccccCccccC
Q psy11364         79 AFYACSSCSHVSR   91 (101)
Q Consensus        79 kp~~C~~C~k~f~   91 (101)
                      .-|.|..||..|+
T Consensus        99 ~Fy~C~~Cg~~wr  111 (113)
T COG1594          99 RFYKCTRCGYRWR  111 (113)
T ss_pred             EEEEecccCCEee
Confidence            5677877876654


No 127
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=44.52  E-value=15  Score=21.17  Aligned_cols=13  Identities=15%  Similarity=-0.028  Sum_probs=8.2

Q ss_pred             Ccceecccchhhc
Q psy11364         51 KLFATCFVCGKQL   63 (101)
Q Consensus        51 ~~~~~C~~c~~~~   63 (101)
                      +.|..|+.||+.|
T Consensus        24 rdPiVsPytG~s~   36 (129)
T COG4530          24 RDPIVSPYTGKSY   36 (129)
T ss_pred             CCccccCcccccc
Confidence            4556666666666


No 128
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=43.46  E-value=13  Score=17.43  Aligned_cols=12  Identities=25%  Similarity=0.534  Sum_probs=6.0

Q ss_pred             ccccCccccCCh
Q psy11364         82 ACSSCSHVSRSR   93 (101)
Q Consensus        82 ~C~~C~k~f~~~   93 (101)
                      .|.+||+.|++.
T Consensus        10 ~C~~C~rpf~WR   21 (42)
T PF10013_consen   10 ICPVCGRPFTWR   21 (42)
T ss_pred             cCcccCCcchHH
Confidence            355555555543


No 129
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=43.40  E-value=4.3  Score=22.42  Aligned_cols=10  Identities=30%  Similarity=0.551  Sum_probs=6.2

Q ss_pred             eecccchhhc
Q psy11364         54 ATCFVCGKQL   63 (101)
Q Consensus        54 ~~C~~c~~~~   63 (101)
                      |.|..|++.|
T Consensus        55 W~C~~C~~~~   64 (90)
T PTZ00255         55 WRCKGCKKTV   64 (90)
T ss_pred             EEcCCCCCEE
Confidence            6666666544


No 130
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=43.38  E-value=6.8  Score=19.65  Aligned_cols=7  Identities=29%  Similarity=0.605  Sum_probs=3.5

Q ss_pred             eecccch
Q psy11364         54 ATCFVCG   60 (101)
Q Consensus        54 ~~C~~c~   60 (101)
                      |-|..|.
T Consensus        32 YmC~eC~   38 (56)
T PF09963_consen   32 YMCDECK   38 (56)
T ss_pred             eeChhHH
Confidence            5555553


No 131
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=42.51  E-value=8.9  Score=18.68  Aligned_cols=15  Identities=13%  Similarity=0.257  Sum_probs=8.6

Q ss_pred             CCcccccCccccCCh
Q psy11364         79 AFYACSSCSHVSRSR   93 (101)
Q Consensus        79 kp~~C~~C~k~f~~~   93 (101)
                      +.+.|..||..|...
T Consensus         3 k~l~C~dCg~~FvfT   17 (49)
T PF13451_consen    3 KTLTCKDCGAEFVFT   17 (49)
T ss_pred             eeEEcccCCCeEEEe
Confidence            345666666665543


No 132
>PF10071 DUF2310:  Zn-ribbon-containing, possibly nucleic-acid-binding protein (DUF2310);  InterPro: IPR016908 This group represents uncharacterised conserved proteins.
Probab=42.35  E-value=34  Score=22.76  Aligned_cols=51  Identities=16%  Similarity=0.083  Sum_probs=31.4

Q ss_pred             cccccceeeeeeeccccC--CCCCCCCCCCCCCccCCCCCCCCCCCCCCCcceecccchhh
Q psy11364          4 NYKRSTLHFLISVSDHCL--TSPLSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQ   62 (101)
Q Consensus         4 ~~~~~~~~~~~~~~~~~~--~~~~~c~~c~~~~~~~~~~~~~~~~~~~~~~~~~C~~c~~~   62 (101)
                      .+..+++.|+..+.....  ...-.||.||..+.-..++        ..---|+|..|.-+
T Consensus       198 ~T~iPtYYyLyrv~g~~~~~e~~r~CP~Cg~~W~L~~pl--------h~iFdFKCD~CRLV  250 (258)
T PF10071_consen  198 LTGIPTYYYLYRVGGESLASEQARKCPSCGGDWRLKEPL--------HDIFDFKCDPCRLV  250 (258)
T ss_pred             HhCCCeEEEEEEccCcchHHhhCCCCCCCCCccccCCch--------hhceeccCCcceee
Confidence            356677777777654432  2477888888877555443        12344778877543


No 133
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=41.49  E-value=34  Score=15.74  Aligned_cols=24  Identities=29%  Similarity=0.567  Sum_probs=15.8

Q ss_pred             eecccchhhcC--CHHHHHHHHHhhC
Q psy11364         54 ATCFVCGKQLS--NQYNLRVHMETHQ   77 (101)
Q Consensus        54 ~~C~~c~~~~~--~~~~l~~h~~~h~   77 (101)
                      -.|..||..|.  .+.....|.+.|.
T Consensus        14 ~~C~~CgM~Y~~~~~eD~~~H~~yH~   39 (41)
T PF13878_consen   14 TTCPTCGMLYSPGSPEDEKLHKKYHD   39 (41)
T ss_pred             cCCCCCCCEECCCCHHHHHHHHHHHh
Confidence            47999997654  4455666766554


No 134
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=41.46  E-value=36  Score=19.27  Aligned_cols=37  Identities=19%  Similarity=0.367  Sum_probs=17.3

Q ss_pred             CCCCCCCCCCCccCCCCCCCCCCCCCCCcceecccch
Q psy11364         24 PLSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCG   60 (101)
Q Consensus        24 ~~~c~~c~~~~~~~~~~~~~~~~~~~~~~~~~C~~c~   60 (101)
                      |-.|+-||..-...+...........+.-.|.|..|+
T Consensus         2 p~~CpYCg~~~~l~~~~~iYg~~~~~~~~~y~C~~C~   38 (102)
T PF11672_consen    2 PIICPYCGGPAELVDGSEIYGHRYDDGPYLYVCTPCD   38 (102)
T ss_pred             CcccCCCCCeeEEcccchhcCccCCCCceeEECCCCC
Confidence            4567778764333222222222222223337787775


No 135
>PRK12496 hypothetical protein; Provisional
Probab=41.24  E-value=15  Score=22.44  Aligned_cols=29  Identities=21%  Similarity=0.464  Sum_probs=18.6

Q ss_pred             cceecccchhhcCCHHHHHHHHHhhCCCCcccccCccccC
Q psy11364         52 LFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHVSR   91 (101)
Q Consensus        52 ~~~~C~~c~~~~~~~~~l~~h~~~h~~kp~~C~~C~k~f~   91 (101)
                      ..+.|..|++.|....           ..-.|+.||....
T Consensus       126 w~~~C~gC~~~~~~~~-----------~~~~C~~CG~~~~  154 (164)
T PRK12496        126 WRKVCKGCKKKYPEDY-----------PDDVCEICGSPVK  154 (164)
T ss_pred             eeEECCCCCccccCCC-----------CCCcCCCCCChhh
Confidence            3478999998875321           1135899986543


No 136
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=41.24  E-value=12  Score=22.74  Aligned_cols=34  Identities=18%  Similarity=0.420  Sum_probs=19.8

Q ss_pred             cceecccchhhcCCHHHHHHHHHhhCCCCcccccCccc
Q psy11364         52 LFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHV   89 (101)
Q Consensus        52 ~~~~C~~c~~~~~~~~~l~~h~~~h~~kp~~C~~C~k~   89 (101)
                      -+|.|. |+..+....   +|-.+-.|+-|.|..|+..
T Consensus       116 ~~Y~C~-C~q~~l~~R---Rhn~~~~g~~YrC~~C~gk  149 (156)
T COG3091         116 YPYRCQ-CQQHYLRIR---RHNTVRRGEVYRCGKCGGK  149 (156)
T ss_pred             eeEEee-cCCccchhh---hcccccccceEEeccCCce
Confidence            357887 887754432   3322222346888888754


No 137
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=41.06  E-value=31  Score=19.33  Aligned_cols=24  Identities=21%  Similarity=0.412  Sum_probs=19.9

Q ss_pred             eec----ccchhhcCCHHHHHHHHHhhC
Q psy11364         54 ATC----FVCGKQLSNQYNLRVHMETHQ   77 (101)
Q Consensus        54 ~~C----~~c~~~~~~~~~l~~h~~~h~   77 (101)
                      |.|    ..|+........+..|.+.+.
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~H  108 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEH  108 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhc
Confidence            788    889999999999999887643


No 138
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=41.02  E-value=13  Score=24.24  Aligned_cols=18  Identities=17%  Similarity=0.573  Sum_probs=13.9

Q ss_pred             hhCCCCcccccCccccCC
Q psy11364         75 THQNAFYACSSCSHVSRS   92 (101)
Q Consensus        75 ~h~~kp~~C~~C~k~f~~   92 (101)
                      ++.+++.+|..||..|.-
T Consensus       176 LrEGkpqRCpECGqVFKL  193 (268)
T PTZ00043        176 CREGFLYRCGECDQIFML  193 (268)
T ss_pred             ecCCCCccCCCCCcEEEE
Confidence            344589999999988753


No 139
>KOG2071|consensus
Probab=40.86  E-value=19  Score=26.64  Aligned_cols=27  Identities=22%  Similarity=0.461  Sum_probs=23.0

Q ss_pred             CcceecccchhhcCCHHHHHHHHHhhC
Q psy11364         51 KLFATCFVCGKQLSNQYNLRVHMETHQ   77 (101)
Q Consensus        51 ~~~~~C~~c~~~~~~~~~l~~h~~~h~   77 (101)
                      ..+..|..||..|........||..|.
T Consensus       416 ~~pnqC~~CG~R~~~~ee~sk~md~H~  442 (579)
T KOG2071|consen  416 DSPNQCKSCGLRFDDSEERSKHMDIHD  442 (579)
T ss_pred             CCcchhcccccccccchhhhhHhhhhh
Confidence            456889999999999998888888776


No 140
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=40.40  E-value=36  Score=16.02  Aligned_cols=12  Identities=25%  Similarity=0.456  Sum_probs=8.0

Q ss_pred             ceecccchhhcC
Q psy11364         53 FATCFVCGKQLS   64 (101)
Q Consensus        53 ~~~C~~c~~~~~   64 (101)
                      .+.|+.|+..+.
T Consensus        20 ~~vC~~Cg~~~~   31 (52)
T smart00661       20 RFVCRKCGYEEP   31 (52)
T ss_pred             EEECCcCCCeEE
Confidence            577888885443


No 141
>PRK05580 primosome assembly protein PriA; Validated
Probab=40.38  E-value=29  Score=26.19  Aligned_cols=8  Identities=38%  Similarity=0.953  Sum_probs=4.1

Q ss_pred             ceecccch
Q psy11364         53 FATCFVCG   60 (101)
Q Consensus        53 ~~~C~~c~   60 (101)
                      ...|..||
T Consensus       408 ~l~Ch~Cg  415 (679)
T PRK05580        408 RLRCHHCG  415 (679)
T ss_pred             eEECCCCc
Confidence            34555555


No 142
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=40.12  E-value=14  Score=21.16  Aligned_cols=25  Identities=20%  Similarity=0.441  Sum_probs=15.2

Q ss_pred             ceecccchhhcCCHHHHHHHHHhhCCCCcccccCcc
Q psy11364         53 FATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSH   88 (101)
Q Consensus        53 ~~~C~~c~~~~~~~~~l~~h~~~h~~kp~~C~~C~k   88 (101)
                      ...|..|+..|....           ..+.|+.||.
T Consensus        70 ~~~C~~Cg~~~~~~~-----------~~~~CP~Cgs   94 (113)
T PRK12380         70 QAWCWDCSQVVEIHQ-----------HDAQCPHCHG   94 (113)
T ss_pred             EEEcccCCCEEecCC-----------cCccCcCCCC
Confidence            367888886654422           2345888874


No 143
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=39.36  E-value=30  Score=21.40  Aligned_cols=20  Identities=30%  Similarity=0.442  Sum_probs=10.9

Q ss_pred             ceecccchhhcCCHHHHHHH
Q psy11364         53 FATCFVCGKQLSNQYNLRVH   72 (101)
Q Consensus        53 ~~~C~~c~~~~~~~~~l~~h   72 (101)
                      .+.|+.||+.|...++...-
T Consensus       130 f~~C~~CgkiYW~GsHw~~m  149 (165)
T COG1656         130 FYRCPKCGKIYWKGSHWRRM  149 (165)
T ss_pred             eeECCCCcccccCchHHHHH
Confidence            34566666666555555433


No 144
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=39.24  E-value=11  Score=18.36  Aligned_cols=12  Identities=17%  Similarity=0.534  Sum_probs=6.2

Q ss_pred             ccccCccccCCh
Q psy11364         82 ACSSCSHVSRSR   93 (101)
Q Consensus        82 ~C~~C~k~f~~~   93 (101)
                      .|++|++.|...
T Consensus        22 ~CPlC~r~l~~e   33 (54)
T PF04423_consen   22 CCPLCGRPLDEE   33 (54)
T ss_dssp             E-TTT--EE-HH
T ss_pred             cCCCCCCCCCHH
Confidence            899999888643


No 145
>KOG3408|consensus
Probab=39.24  E-value=12  Score=21.94  Aligned_cols=23  Identities=17%  Similarity=0.369  Sum_probs=16.1

Q ss_pred             CcceecccchhhcCCHHHHHHHH
Q psy11364         51 KLFATCFVCGKQLSNQYNLRVHM   73 (101)
Q Consensus        51 ~~~~~C~~c~~~~~~~~~l~~h~   73 (101)
                      .-.|.|-.|.+-|.....+..|.
T Consensus        55 ~GqfyCi~CaRyFi~~~~l~~H~   77 (129)
T KOG3408|consen   55 GGQFYCIECARYFIDAKALKTHF   77 (129)
T ss_pred             CceeehhhhhhhhcchHHHHHHH
Confidence            34577778888887777776653


No 146
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=39.08  E-value=52  Score=19.00  Aligned_cols=12  Identities=33%  Similarity=0.764  Sum_probs=6.0

Q ss_pred             CcccccCccccC
Q psy11364         80 FYACSSCSHVSR   91 (101)
Q Consensus        80 p~~C~~C~k~f~   91 (101)
                      .|.|+.|...|-
T Consensus        81 ~y~C~~C~~~FC   92 (112)
T TIGR00622        81 RYVCAVCKNVFC   92 (112)
T ss_pred             ceeCCCCCCccc
Confidence            455555554443


No 147
>PLN02748 tRNA dimethylallyltransferase
Probab=39.04  E-value=18  Score=26.14  Aligned_cols=22  Identities=27%  Similarity=0.693  Sum_probs=11.0

Q ss_pred             CCcccccCcc-ccCChHHHhccc
Q psy11364         79 AFYACSSCSH-VSRSRDALRKHD  100 (101)
Q Consensus        79 kp~~C~~C~k-~f~~~~~l~~H~  100 (101)
                      +.|.|+.|++ .+........|+
T Consensus       417 ~~~~Ce~C~~~~~~G~~eW~~Hl  439 (468)
T PLN02748        417 TQYVCEACGNKVLRGAHEWEQHK  439 (468)
T ss_pred             ccccccCCCCcccCCHHHHHHHh
Confidence            3455555554 455444444443


No 148
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=37.91  E-value=16  Score=21.04  Aligned_cols=26  Identities=19%  Similarity=0.416  Sum_probs=15.4

Q ss_pred             ceecccchhhcCCHHHHHHHHHhhCCCCc-ccccCccc
Q psy11364         53 FATCFVCGKQLSNQYNLRVHMETHQNAFY-ACSSCSHV   89 (101)
Q Consensus        53 ~~~C~~c~~~~~~~~~l~~h~~~h~~kp~-~C~~C~k~   89 (101)
                      ...|..|+..|.....           .+ .|+.||..
T Consensus        71 ~~~C~~Cg~~~~~~~~-----------~~~~CP~Cgs~   97 (117)
T PRK00564         71 ELECKDCSHVFKPNAL-----------DYGVCEKCHSK   97 (117)
T ss_pred             EEEhhhCCCccccCCc-----------cCCcCcCCCCC
Confidence            3678888866544321           23 48888753


No 149
>KOG2636|consensus
Probab=37.77  E-value=22  Score=25.58  Aligned_cols=25  Identities=32%  Similarity=0.610  Sum_probs=14.7

Q ss_pred             hhCC-CCcccccCc-cccCChHHHhcc
Q psy11364         75 THQN-AFYACSSCS-HVSRSRDALRKH   99 (101)
Q Consensus        75 ~h~~-kp~~C~~C~-k~f~~~~~l~~H   99 (101)
                      .|.- ..|.|.+|| +++.-.....+|
T Consensus       395 LHGL~~ey~CEICGNy~Y~GrkaF~RH  421 (497)
T KOG2636|consen  395 LHGLDIEYNCEICGNYVYKGRKAFDRH  421 (497)
T ss_pred             hcCCCcccceeeccCccccCcHHHHHH
Confidence            3444 678888887 555555444444


No 150
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=37.49  E-value=17  Score=17.72  Aligned_cols=39  Identities=18%  Similarity=0.335  Sum_probs=20.0

Q ss_pred             cceeccc--chhhcCCHHHHHHHHHhhCC-CCccccc----CccccC
Q psy11364         52 LFATCFV--CGKQLSNQYNLRVHMETHQN-AFYACSS----CSHVSR   91 (101)
Q Consensus        52 ~~~~C~~--c~~~~~~~~~l~~h~~~h~~-kp~~C~~----C~k~f~   91 (101)
                      .+..|+.  |...+. +..|..|....=. ++..|..    |+..+.
T Consensus         8 ~~v~C~~~cc~~~i~-r~~l~~H~~~~C~~~~v~C~~~~~GC~~~~~   53 (60)
T PF02176_consen    8 RPVPCPNGCCNEMIP-RKELDDHLENECPKRPVPCPYSPYGCKERVP   53 (60)
T ss_dssp             SEEE-TT--S-BEEE-CCCHHHHHHTTSTTSEEE-SS----S--EEE
T ss_pred             CEeeCCCCCccccee-HHHHHHHHHccCCCCcEECCCCCCCCCCccc
Confidence            4456765  434343 4457888874333 6677777    766654


No 151
>PF01215 COX5B:  Cytochrome c oxidase subunit Vb This family consists of chains F and S ;  InterPro: IPR002124 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....
Probab=37.04  E-value=9.9  Score=22.68  Aligned_cols=18  Identities=22%  Similarity=0.451  Sum_probs=13.8

Q ss_pred             HhhCCCCcccccCccccC
Q psy11364         74 ETHQNAFYACSSCSHVSR   91 (101)
Q Consensus        74 ~~h~~kp~~C~~C~k~f~   91 (101)
                      .++.++|.+|..||..|.
T Consensus       106 ~l~~g~~~RCpeCG~~fk  123 (136)
T PF01215_consen  106 WLHKGKPQRCPECGQVFK  123 (136)
T ss_dssp             EEETTSEEEETTTEEEEE
T ss_pred             EEeCCCccCCCCCCeEEE
Confidence            344458999999998875


No 152
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=36.95  E-value=7.1  Score=23.21  Aligned_cols=33  Identities=21%  Similarity=0.558  Sum_probs=20.9

Q ss_pred             cceecccchhhcCCHHHHHHHHHhhCCCCcccccCccccC
Q psy11364         52 LFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHVSR   91 (101)
Q Consensus        52 ~~~~C~~c~~~~~~~~~l~~h~~~h~~kp~~C~~C~k~f~   91 (101)
                      -.|.|..|+..+..      +.++ ..+-|.|..|+..+.
T Consensus       122 ~~~~C~~C~~~~~r------~~~~-~~~~~~C~~C~~~l~  154 (157)
T PF10263_consen  122 YVYRCPSCGREYKR------HRRS-KRKRYRCGRCGGPLV  154 (157)
T ss_pred             eEEEcCCCCCEeee------eccc-chhhEECCCCCCEEE
Confidence            34789999866532      2233 114588999987654


No 153
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=36.31  E-value=4.9  Score=22.24  Aligned_cols=10  Identities=40%  Similarity=0.889  Sum_probs=5.9

Q ss_pred             eecccchhhc
Q psy11364         54 ATCFVCGKQL   63 (101)
Q Consensus        54 ~~C~~c~~~~   63 (101)
                      |.|..|++.|
T Consensus        54 W~C~~C~~~~   63 (91)
T TIGR00280        54 WTCRKCGAKF   63 (91)
T ss_pred             EEcCCCCCEE
Confidence            5666666544


No 154
>TIGR00143 hypF [NiFe] hydrogenase maturation protein HypF. A previously described regulatory effect of HypF mutatation is attributable to loss of activity of a regulatory hydrogenase. A zinc finger-like region CXXCX(18)CXXCX(24)CXXCX(18)CXXC region further supported the regulatory hypothesis. However, more recent work (PUBMED:11375153) shows the direct effect is on the activity of expressed hydrogenases with nickel/iron centers, rather than on expression.
Probab=36.09  E-value=16  Score=27.83  Aligned_cols=59  Identities=19%  Similarity=0.243  Sum_probs=36.2

Q ss_pred             CCCCCCCCCccCCCCCCCCCCCCCCCcceecccchhhcCCHHHHHHHHHhhCCCCcccccCcccc
Q psy11364         26 SSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHVS   90 (101)
Q Consensus        26 ~c~~c~~~~~~~~~~~~~~~~~~~~~~~~~C~~c~~~~~~~~~l~~h~~~h~~kp~~C~~C~k~f   90 (101)
                      .|..||-.|.-..++.-...... ....-.|+.|.+.+..+.+-    +-|. .+-.|..||-..
T Consensus        92 nCt~CGPr~~i~~~lpydr~~t~-m~~f~~C~~C~~ey~~p~~r----r~h~-~~~~C~~Cgp~l  150 (711)
T TIGR00143        92 SCTHCGPRFTIIEALPYDRENTS-MADFPLCPDCAKEYKDPLDR----RFHA-QPIACPRCGPQL  150 (711)
T ss_pred             cccCCCCCeEEeecCCCCCCCcC-CCCCcCCHHHHHHhcCCccc----cCCC-CCccCCCCCcEE
Confidence            57889988866666543332222 23333599998887766432    2222 577899998654


No 155
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=36.08  E-value=42  Score=22.91  Aligned_cols=11  Identities=18%  Similarity=0.087  Sum_probs=8.4

Q ss_pred             CCCCCCCCCCC
Q psy11364         23 SPLSSSIPGSS   33 (101)
Q Consensus        23 ~~~~c~~c~~~   33 (101)
                      ....|+.||..
T Consensus       186 ~~~~CPvCGs~  196 (309)
T PRK03564        186 QRQFCPVCGSM  196 (309)
T ss_pred             CCCCCCCCCCc
Confidence            46789999963


No 156
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=36.00  E-value=35  Score=16.93  Aligned_cols=10  Identities=10%  Similarity=0.056  Sum_probs=6.7

Q ss_pred             CCCCCCCCCC
Q psy11364         25 LSSSIPGSSK   34 (101)
Q Consensus        25 ~~c~~c~~~~   34 (101)
                      +.|+.||..+
T Consensus         3 ~~CP~CG~~i   12 (54)
T TIGR01206         3 FECPDCGAEI   12 (54)
T ss_pred             cCCCCCCCEE
Confidence            4677777755


No 157
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=35.25  E-value=25  Score=19.49  Aligned_cols=13  Identities=46%  Similarity=1.060  Sum_probs=8.5

Q ss_pred             CCcccccCccccC
Q psy11364         79 AFYACSSCSHVSR   91 (101)
Q Consensus        79 kp~~C~~C~k~f~   91 (101)
                      .-|.|..|+..+.
T Consensus        89 ~fy~C~~C~~~w~  101 (104)
T TIGR01384        89 RFYKCTKCGYVWR  101 (104)
T ss_pred             EEEEeCCCCCeeE
Confidence            4677777776543


No 158
>PRK05978 hypothetical protein; Provisional
Probab=34.47  E-value=37  Score=20.58  Aligned_cols=11  Identities=18%  Similarity=0.048  Sum_probs=5.5

Q ss_pred             CCCCCCCCCCC
Q psy11364         24 PLSSSIPGSSK   34 (101)
Q Consensus        24 ~~~c~~c~~~~   34 (101)
                      ...|+.||++.
T Consensus        33 ~grCP~CG~G~   43 (148)
T PRK05978         33 RGRCPACGEGK   43 (148)
T ss_pred             cCcCCCCCCCc
Confidence            34555555543


No 159
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=34.23  E-value=25  Score=17.76  Aligned_cols=12  Identities=25%  Similarity=0.575  Sum_probs=4.7

Q ss_pred             cceecccchhhc
Q psy11364         52 LFATCFVCGKQL   63 (101)
Q Consensus        52 ~~~~C~~c~~~~   63 (101)
                      +.+.|..||..+
T Consensus        24 rrhhCr~CG~~v   35 (69)
T PF01363_consen   24 RRHHCRNCGRVV   35 (69)
T ss_dssp             -EEE-TTT--EE
T ss_pred             eeEccCCCCCEE
Confidence            446666666544


No 160
>KOG2482|consensus
Probab=34.10  E-value=27  Score=24.32  Aligned_cols=23  Identities=26%  Similarity=0.580  Sum_probs=21.0

Q ss_pred             ceecccchhhcCCHHHHHHHHHh
Q psy11364         53 FATCFVCGKQLSNQYNLRVHMET   75 (101)
Q Consensus        53 ~~~C~~c~~~~~~~~~l~~h~~~   75 (101)
                      .+.|-.|.+.|..+..|..||+.
T Consensus       195 r~~CLyCekifrdkntLkeHMrk  217 (423)
T KOG2482|consen  195 RLRCLYCEKIFRDKNTLKEHMRK  217 (423)
T ss_pred             hheeeeeccccCCcHHHHHHHHh
Confidence            47899999999999999999985


No 161
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=33.49  E-value=21  Score=20.46  Aligned_cols=26  Identities=23%  Similarity=0.692  Sum_probs=15.8

Q ss_pred             ceecccchhhcCCHHHHHHHHHhhCCCCcccccCccc
Q psy11364         53 FATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHV   89 (101)
Q Consensus        53 ~~~C~~c~~~~~~~~~l~~h~~~h~~kp~~C~~C~k~   89 (101)
                      ...|..|+..|....           ..+.|+.||..
T Consensus        70 ~~~C~~Cg~~~~~~~-----------~~~~CP~Cgs~   95 (115)
T TIGR00100        70 ECECEDCSEEVSPEI-----------DLYRCPKCHGI   95 (115)
T ss_pred             EEEcccCCCEEecCC-----------cCccCcCCcCC
Confidence            367888886664432           13568888753


No 162
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=33.31  E-value=30  Score=23.26  Aligned_cols=30  Identities=30%  Similarity=0.656  Sum_probs=16.3

Q ss_pred             eecccchhhcCCHHHHHHHHHhhCCCCcccccCccccC
Q psy11364         54 ATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHVSR   91 (101)
Q Consensus        54 ~~C~~c~~~~~~~~~l~~h~~~h~~kp~~C~~C~k~f~   91 (101)
                      .+|+.|+...-.+. |..       .-+.|+.||..|.
T Consensus        27 ~~c~~c~~~~~~~~-l~~-------~~~vc~~c~~h~r   56 (285)
T TIGR00515        27 TKCPKCGQVLYTKE-LER-------NLEVCPKCDHHMR   56 (285)
T ss_pred             eECCCCcchhhHHH-HHh-------hCCCCCCCCCcCc
Confidence            46777775543322 211       2457777776665


No 163
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=33.10  E-value=18  Score=16.20  Aligned_cols=11  Identities=18%  Similarity=0.561  Sum_probs=5.0

Q ss_pred             ccccCccccCC
Q psy11364         82 ACSSCSHVSRS   92 (101)
Q Consensus        82 ~C~~C~k~f~~   92 (101)
                      .|..|++.|.-
T Consensus         5 ~C~eC~~~f~d   15 (34)
T PF01286_consen    5 KCDECGKPFMD   15 (34)
T ss_dssp             E-TTT--EES-
T ss_pred             hHhHhCCHHHH
Confidence            57778877764


No 164
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=32.91  E-value=16  Score=16.23  Aligned_cols=11  Identities=27%  Similarity=0.549  Sum_probs=6.6

Q ss_pred             Ccceecccchh
Q psy11364         51 KLFATCFVCGK   61 (101)
Q Consensus        51 ~~~~~C~~c~~   61 (101)
                      ...+.|..|+.
T Consensus        20 r~R~vC~~Cg~   30 (34)
T PF14803_consen   20 RERLVCPACGF   30 (34)
T ss_dssp             S-EEEETTTTE
T ss_pred             ccceECCCCCC
Confidence            34467877774


No 165
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=32.77  E-value=2.9  Score=23.57  Aligned_cols=9  Identities=44%  Similarity=0.730  Sum_probs=4.4

Q ss_pred             cceecccch
Q psy11364         52 LFATCFVCG   60 (101)
Q Consensus        52 ~~~~C~~c~   60 (101)
                      +.|.|+.|+
T Consensus        21 k~FtCp~Cg   29 (104)
T COG4888          21 KTFTCPRCG   29 (104)
T ss_pred             ceEecCccC
Confidence            345555554


No 166
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=32.51  E-value=21  Score=21.32  Aligned_cols=24  Identities=29%  Similarity=0.598  Sum_probs=19.3

Q ss_pred             cceecccchhhcCCHHHHHHHHHhhCC
Q psy11364         52 LFATCFVCGKQLSNQYNLRVHMETHQN   78 (101)
Q Consensus        52 ~~~~C~~c~~~~~~~~~l~~h~~~h~~   78 (101)
                      ....|-++|+.|..   |++|+..|-+
T Consensus        75 D~IicLEDGkkfKS---LKRHL~t~~g   98 (148)
T COG4957          75 DYIICLEDGKKFKS---LKRHLTTHYG   98 (148)
T ss_pred             CeEEEeccCcchHH---HHHHHhcccC
Confidence            44678899998865   8899999876


No 167
>TIGR02159 PA_CoA_Oxy4 phenylacetate-CoA oxygenase, PaaJ subunit. Phenylacetate-CoA oxygenase is comprised of a five gene complex responsible for the hydroxylation of phenylacetate-CoA (PA-CoA) as the second catabolic step in phenylacetic acid (PA) degradation. Although the exact function of this enzyme has not been determined, it has been shown to be required for phenylacetic acid degradation and has been proposed to function in a multicomponent oxygenase acting on phenylacetate-CoA.
Probab=32.18  E-value=15  Score=22.13  Aligned_cols=9  Identities=22%  Similarity=0.257  Sum_probs=4.3

Q ss_pred             CCCCCCCCC
Q psy11364         25 LSSSIPGSS   33 (101)
Q Consensus        25 ~~c~~c~~~   33 (101)
                      -.|+.||..
T Consensus       106 ~~cp~c~s~  114 (146)
T TIGR02159       106 VQCPRCGSA  114 (146)
T ss_pred             CcCCCCCCC
Confidence            345555543


No 168
>KOG3497|consensus
Probab=32.07  E-value=22  Score=18.17  Aligned_cols=15  Identities=20%  Similarity=0.361  Sum_probs=10.2

Q ss_pred             CcccccCccccCChH
Q psy11364         80 FYACSSCSHVSRSRD   94 (101)
Q Consensus        80 p~~C~~C~k~f~~~~   94 (101)
                      |..|..|||....++
T Consensus         4 PiRCFtCGKvig~KW   18 (69)
T KOG3497|consen    4 PIRCFTCGKVIGDKW   18 (69)
T ss_pred             eeEeeeccccccccH
Confidence            667888887766543


No 169
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=31.69  E-value=7.2  Score=19.15  Aligned_cols=27  Identities=15%  Similarity=0.294  Sum_probs=13.7

Q ss_pred             CcceecccchhhcCCHHHHHHHHHhhC
Q psy11364         51 KLFATCFVCGKQLSNQYNLRVHMETHQ   77 (101)
Q Consensus        51 ~~~~~C~~c~~~~~~~~~l~~h~~~h~   77 (101)
                      ...|.|+.|.+.|-..-.+-.|..+|.
T Consensus        19 ~~~y~C~~C~~~FC~dCD~fiHE~LH~   45 (51)
T PF07975_consen   19 SSRYRCPKCKNHFCIDCDVFIHETLHN   45 (51)
T ss_dssp             -EEE--TTTT--B-HHHHHTTTTTS-S
T ss_pred             CCeEECCCCCCccccCcChhhhccccC
Confidence            356889999888877776665654443


No 170
>KOG0717|consensus
Probab=31.09  E-value=23  Score=25.63  Aligned_cols=20  Identities=25%  Similarity=0.639  Sum_probs=15.2

Q ss_pred             cccccCccccCChHHHhccc
Q psy11364         81 YACSSCSHVSRSRDALRKHD  100 (101)
Q Consensus        81 ~~C~~C~k~f~~~~~l~~H~  100 (101)
                      +-|.+|.|.|.+..+|..|.
T Consensus       293 lyC~vCnKsFKseKq~kNHE  312 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHE  312 (508)
T ss_pred             eEEeeccccccchHHHHhhH
Confidence            66888888888887777763


No 171
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=30.76  E-value=44  Score=20.90  Aligned_cols=30  Identities=17%  Similarity=0.403  Sum_probs=16.0

Q ss_pred             cceecccchhhcCCHHHHHHHHHhhCCCCcccccCccc
Q psy11364         52 LFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHV   89 (101)
Q Consensus        52 ~~~~C~~c~~~~~~~~~l~~h~~~h~~kp~~C~~C~k~   89 (101)
                      ..|.|+.|...++......        .-|.|+.||..
T Consensus       112 ~~y~C~~~~~r~sfdeA~~--------~~F~Cp~Cg~~  141 (176)
T COG1675         112 NYYVCPNCHVKYSFDEAME--------LGFTCPKCGED  141 (176)
T ss_pred             CceeCCCCCCcccHHHHHH--------hCCCCCCCCch
Confidence            3466766655544433322        13677777754


No 172
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=30.58  E-value=16  Score=17.75  Aligned_cols=12  Identities=25%  Similarity=0.528  Sum_probs=5.9

Q ss_pred             ccccCccccCCh
Q psy11364         82 ACSSCSHVSRSR   93 (101)
Q Consensus        82 ~C~~C~k~f~~~   93 (101)
                      .|+.|++-|.+.
T Consensus        14 ICpvCqRPFsWR   25 (54)
T COG4338          14 ICPVCQRPFSWR   25 (54)
T ss_pred             hhhhhcCchHHH
Confidence            355555555443


No 173
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=30.14  E-value=22  Score=20.89  Aligned_cols=12  Identities=33%  Similarity=0.742  Sum_probs=6.8

Q ss_pred             CcccccCccccC
Q psy11364         80 FYACSSCSHVSR   91 (101)
Q Consensus        80 p~~C~~C~k~f~   91 (101)
                      -|+|..|++.|.
T Consensus        53 RyrC~~C~~tf~   64 (129)
T COG3677          53 RYKCKSCGSTFT   64 (129)
T ss_pred             ccccCCcCccee
Confidence            455666665554


No 174
>TIGR01385 TFSII transcription elongation factor S-II. This model represents eukaryotic transcription elongation factor S-II. This protein allows stalled RNA transcription complexes to perform a cleavage of the nascent RNA and restart at the newly generated 3-prime end.
Probab=30.12  E-value=44  Score=22.68  Aligned_cols=41  Identities=20%  Similarity=0.244  Sum_probs=18.4

Q ss_pred             CCCCCCCCCCCCCccCCCCCCCCCCCCCCCcceecccchhhc
Q psy11364         22 TSPLSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQL   63 (101)
Q Consensus        22 ~~~~~c~~c~~~~~~~~~~~~~~~~~~~~~~~~~C~~c~~~~   63 (101)
                      ++-+.|+.||..-..-..+++.. .....-..|.|..|+..|
T Consensus       256 t~~~~C~~C~~~~~~~~q~Qtrs-aDEpmT~f~~C~~Cg~~w  296 (299)
T TIGR01385       256 TDLFTCGKCKQKKCTYYQLQTRS-ADEPMTTFVTCEECGNRW  296 (299)
T ss_pred             cccccCCCCCCccceEEEecccC-CCCCCeEEEEcCCCCCee
Confidence            34677777775433222222211 111112335677776544


No 175
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=29.95  E-value=50  Score=21.85  Aligned_cols=32  Identities=19%  Similarity=0.215  Sum_probs=21.5

Q ss_pred             CCCCCCCCCCCCccCCCCCCCCCCCCCCCcceecccchhhcCCHHHHH
Q psy11364         23 SPLSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQLSNQYNLR   70 (101)
Q Consensus        23 ~~~~c~~c~~~~~~~~~~~~~~~~~~~~~~~~~C~~c~~~~~~~~~l~   70 (101)
                      ++-.|+.||.                ...+.+.|+.||......-+..
T Consensus       308 tS~~C~~cg~----------------~~~r~~~C~~cg~~~~rD~naa  339 (364)
T COG0675         308 TSKTCPCCGH----------------LSGRLFKCPRCGFVHDRDVNAA  339 (364)
T ss_pred             CcccccccCC----------------ccceeEECCCCCCeehhhHHHH
Confidence            4566888886                1246689999998765555433


No 176
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=29.57  E-value=25  Score=20.11  Aligned_cols=27  Identities=15%  Similarity=0.306  Sum_probs=15.1

Q ss_pred             ceecccchhhcCCHHHHHHHHHhhCCCCcccccCccc
Q psy11364         53 FATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHV   89 (101)
Q Consensus        53 ~~~C~~c~~~~~~~~~l~~h~~~h~~kp~~C~~C~k~   89 (101)
                      ...|..|+..|.....          ..+.|+.||..
T Consensus        70 ~~~C~~Cg~~~~~~~~----------~~~~CP~Cgs~   96 (114)
T PRK03681         70 ECWCETCQQYVTLLTQ----------RVRRCPQCHGD   96 (114)
T ss_pred             EEEcccCCCeeecCCc----------cCCcCcCcCCC
Confidence            3678888865433211          12558888743


No 177
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=29.56  E-value=39  Score=22.92  Aligned_cols=32  Identities=16%  Similarity=0.417  Sum_probs=18.6

Q ss_pred             ceecccchhhcCCHHHHHHHHHhhCCCCcccccCccccCC
Q psy11364         53 FATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHVSRS   92 (101)
Q Consensus        53 ~~~C~~c~~~~~~~~~l~~h~~~h~~kp~~C~~C~k~f~~   92 (101)
                      ..+|+.|++..-.+. |..       .-+.|+.||..|.-
T Consensus        38 w~kc~~C~~~~~~~~-l~~-------~~~vcp~c~~h~rl   69 (296)
T CHL00174         38 WVQCENCYGLNYKKF-LKS-------KMNICEQCGYHLKM   69 (296)
T ss_pred             eeECCCccchhhHHH-HHH-------cCCCCCCCCCCcCC
Confidence            346888876543322 211       34678888877663


No 178
>PF01194 RNA_pol_N:  RNA polymerases N / 8 kDa subunit;  InterPro: IPR000268 In eukaryotes, there are three different forms of DNA-dependent RNA polymerases (2.7.7.6 from EC) transcribing different sets of genes. Each class of RNA polymerase is an assemblage of ten to twelve different polypeptides. In archaebacteria, there is generally a single form of RNA polymerase which also consists of an oligomeric assemblage of 10 to 13 polypeptides. Archaebacterial subunit N (gene rpoN) [] is a small protein of about 8 kDa, it is evolutionary related [] to a 8.3 kDa component shared by all three forms of eukaryotic RNA polymerases (gene RPB10 in yeast and POLR2J in mammals) as well as to African swine fever virus (ASFV) protein CP80R []. There is a conserved region which is located at the N-terminal extremity of these polymerase subunits; this region contains two cysteines that binds a zinc ion [].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_N 3HKZ_N 1EF4_A 3H0G_V 2Y0S_N 2R92_J 3M4O_J 3S2D_J 1R9S_J 1Y1W_J ....
Probab=29.43  E-value=34  Score=17.40  Aligned_cols=14  Identities=21%  Similarity=0.510  Sum_probs=8.5

Q ss_pred             CcccccCccccCCh
Q psy11364         80 FYACSSCSHVSRSR   93 (101)
Q Consensus        80 p~~C~~C~k~f~~~   93 (101)
                      |..|..||+.....
T Consensus         4 PVRCFTCGkvi~~~   17 (60)
T PF01194_consen    4 PVRCFTCGKVIGNK   17 (60)
T ss_dssp             SSS-STTTSBTCGH
T ss_pred             ceecCCCCCChhHh
Confidence            66777787765543


No 179
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=28.65  E-value=51  Score=18.93  Aligned_cols=12  Identities=8%  Similarity=-0.316  Sum_probs=5.5

Q ss_pred             CCCCCCCCCCCc
Q psy11364         24 PLSSSIPGSSKT   35 (101)
Q Consensus        24 ~~~c~~c~~~~~   35 (101)
                      -+.|+.|+..|.
T Consensus        19 ~~iCpeC~~EW~   30 (109)
T TIGR00686        19 QLICPSCLYEWN   30 (109)
T ss_pred             eeECcccccccc
Confidence            344444444443


No 180
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=28.65  E-value=32  Score=16.54  Aligned_cols=27  Identities=22%  Similarity=0.288  Sum_probs=15.4

Q ss_pred             CCCCCCCCCccCCCCCCCCCCCCCCCcceecccchhhcCC
Q psy11364         26 SSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQLSN   65 (101)
Q Consensus        26 ~c~~c~~~~~~~~~~~~~~~~~~~~~~~~~C~~c~~~~~~   65 (101)
                      .|..|++.|..             ..+.+.|..||+.+-.
T Consensus         4 ~C~~C~~~F~~-------------~~rk~~Cr~Cg~~~C~   30 (57)
T cd00065           4 SCMGCGKPFTL-------------TRRRHHCRNCGRIFCS   30 (57)
T ss_pred             cCcccCccccC-------------CccccccCcCcCCcCh
Confidence            46667766643             1233567777766544


No 181
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=28.56  E-value=52  Score=23.86  Aligned_cols=29  Identities=34%  Similarity=0.468  Sum_probs=24.7

Q ss_pred             CCcceecccchhhcCCHHHHHHHHH-hhCC
Q psy11364         50 SKLFATCFVCGKQLSNQYNLRVHME-THQN   78 (101)
Q Consensus        50 ~~~~~~C~~c~~~~~~~~~l~~h~~-~h~~   78 (101)
                      ..+.+.|+.|.+.|.....+..|+. .|.+
T Consensus        54 sWrFWiCp~CskkF~d~~~~~~H~~~eH~~   83 (466)
T PF04780_consen   54 SWRFWICPRCSKKFSDAESCLSHMEQEHPA   83 (466)
T ss_pred             ceeEeeCCcccceeCCHHHHHHHHHHhhhh
Confidence            3677899999999999999999987 4664


No 182
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=28.47  E-value=8.6  Score=21.25  Aligned_cols=10  Identities=30%  Similarity=0.803  Sum_probs=5.6

Q ss_pred             eecccchhhc
Q psy11364         54 ATCFVCGKQL   63 (101)
Q Consensus        54 ~~C~~c~~~~   63 (101)
                      |.|..|++.|
T Consensus        55 W~C~~C~~~~   64 (90)
T PRK03976         55 WECRKCGAKF   64 (90)
T ss_pred             EEcCCCCCEE
Confidence            5566666543


No 183
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=28.12  E-value=23  Score=16.06  Aligned_cols=11  Identities=36%  Similarity=1.274  Sum_probs=5.3

Q ss_pred             CCcccccCccc
Q psy11364         79 AFYACSSCSHV   89 (101)
Q Consensus        79 kp~~C~~C~k~   89 (101)
                      +-|+|..||..
T Consensus         5 ~~YkC~~CGni   15 (36)
T PF06397_consen    5 EFYKCEHCGNI   15 (36)
T ss_dssp             EEEE-TTT--E
T ss_pred             cEEEccCCCCE
Confidence            45777777754


No 184
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=28.00  E-value=5.4  Score=17.94  Aligned_cols=12  Identities=25%  Similarity=0.778  Sum_probs=5.0

Q ss_pred             CcccccCccccC
Q psy11364         80 FYACSSCSHVSR   91 (101)
Q Consensus        80 p~~C~~C~k~f~   91 (101)
                      +..|..||-.++
T Consensus        21 ~isC~~CGPr~~   32 (35)
T PF07503_consen   21 FISCTNCGPRYS   32 (35)
T ss_dssp             T--BTTCC-SCC
T ss_pred             CccCCCCCCCEE
Confidence            445666665543


No 185
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=27.74  E-value=20  Score=23.95  Aligned_cols=11  Identities=18%  Similarity=0.461  Sum_probs=6.7

Q ss_pred             CCcccccCccc
Q psy11364         79 AFYACSSCSHV   89 (101)
Q Consensus        79 kp~~C~~C~k~   89 (101)
                      +|+.|+.||.-
T Consensus       208 k~~PCPKCg~e  218 (314)
T PF06524_consen  208 KPIPCPKCGYE  218 (314)
T ss_pred             CCCCCCCCCCc
Confidence            56666666643


No 186
>KOG3507|consensus
Probab=26.98  E-value=36  Score=17.28  Aligned_cols=13  Identities=23%  Similarity=0.531  Sum_probs=9.4

Q ss_pred             Ccceecccchhhc
Q psy11364         51 KLFATCFVCGKQL   63 (101)
Q Consensus        51 ~~~~~C~~c~~~~   63 (101)
                      ..++.|.+||...
T Consensus        35 ~D~irCReCG~RI   47 (62)
T KOG3507|consen   35 GDVIRCRECGYRI   47 (62)
T ss_pred             CCcEehhhcchHH
Confidence            4568899998644


No 187
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=26.58  E-value=76  Score=14.31  Aligned_cols=20  Identities=20%  Similarity=0.298  Sum_probs=12.9

Q ss_pred             cceecccchhhcCCHHHHHH
Q psy11364         52 LFATCFVCGKQLSNQYNLRV   71 (101)
Q Consensus        52 ~~~~C~~c~~~~~~~~~l~~   71 (101)
                      ....|..|+-.+.....+..
T Consensus        18 ~id~C~~C~G~W~d~~el~~   37 (41)
T PF13453_consen   18 EIDVCPSCGGIWFDAGELEK   37 (41)
T ss_pred             EEEECCCCCeEEccHHHHHH
Confidence            34667777777766666543


No 189
>PRK04351 hypothetical protein; Provisional
Probab=25.98  E-value=24  Score=21.30  Aligned_cols=35  Identities=20%  Similarity=0.456  Sum_probs=22.7

Q ss_pred             cceecccchhhcCCHHHHHHHHHhhCCCCcccccCccccCCh
Q psy11364         52 LFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHVSRSR   93 (101)
Q Consensus        52 ~~~~C~~c~~~~~~~~~l~~h~~~h~~kp~~C~~C~k~f~~~   93 (101)
                      -.|.|..|+..+..      + +.+...-|.|..|+..+...
T Consensus       111 y~Y~C~~Cg~~~~r------~-Rr~n~~~yrCg~C~g~L~~~  145 (149)
T PRK04351        111 YLYECQSCGQQYLR------K-RRINTKRYRCGKCRGKLKLI  145 (149)
T ss_pred             EEEECCCCCCEeee------e-eecCCCcEEeCCCCcEeeec
Confidence            34889889866533      2 22333679999998766543


No 190
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated
Probab=25.81  E-value=46  Score=22.47  Aligned_cols=30  Identities=30%  Similarity=0.698  Sum_probs=16.0

Q ss_pred             eecccchhhcCCHHHHHHHHHhhCCCCcccccCccccC
Q psy11364         54 ATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHVSR   91 (101)
Q Consensus        54 ~~C~~c~~~~~~~~~l~~h~~~h~~kp~~C~~C~k~f~   91 (101)
                      .+|+.|+...-.+. |..       .-+.|+.||..|.
T Consensus        28 ~~c~~c~~~~~~~~-l~~-------~~~vc~~c~~h~r   57 (292)
T PRK05654         28 TKCPSCGQVLYRKE-LEA-------NLNVCPKCGHHMR   57 (292)
T ss_pred             eECCCccchhhHHH-HHh-------cCCCCCCCCCCee
Confidence            46777765432222 111       2357777777665


No 191
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=25.79  E-value=49  Score=16.51  Aligned_cols=12  Identities=25%  Similarity=0.487  Sum_probs=8.6

Q ss_pred             Ccceecccchhh
Q psy11364         51 KLFATCFVCGKQ   62 (101)
Q Consensus        51 ~~~~~C~~c~~~   62 (101)
                      ...|.|+.||-.
T Consensus        12 ~v~~~Cp~cGip   23 (55)
T PF13824_consen   12 HVNFECPDCGIP   23 (55)
T ss_pred             ccCCcCCCCCCc
Confidence            455889888853


No 192
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=25.49  E-value=91  Score=23.68  Aligned_cols=11  Identities=18%  Similarity=-0.076  Sum_probs=6.6

Q ss_pred             CCCCCCCCCCC
Q psy11364         24 PLSSSIPGSSK   34 (101)
Q Consensus        24 ~~~c~~c~~~~   34 (101)
                      .-.|+.||...
T Consensus        15 akFC~~CG~~l   25 (645)
T PRK14559         15 NRFCQKCGTSL   25 (645)
T ss_pred             CccccccCCCC
Confidence            44566776654


No 193
>COG1773 Rubredoxin [Energy production and conversion]
Probab=25.03  E-value=31  Score=17.22  Aligned_cols=10  Identities=40%  Similarity=0.913  Sum_probs=5.3

Q ss_pred             cccccCcccc
Q psy11364         81 YACSSCSHVS   90 (101)
Q Consensus        81 ~~C~~C~k~f   90 (101)
                      |+|..||..|
T Consensus         4 ~~C~~CG~vY   13 (55)
T COG1773           4 WRCSVCGYVY   13 (55)
T ss_pred             eEecCCceEe
Confidence            4555555444


No 194
>PF12156 ATPase-cat_bd:  Putative metal-binding domain of cation transport ATPase;  InterPro: IPR021993  This domain is found in bacteria, and is approximately 90 amino acids in length. It is found associated with PF00403 from PFAM, PF00122 from PFAM, PF00702 from PFAM. The cysteine-rich nature and composition suggest this might be a cation-binding domain; most members are annotated as being cation transport ATPases. 
Probab=24.64  E-value=50  Score=17.94  Aligned_cols=35  Identities=9%  Similarity=-0.017  Sum_probs=20.7

Q ss_pred             CCCCCCCCCccCCCCCCCCCCCCCCCcceecccchhhc
Q psy11364         26 SSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQL   63 (101)
Q Consensus        26 ~c~~c~~~~~~~~~~~~~~~~~~~~~~~~~C~~c~~~~   63 (101)
                      .|-.||...+....+...  +. ...+.|-|..|.-++
T Consensus         2 ~C~HCg~~~p~~~~~~~~--~~-g~~~~FCC~GC~~V~   36 (88)
T PF12156_consen    2 KCYHCGLPVPEGAKITVE--ID-GEERPFCCPGCQAVY   36 (88)
T ss_pred             CCCCCCCCCCCCCCeeee--eC-CCccccccHHHHHHH
Confidence            477788777544333222  11 235788999997554


No 195
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=24.54  E-value=2e+02  Score=23.97  Aligned_cols=10  Identities=30%  Similarity=0.737  Sum_probs=6.4

Q ss_pred             ceecccchhh
Q psy11364         53 FATCFVCGKQ   62 (101)
Q Consensus        53 ~~~C~~c~~~   62 (101)
                      ++.|+.||..
T Consensus       692 vy~CPsCGae  701 (1337)
T PRK14714        692 VYVCPDCGAE  701 (1337)
T ss_pred             ceeCccCCCc
Confidence            4567777754


No 196
>PF11931 DUF3449:  Domain of unknown function (DUF3449);  InterPro: IPR024598 This presumed domain is functionally uncharacterised. It has two conserved sequence motifs: PIP and CEICG and contains a zinc-finger of the C2H2-type.; PDB: 4DGW_A.
Probab=24.34  E-value=25  Score=22.34  Aligned_cols=9  Identities=33%  Similarity=0.940  Sum_probs=0.0

Q ss_pred             CCcccccCc
Q psy11364         79 AFYACSSCS   87 (101)
Q Consensus        79 kp~~C~~C~   87 (101)
                      +-|.|.+||
T Consensus       100 ~ey~CEICG  108 (196)
T PF11931_consen  100 VEYKCEICG  108 (196)
T ss_dssp             ---------
T ss_pred             CeeeeEeCC
Confidence            667777776


No 197
>PF10621 FpoO:  F420H2 dehydrogenase subunit FpoO ;  InterPro: IPR018288 This entry represents the FpoO subunit of membrane-bound multi-subunit F420H2 dehydrogenase, which oxidises the reduced coenzyme F420H2 to coenzyme F420 and feeds the electrons via an FeS cluster into an energy-conserving electron transport chain [, ]. This enzyme plays a role in the methanogenic pathway in methanogenic archaea. Reduced coenzyme F420H2 is the major cytoplasmic electron carrier of methanogens and a reversible hydride donor, much like NADH []. F420H2 + COB-S-S-CoM = F420 + CoM-SH + CoB-SH  Where CoB-S-S-CoM (the heterosulphide of 2-mercaptoethanesulphonate and 7-mercaptoheptanoylthreonine phosphate) is the terminal electron acceptor of the methanogenic pathway, and is reduced with the concomitant generation of a transmembrane proton potential and ATP synthesis.  The FpoO subunit of F420H2 dehydrogenase probably participates in the reduction of methanophenazine, where it acts as a special mechanism for the reduction of the methanogenic cofactor []. 
Probab=24.25  E-value=39  Score=19.47  Aligned_cols=60  Identities=10%  Similarity=0.077  Sum_probs=29.3

Q ss_pred             CCCCCCCCccCCCCCC---CCCCCCCCCcce--ecccchhhcCCHHHHHHHHHhhCC-CCcccccCccc
Q psy11364         27 SSIPGSSKTKASGSGT---TGGSSNHSKLFA--TCFVCGKQLSNQYNLRVHMETHQN-AFYACSSCSHV   89 (101)
Q Consensus        27 c~~c~~~~~~~~~~~~---~~~~~~~~~~~~--~C~~c~~~~~~~~~l~~h~~~h~~-kp~~C~~C~k~   89 (101)
                      |+.||.+.++--+...   ......+ +-.|  .|..|-...  ......+-+.+.. +.=+|..||+.
T Consensus         4 CdLCg~~~Pt~~PvrV~~Pr~~~~yP-eGvwKGLC~~CL~sa--~~ty~e~~~~~~s~~~gKC~LCG~k   69 (119)
T PF10621_consen    4 CDLCGRAIPTVCPVRVFAPRLTLAYP-EGVWKGLCETCLDSA--EKTYQEVNENESSCRSGKCDLCGKK   69 (119)
T ss_pred             cchhcCcCCceeEEEeecchhhccCc-chHHHhhHHHHHHHH--HHHHHHHhcccccccccceeccCCc
Confidence            6677776655433221   1111111 2223  466665432  2333444444555 67788999863


No 198
>PRK08222 hydrogenase 4 subunit H; Validated
Probab=24.20  E-value=50  Score=20.48  Aligned_cols=18  Identities=17%  Similarity=0.451  Sum_probs=14.5

Q ss_pred             CCcccccCccccCChHHH
Q psy11364         79 AFYACSSCSHVSRSRDAL   96 (101)
Q Consensus        79 kp~~C~~C~k~f~~~~~l   96 (101)
                      ....|..||+.|.....+
T Consensus       113 ~~~~C~~Cg~~f~~~k~i  130 (181)
T PRK08222        113 HLQRCSRCERPFAPQKTV  130 (181)
T ss_pred             ccCcCcccCCccCcHhHH
Confidence            688899999999866444


No 199
>KOG0978|consensus
Probab=24.06  E-value=35  Score=25.99  Aligned_cols=21  Identities=24%  Similarity=0.436  Sum_probs=16.5

Q ss_pred             CCcccccCccccCChHHHhcc
Q psy11364         79 AFYACSSCSHVSRSRDALRKH   99 (101)
Q Consensus        79 kp~~C~~C~k~f~~~~~l~~H   99 (101)
                      +.=+||.|+.+|...+-+.-|
T Consensus       677 RqRKCP~Cn~aFganDv~~I~  697 (698)
T KOG0978|consen  677 RQRKCPKCNAAFGANDVHRIH  697 (698)
T ss_pred             hcCCCCCCCCCCCcccccccC
Confidence            556899999999987766554


No 200
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=23.97  E-value=30  Score=20.50  Aligned_cols=32  Identities=22%  Similarity=0.403  Sum_probs=18.1

Q ss_pred             ceecccchhhcCCHHHHHHHHHhhCC-CCcccccCccccC
Q psy11364         53 FATCFVCGKQLSNQYNLRVHMETHQN-AFYACSSCSHVSR   91 (101)
Q Consensus        53 ~~~C~~c~~~~~~~~~l~~h~~~h~~-kp~~C~~C~k~f~   91 (101)
                      .|.|..|+..+.      ++. -+.. .-|.|..|+..+.
T Consensus       112 ~y~C~~C~~~~~------~~r-r~~~~~~y~C~~C~g~l~  144 (146)
T smart00731      112 PYRCTGCGQRYL------RVR-RSNNVSRYRCGKCGGKLI  144 (146)
T ss_pred             EEECCCCCCCCc------eEc-cccCcceEEcCCCCCEEE
Confidence            477877876543      121 1222 4577887876543


No 201
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=23.87  E-value=27  Score=16.19  Aligned_cols=10  Identities=30%  Similarity=0.753  Sum_probs=5.1

Q ss_pred             ceecccchhh
Q psy11364         53 FATCFVCGKQ   62 (101)
Q Consensus        53 ~~~C~~c~~~   62 (101)
                      +-.|+.|+..
T Consensus        29 ~~~CpYCg~~   38 (40)
T PF10276_consen   29 PVVCPYCGTR   38 (40)
T ss_dssp             EEEETTTTEE
T ss_pred             eEECCCCCCE
Confidence            3455555543


No 202
>PRK10220 hypothetical protein; Provisional
Probab=23.27  E-value=1.1e+02  Score=17.57  Aligned_cols=14  Identities=7%  Similarity=-0.213  Sum_probs=7.6

Q ss_pred             CCCCCCCCCCCccC
Q psy11364         24 PLSSSIPGSSKTKA   37 (101)
Q Consensus        24 ~~~c~~c~~~~~~~   37 (101)
                      -|.|+.|+..|...
T Consensus        20 ~~vCpeC~hEW~~~   33 (111)
T PRK10220         20 MYICPECAHEWNDA   33 (111)
T ss_pred             eEECCcccCcCCcc
Confidence            45566666555444


No 203
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=23.05  E-value=65  Score=15.56  Aligned_cols=15  Identities=20%  Similarity=0.550  Sum_probs=9.8

Q ss_pred             ceecccchhhcCCHH
Q psy11364         53 FATCFVCGKQLSNQY   67 (101)
Q Consensus        53 ~~~C~~c~~~~~~~~   67 (101)
                      -+.|..|+..+...-
T Consensus        28 ~W~C~~Cgh~w~~~v   42 (55)
T PF14311_consen   28 WWKCPKCGHEWKASV   42 (55)
T ss_pred             EEECCCCCCeeEccH
Confidence            367888876665543


No 204
>PF14369 zf-RING_3:  zinc-finger
Probab=22.59  E-value=49  Score=14.69  Aligned_cols=10  Identities=0%  Similarity=-0.257  Sum_probs=8.2

Q ss_pred             CCCCCCCCCc
Q psy11364         26 SSSIPGSSKT   35 (101)
Q Consensus        26 ~c~~c~~~~~   35 (101)
                      .|+.|+.+|.
T Consensus        23 ~CP~C~~gFv   32 (35)
T PF14369_consen   23 ACPRCHGGFV   32 (35)
T ss_pred             CCcCCCCcEe
Confidence            5999998874


No 205
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=22.56  E-value=33  Score=16.43  Aligned_cols=10  Identities=40%  Similarity=0.989  Sum_probs=5.2

Q ss_pred             cccccCcccc
Q psy11364         81 YACSSCSHVS   90 (101)
Q Consensus        81 ~~C~~C~k~f   90 (101)
                      |.|..||..+
T Consensus         2 y~C~~CgyvY   11 (47)
T PF00301_consen    2 YQCPVCGYVY   11 (47)
T ss_dssp             EEETTTSBEE
T ss_pred             cCCCCCCEEE
Confidence            4555665443


No 206
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=22.37  E-value=30  Score=16.36  Aligned_cols=8  Identities=25%  Similarity=0.156  Sum_probs=5.0

Q ss_pred             CCCCCCCC
Q psy11364         27 SSIPGSSK   34 (101)
Q Consensus        27 c~~c~~~~   34 (101)
                      |+.||..-
T Consensus         2 CP~Cg~~a    9 (47)
T PF04606_consen    2 CPHCGSKA    9 (47)
T ss_pred             cCCCCCee
Confidence            67777643


No 207
>KOG1280|consensus
Probab=22.27  E-value=78  Score=22.15  Aligned_cols=37  Identities=22%  Similarity=0.375  Sum_probs=25.1

Q ss_pred             CcceecccchhhcCCHHHHHHHHH-hhCC--CCcccccCc
Q psy11364         51 KLFATCFVCGKQLSNQYNLRVHME-THQN--AFYACSSCS   87 (101)
Q Consensus        51 ~~~~~C~~c~~~~~~~~~l~~h~~-~h~~--kp~~C~~C~   87 (101)
                      +.-|.|+.|++.-.....+..|.. .|..  -...|+.|+
T Consensus        77 ~qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~  116 (381)
T KOG1280|consen   77 PQSFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCA  116 (381)
T ss_pred             cccccCCcccccccchhHHHHHhhhcCcccCcceeeeccc
Confidence            346889999987777777888864 5655  234456664


No 208
>KOG0782|consensus
Probab=22.23  E-value=23  Score=26.58  Aligned_cols=17  Identities=6%  Similarity=-0.259  Sum_probs=9.3

Q ss_pred             CCCCCCCCCCCccCCCC
Q psy11364         24 PLSSSIPGSSKTKASGS   40 (101)
Q Consensus        24 ~~~c~~c~~~~~~~~~~   40 (101)
                      .-.|..||++|.++-.+
T Consensus       253 eGkC~~CgKgFQQKf~F  269 (1004)
T KOG0782|consen  253 EGKCNTCGKGFQQKFFF  269 (1004)
T ss_pred             ccccchhhhhhhhheee
Confidence            44566666666555443


No 209
>PRK04016 DNA-directed RNA polymerase subunit N; Provisional
Probab=21.68  E-value=42  Score=17.22  Aligned_cols=13  Identities=23%  Similarity=0.473  Sum_probs=8.6

Q ss_pred             CcccccCccccCC
Q psy11364         80 FYACSSCSHVSRS   92 (101)
Q Consensus        80 p~~C~~C~k~f~~   92 (101)
                      |..|..||+....
T Consensus         4 PvRCFTCGkvi~~   16 (62)
T PRK04016          4 PVRCFTCGKVIAE   16 (62)
T ss_pred             CeEecCCCCChHH
Confidence            6677777776544


No 210
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=21.58  E-value=29  Score=18.59  Aligned_cols=11  Identities=27%  Similarity=0.803  Sum_probs=6.9

Q ss_pred             CcccccCcccc
Q psy11364         80 FYACSSCSHVS   90 (101)
Q Consensus        80 p~~C~~C~k~f   90 (101)
                      .|+|..||..|
T Consensus        12 ~Y~c~~cg~~~   22 (82)
T COG2331          12 SYECTECGNRF   22 (82)
T ss_pred             EEeecccchHH
Confidence            36777776554


No 211
>KOG4124|consensus
Probab=21.31  E-value=18  Score=25.21  Aligned_cols=21  Identities=29%  Similarity=0.616  Sum_probs=15.9

Q ss_pred             CCcccccCccccCChHHHhcc
Q psy11364         79 AFYACSSCSHVSRSRDALRKH   99 (101)
Q Consensus        79 kp~~C~~C~k~f~~~~~l~~H   99 (101)
                      |||+|++|.+++.-...|..|
T Consensus       397 k~~r~~i~~~~~k~~~~l~~~  417 (442)
T KOG4124|consen  397 KPYRCEVCSKRYKNLNGLKYH  417 (442)
T ss_pred             CcccChhhhhhhccCCCCCce
Confidence            899999999887766555443


No 212
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=21.25  E-value=34  Score=15.35  Aligned_cols=9  Identities=22%  Similarity=0.922  Sum_probs=4.8

Q ss_pred             ccccCcccc
Q psy11364         82 ACSSCSHVS   90 (101)
Q Consensus        82 ~C~~C~k~f   90 (101)
                      .|+.||+.|
T Consensus         3 ~C~~Cg~~Y   11 (36)
T PF05191_consen    3 ICPKCGRIY   11 (36)
T ss_dssp             EETTTTEEE
T ss_pred             CcCCCCCcc
Confidence            355566554


No 213
>PF14690 zf-ISL3:  zinc-finger of transposase IS204/IS1001/IS1096/IS1165
Probab=20.62  E-value=54  Score=15.03  Aligned_cols=10  Identities=20%  Similarity=0.471  Sum_probs=6.8

Q ss_pred             CcccccCccc
Q psy11364         80 FYACSSCSHV   89 (101)
Q Consensus        80 p~~C~~C~k~   89 (101)
                      |..|+.||..
T Consensus         2 ~~~Cp~Cg~~   11 (47)
T PF14690_consen    2 PPRCPHCGSP   11 (47)
T ss_pred             CccCCCcCCC
Confidence            5678888743


No 214
>PRK06260 threonine synthase; Validated
Probab=20.56  E-value=54  Score=22.89  Aligned_cols=25  Identities=24%  Similarity=0.372  Sum_probs=15.1

Q ss_pred             CCCCCCCCCCccCCCCCCCCCCCCCCCcceecccchhh
Q psy11364         25 LSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQ   62 (101)
Q Consensus        25 ~~c~~c~~~~~~~~~~~~~~~~~~~~~~~~~C~~c~~~   62 (101)
                      +.|..||..+..             ....+.|+.|+-.
T Consensus         4 ~~C~~cg~~~~~-------------~~~~~~Cp~cg~~   28 (397)
T PRK06260          4 LKCIECGKEYDP-------------DEIIYTCPECGGL   28 (397)
T ss_pred             EEECCCCCCCCC-------------CCccccCCCCCCe
Confidence            567788865521             1234678888754


No 215
>PF12773 DZR:  Double zinc ribbon
Probab=20.47  E-value=98  Score=14.39  Aligned_cols=6  Identities=33%  Similarity=1.326  Sum_probs=2.4

Q ss_pred             ccccCc
Q psy11364         82 ACSSCS   87 (101)
Q Consensus        82 ~C~~C~   87 (101)
                      .|+.||
T Consensus        31 ~C~~Cg   36 (50)
T PF12773_consen   31 ICPNCG   36 (50)
T ss_pred             CCcCCc
Confidence            344443


No 216
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=20.04  E-value=50  Score=14.97  Aligned_cols=14  Identities=14%  Similarity=0.337  Sum_probs=7.2

Q ss_pred             ccccCccccCChHH
Q psy11364         82 ACSSCSHVSRSRDA   95 (101)
Q Consensus        82 ~C~~C~k~f~~~~~   95 (101)
                      .|+-|++.|-+.+.
T Consensus         4 ~CprC~kg~Hwa~~   17 (36)
T PF14787_consen    4 LCPRCGKGFHWASE   17 (36)
T ss_dssp             C-TTTSSSCS-TTT
T ss_pred             cCcccCCCcchhhh
Confidence            46667776655443


Done!