Diaphorina citri psyllid: psy11379


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300------
MSMDEIIRVQTIEDFPQFPHRGLLVDGSRHYLPIKAIKKQLDIMSYNKLNVLHWHLVDDQSFPYESKKFPSLSLKGAFGPDAIYTEKMIKKVGLGARKMTLCNSTLVPFLFQIIRVQTIEDFPQFPHRGLLVDGSRHYLPIKAIKKQLDIMSYNKLNVLHWHLVDDQSFPYESKKFPSLSLKGAFGPDAIYTEKMIKSVIEYARLRGIRVIPEIDTPGHTDSMEPGMPQIHCHCPHRVEGKTFVGPLDPTKNVTLDFVRDLFTELGQRFPESYVHLGGDEVDFFCWEQNPEIKAFMSSGDEVDFFC
ccccEEEEccEEECcccccccccccccccccccHHHHHHHHHHHHHHcccEEEEEEcccccccEEEEcccccCCccccccccCEEEEEEEEEcccccccccccccccccEEEEEEccEEECcccccccccccccccccccHHHHHHHHHHHHHHcccEEEEEccccccccEEEcccccccccccccccccccHHHHHHHHHHHHHcccEEEEccccccHHccHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccEECcccccccccccccHHHHHHHHccccccccc
**MDEIIRVQTIEDFPQFPHRGLLVDGSRHYLPIKAIKKQLDIMSYNKLNVLHWHLVDDQSFPYESKKFPSLSLKGAFGPDAIYTEKMIKKVGLGARKMTLCNSTLVPFLFQIIRVQTIEDFPQFPHRGLLVDGSRHYLPIKAIKKQLDIMSYNKLNVLHWHLVDDQSFPYESKKFPSLSLKGAFGPDAIYTEKMIKSVIEYARLRGIRVIPEIDTPGHTDSMEPGMPQIHCHCPHRVEGKTFVGPLDPTKNVTLDFVRDLFTELGQRFPESYVHLGGDEVDFFCWEQNPEIKAFMSSGDE*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSMDEIIRVQTIEDFPQFPHRGLLVDGSRHYLPIKAIKKQLDIMSYNKLNVLHWHLVDDQSFPYESKKFPSLSLKGAFGPDAIYTEKMIKKVGLGARKMTLCNSTLVPFLFQIIRVQTIEDFPQFPHRGLLVDGSRHYLPIKAIKKQLDIMSYNKLNVLHWHLVDDQSFPYESKKFPSLSLKGAFGPDAIYTEKMIKSVIEYARLRGIRVIPEIDTPGHTDSMEPGMPQIHCHCPHRVEGKTFVGPLDPTKNVTLDFVRDLFTELGQRFPESYVHLGGDEVDFFCWEQNPEIKAFMSSGDEVDFFC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Beta-hexosaminidase subunit alpha Responsible for the degradation of GM2 gangliosides, and a variety of other molecules containing terminal N-acetyl hexosamines, in the brain and other tissues.confidentQ5RC84
Beta-hexosaminidase subunit alpha Responsible for the degradation of GM2 gangliosides, and a variety of other molecules containing terminal N-acetyl hexosamines, in the brain and other tissues. The form B is active against certain oligosaccharides. The form S has no measurable activity.confidentP06865
Beta-hexosaminidase subunit alpha Responsible for the degradation of GM2 gangliosides, and a variety of other molecules containing terminal N-acetyl hexosamines, in the brain and other tissues.confidentQ641X3

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0001501 [BP]skeletal system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0007605 [BP]sensory perception of soundprobableGO:0032501, GO:0044707, GO:0050954, GO:0007600, GO:0008150, GO:0050877, GO:0044699, GO:0003008
GO:0006689 [BP]ganglioside catabolic processprobableGO:0044248, GO:0006807, GO:0044242, GO:0006629, GO:1901575, GO:0016042, GO:0071704, GO:0006687, GO:0046466, GO:0019377, GO:0006664, GO:0006665, GO:0030149, GO:0006643, GO:0009987, GO:0044710, GO:0008150, GO:0008152, GO:0044255, GO:0009056, GO:0044238, GO:0001573, GO:1901564, GO:1901565, GO:1901136, GO:1901135, GO:0044237, GO:0046479, GO:0046514, GO:0006672
GO:0019538 [BP]protein metabolic processprobableGO:0071704, GO:0044238, GO:0008150, GO:0008152, GO:0043170
GO:0030203 [BP]glycosaminoglycan metabolic processprobableGO:1901564, GO:1901135, GO:0043170, GO:0071704, GO:0006807, GO:0008150, GO:0008152, GO:0006022
GO:0007626 [BP]locomotory behaviorprobableGO:0044708, GO:0050896, GO:0008150, GO:0007610
GO:0006044 [BP]N-acetylglucosamine metabolic processprobableGO:0006040, GO:1901135, GO:0071704, GO:0008150, GO:0008152, GO:1901071
GO:0051179 [BP]localizationprobableGO:0008150
GO:0042552 [BP]myelinationprobableGO:0042391, GO:0019226, GO:0035637, GO:0050801, GO:0019228, GO:0042592, GO:0023052, GO:0001508, GO:0007272, GO:0007275, GO:0044699, GO:0065007, GO:0019725, GO:0065008, GO:0032502, GO:0032501, GO:0050877, GO:0009987, GO:0006873, GO:0008150, GO:0008366, GO:0048731, GO:0007154, GO:0055082, GO:0003008, GO:0044700, GO:0044707, GO:0007399, GO:0048856, GO:0048878, GO:0044763
GO:0044260 [BP]cellular macromolecule metabolic processprobableGO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0046982 [MF]protein heterodimerization activityprobableGO:0046983, GO:0003674, GO:0005488, GO:0005515
GO:0006026 [BP]aminoglycan catabolic processprobableGO:1901575, GO:1901564, GO:1901565, GO:1901136, GO:1901135, GO:0043170, GO:0071704, GO:0006807, GO:0008150, GO:0008152, GO:0006022, GO:0009056, GO:0009057
GO:0019953 [BP]sexual reproductionprobableGO:0008150, GO:0000003
GO:0001669 [CC]acrosomal vesicleprobableGO:0005737, GO:0043231, GO:0016023, GO:0030141, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0031410, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0006644 [BP]phospholipid metabolic processprobableGO:0044238, GO:0044710, GO:0006629, GO:0009987, GO:0044237, GO:0071704, GO:0006796, GO:0008150, GO:0008152, GO:0006793, GO:0019637, GO:0044255
GO:0016231 [MF]beta-N-acetylglucosaminidase activityprobableGO:0016787, GO:0016798, GO:0015929, GO:0003824, GO:0004563, GO:0003674, GO:0004553
GO:0030246 [MF]carbohydrate bindingprobableGO:0003674, GO:0005488
GO:0050905 [BP]neuromuscular processprobableGO:0032501, GO:0044707, GO:0050877, GO:0008150, GO:0044699, GO:0003008
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0022008 [BP]neurogenesisprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0009987, GO:0007275, GO:0044699
GO:0005975 [BP]carbohydrate metabolic processprobableGO:0044238, GO:0008150, GO:0008152, GO:0071704
GO:0005764 [CC]lysosomeprobableGO:0005737, GO:0000323, GO:0043231, GO:0005773, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3RCN, chain A
Confidence level:very confident
Coverage over the Query: 35-304
View the alignment between query and template
View the model in PyMOL
Template: 1NOW, chain A
Confidence level:very confident
Coverage over the Query: 6-215
View the alignment between query and template
View the model in PyMOL