Diaphorina citri psyllid: psy1136

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------

MICSQNEKSDVRAKSRKNEDKPHIKPTLLNVYVFFIILYGVTILSGVALNIFAIYHIIVERLFRDATCGYFINIALADIIKCMFVLPITLMVTLVQNWTWGSFLCYFLPMLQVMERLFRDATCGYFINIALADIIKCMFVLPITLMVTLVQNWTWGSFLCYFLPMLQ

ccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHEEHHEEccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHccccccHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEccHHHHHHHHHHHHHHHHHHHHHcccc

************AKSRKNEDKPHIKPTLLNVYVFFIILYGVTILSGVALNIFAIYHIIVERLFRDATCGYFINIALADIIKCMFVLPITLMVTLVQNWTWGSFLCYFLPMLQVMERLFRDATCGYFINIALADIIKCMFVLPITLMVTLVQNWTWGSFLCYFLPMLQ

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxHHxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MICSQNEKSDVRAKSRKNEDKPHIKPTLLNVYVFFIILYGVTILSGVALNIFAIYHIIVERLFRDATCGYFINIALADIIKCMFVLPITLMVTLVQNWTWGSFLCYFLPMLQVMERLFRDATCGYFINIALADIIKCMFVLPITLMVTLVQNWTWGSFLCYFLPMLQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0008188 [MF]	neuropeptide receptor activity	probable	GO:0008528, GO:0004930, GO:0030594, GO:0038023, GO:0060089, GO:0004888, GO:0001653, GO:0003674, GO:0004872, GO:0004871
GO:0044464 [CC]	cell part	probable	GO:0005575, GO:0005623
GO:0007186 [BP]	G-protein coupled receptor signaling pathway	probable	GO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0016020 [CC]	membrane	probable	GO:0005575

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4EA3, chain A
Confidence level:very confident
Coverage over the Query: 28-147
View the alignment between query and template
View the model in PyMOL