Query         psy11384
Match_columns 137
No_of_seqs    126 out of 182
Neff          3.3 
Searched_HMMs 46136
Date          Fri Aug 16 17:01:39 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy11384.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/11384hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PLN00186 ribosomal protein S26 100.0 1.3E-63 2.8E-68  371.7   7.4  105    1-105     1-105 (109)
  2 PF01283 Ribosomal_S26e:  Ribos 100.0 5.6E-64 1.2E-68  375.3   3.5  110    1-110     1-110 (113)
  3 PTZ00172 40S ribosomal protein 100.0 3.7E-63 8.1E-68  368.8   7.8  104    1-104     1-104 (108)
  4 PRK09335 30S ribosomal protein 100.0 1.5E-57 3.3E-62  332.5   6.4   94    1-98      1-94  (95)
  5 KOG1768|consensus              100.0   2E-55 4.3E-60  330.2   4.6  111    1-111     1-111 (115)
  6 COG4830 RPS26B Ribosomal prote 100.0   4E-52 8.6E-57  308.7   5.8   97    1-97      1-97  (108)
  7 COG1400 SEC65 Signal recogniti  76.8    0.73 1.6E-05   34.0  -0.2   26   27-54     20-45  (93)
  8 PF02591 DUF164:  Putative zinc  56.4     6.1 0.00013   25.4   1.0   13   18-30     44-56  (56)
  9 PF07503 zf-HYPF:  HypF finger;  55.0     6.1 0.00013   24.2   0.8   14   15-28     16-29  (35)
 10 PF08209 Sgf11:  Sgf11 (transcr  49.6     9.4  0.0002   23.3   1.0   15   18-32      2-16  (33)
 11 PF09889 DUF2116:  Uncharacteri  48.6     7.7 0.00017   26.4   0.6   17   21-37      4-20  (59)
 12 TIGR01031 rpmF_bact ribosomal   48.1      14  0.0003   24.5   1.8   28    2-29      2-35  (55)
 13 PF04726 Microvir_J:  Microviru  44.5      12 0.00027   21.7   0.9   15    1-15      1-15  (24)
 14 PRK04016 DNA-directed RNA poly  41.7      13 0.00028   25.8   0.9   14   19-32      3-16  (62)
 15 KOG2612|consensus               40.1      12 0.00026   28.3   0.5   15   17-31     71-85  (103)
 16 PF01922 SRP19:  SRP19 protein;  39.2     9.2  0.0002   27.6  -0.2   23   26-48     16-38  (95)
 17 PF13248 zf-ribbon_3:  zinc-rib  39.1      13 0.00028   20.8   0.5   15   20-34      2-16  (26)
 18 COG1644 RPB10 DNA-directed RNA  38.3      14 0.00031   25.8   0.7   13   19-31      3-15  (63)
 19 COG4481 Uncharacterized protei  37.6      16 0.00035   25.3   0.8   15   16-30     30-44  (60)
 20 PF13119 DUF3973:  Domain of un  36.5      16 0.00035   23.7   0.7   11   71-81      1-12  (41)
 21 PF10122 Mu-like_Com:  Mu-like   34.4      19 0.00042   24.2   0.8   18   19-36      3-20  (51)
 22 PLN00032 DNA-directed RNA poly  34.3      20 0.00043   25.5   0.9   12   19-30      3-14  (71)
 23 COG1150 HdrC Heterodisulfide r  33.8      22 0.00049   29.4   1.2   49   20-78     38-89  (195)
 24 PF07496 zf-CW:  CW-type Zinc F  33.3      20 0.00044   22.8   0.7   13   20-32      3-17  (50)
 25 PF01194 RNA_pol_N:  RNA polyme  33.2      18 0.00038   24.9   0.5   13   19-31      3-15  (60)
 26 COG5112 UFD2 U1-like Zn-finger  33.1      14 0.00031   28.7  -0.0   45   35-81     17-65  (126)
 27 PF03604 DNA_RNApol_7kD:  DNA d  30.1      23 0.00049   21.4   0.5   12   18-29     15-26  (32)
 28 COG5134 Uncharacterized conser  30.0      28 0.00061   30.1   1.3   46   19-78     41-86  (272)
 29 PRK12286 rpmF 50S ribosomal pr  29.1      37  0.0008   22.7   1.5   29    2-30      4-37  (57)
 30 PRK14890 putative Zn-ribbon RN  27.7      32 0.00069   23.7   1.0   26   18-44      5-31  (59)
 31 PF10589 NADH_4Fe-4S:  NADH-ubi  27.5      20 0.00043   22.7  -0.1    9   24-32     14-22  (46)
 32 KOG3408|consensus               27.1      19 0.00041   28.3  -0.3   18   62-81     50-67  (129)
 33 COG2888 Predicted Zn-ribbon RN  26.5      38 0.00083   23.6   1.2   34   18-52      7-41  (61)
 34 KOG3198|consensus               26.2      22 0.00049   28.6   0.0   31   27-59     32-62  (152)
 35 PF13240 zinc_ribbon_2:  zinc-r  25.4      32  0.0007   19.1   0.6   12   22-33      1-12  (23)
 36 PF12230 PRP21_like_P:  Pre-mRN  24.7      25 0.00053   28.2   0.0   31   16-47    164-194 (229)
 37 PF14832 Tautomerase_3:  Putati  23.2      60  0.0013   24.9   1.9   25   48-74     20-44  (136)
 38 PF10262 Rdx:  Rdx family;  Int  22.4      40 0.00087   22.6   0.7   19   69-87      3-21  (76)
 39 PF13717 zinc_ribbon_4:  zinc-r  22.4      54  0.0012   19.7   1.2   14   16-29     21-34  (36)
 40 PF13913 zf-C2HC_2:  zinc-finge  22.3      39 0.00084   18.9   0.5   14   20-33      2-15  (25)
 41 TIGR02174 CXXU_selWTH selT/sel  21.7      38 0.00082   22.8   0.4   13   69-81      1-13  (72)
 42 KOG3497|consensus               21.6      40 0.00087   23.9   0.6   13   19-31      3-15  (69)
 43 PF04810 zf-Sec23_Sec24:  Sec23  21.5      43 0.00094   20.4   0.7   11   20-30      2-12  (40)
 44 PF07282 OrfB_Zn_ribbon:  Putat  21.0      66  0.0014   20.8   1.5   19   15-33     41-59  (69)
 45 PRK00754 signal recognition pa  20.8      28 0.00062   25.4  -0.3   20   27-46     23-42  (95)
 46 PF10238 Eapp_C:  E2F-associate  20.8      74  0.0016   24.8   2.0   12   19-30    108-119 (136)
 47 KOG3286|consensus               20.3      63  0.0014   27.5   1.6   13   69-81     72-84  (226)

No 1  
>PLN00186 ribosomal protein S26; Provisional
Probab=100.00  E-value=1.3e-63  Score=371.71  Aligned_cols=105  Identities=68%  Similarity=1.199  Sum_probs=103.2

Q ss_pred             CCccccCCCCCCCCCCCccceeccCCCcccccccceeeceeecchhhHHhhhHHhhccccccccceeeEeEEEeeeeeee
Q psy11384          1 MTCKRRNGGRSKHGRGHVNPVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDITEASYYQSYQLPKLYAKLHYCVSCAIH   80 (137)
Q Consensus         1 M~kKRrNnGR~KkgrGhv~~V~C~NCgrcvPKDKAIKrf~irNiVEaaavRDiseAsV~~~y~lPKlyvKl~YCVSCAIH   80 (137)
                      ||+|||||||+|+|||||++|+|+|||+|||||||||+|+|+||||+||+|||+||+||++|.|||||+|+|||||||||
T Consensus         1 M~kKRrN~GR~K~~rGhv~~V~C~nCgr~vPKDKAIkrf~irniVe~aa~rDl~~a~vy~~y~lPKly~K~~YCVSCAIH   80 (109)
T PLN00186          1 MTKKRRNGGRNKHGRGHVKRIRCSNCGKCVPKDKAIKRFLVRNIVEQAALRDVQEACVYDGYTLPKLYAKVQYCISCAIH   80 (109)
T ss_pred             CCcccccCCCCCCCCCCCcceeeCCCcccccccceEEEEecccCccHHHHHHHHhhhcccccccchhhhceEEEEeehhc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCcccccCccccccCCCCCCCCCCC
Q psy11384         81 SKVVRNRSKSDRRIRTPPQRNFPRS  105 (137)
Q Consensus        81 skVVRvRS~e~RK~R~pp~~~~~~~  105 (137)
                      ++|||+||+|+||+|+||++|++..
T Consensus        81 ~~iVRvRs~e~Rk~r~pp~r~~~~~  105 (109)
T PLN00186         81 SRVVRVRSRENRRIREPPPRFRRRK  105 (109)
T ss_pred             cceeecCChHHccccCCCccccccc
Confidence            9999999999999999999998754


No 2  
>PF01283 Ribosomal_S26e:  Ribosomal protein S26e;  InterPro: IPR000892 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. A number of eukaryotic ribosomal proteins can be grouped on the basis of sequence similarities. One of these families, the S26E family, includes mammalian S26 []; Octopus S26 []; Drosophila S26 (DS31) []; plant cytoplasmic S26; and fungal S26 []. These proteins have 114 to 127 amino acids.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 3U5G_a 3U5C_a 2XZM_5 2XZN_5.
Probab=100.00  E-value=5.6e-64  Score=375.25  Aligned_cols=110  Identities=73%  Similarity=1.160  Sum_probs=73.0

Q ss_pred             CCccccCCCCCCCCCCCccceeccCCCcccccccceeeceeecchhhHHhhhHHhhccccccccceeeEeEEEeeeeeee
Q psy11384          1 MTCKRRNGGRSKHGRGHVNPVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDITEASYYQSYQLPKLYAKLHYCVSCAIH   80 (137)
Q Consensus         1 M~kKRrNnGR~KkgrGhv~~V~C~NCgrcvPKDKAIKrf~irNiVEaaavRDiseAsV~~~y~lPKlyvKl~YCVSCAIH   80 (137)
                      ||+|||||||+|+|||||++|+|+|||+|||||||||+|+|+||||++++|||+||+||++|+|||||+|+|||||||||
T Consensus         1 M~~KRrN~Gr~KkgrGhv~~V~C~nCgr~vPKDKAIkrf~i~niVeaaa~rdi~~a~v~~~y~lPKlyvK~~YCvSCAIH   80 (113)
T PF01283_consen    1 MTKKRRNNGRSKKGRGHVQPVRCDNCGRCVPKDKAIKRFVIRNIVEAAAVRDISEASVYDAYVLPKLYVKLYYCVSCAIH   80 (113)
T ss_dssp             -----TTTTSS-SSSS---EEE-TTTB-EEECCCSEEEEEEEESS-CCCHHHHHHCB-SSS--S-EEEEEEEE-CHHHHH
T ss_pred             CCcccccCCCCCCCCCCCcCEeeCcccccCcCCceEEEEEccCCccHHHHHHHhhcceeeecccccceeEEEEeeeeeee
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCcccccCccccccCCCCCCCCCCCCCCCc
Q psy11384         81 SKVVRNRSKSDRRIRTPPQRNFPRSVSLTE  110 (137)
Q Consensus        81 skVVRvRS~e~RK~R~pp~~~~~~~~~~~~  110 (137)
                      ++|||+||+|+||+|+||++|++......+
T Consensus        81 ~~IVr~Rs~e~RK~r~~p~~~~~~~~~~~~  110 (113)
T PF01283_consen   81 SKIVRVRSREERKDRTPPPRFRPRKQGQKP  110 (113)
T ss_dssp             TTSS----TCCCC--S--------------
T ss_pred             ccccccCChHHccccCCCCcCCcccccccc
Confidence            999999999999999999999987665543


No 3  
>PTZ00172 40S ribosomal protein S26; Provisional
Probab=100.00  E-value=3.7e-63  Score=368.78  Aligned_cols=104  Identities=75%  Similarity=1.270  Sum_probs=101.6

Q ss_pred             CCccccCCCCCCCCCCCccceeccCCCcccccccceeeceeecchhhHHhhhHHhhccccccccceeeEeEEEeeeeeee
Q psy11384          1 MTCKRRNGGRSKHGRGHVNPVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDITEASYYQSYQLPKLYAKLHYCVSCAIH   80 (137)
Q Consensus         1 M~kKRrNnGR~KkgrGhv~~V~C~NCgrcvPKDKAIKrf~irNiVEaaavRDiseAsV~~~y~lPKlyvKl~YCVSCAIH   80 (137)
                      ||+|||||||+|+|||||++|+|+|||+|||||||||+|+|+||||+||++||+||+||++|+|||||+|+|||||||||
T Consensus         1 M~kKRrN~GR~K~~rGhv~~V~C~nCgr~vPKDKAIkrf~irniVe~aa~rDl~~a~v~~~y~lPKly~k~~YCVSCAIH   80 (108)
T PTZ00172          1 MTSKRRNNGRSKHGRGHVKPVRCSNCGRCVPKDKAIKRFVVRNIVDAASVRDIAEASVYYGYPLPKLYMKQQYCVSCAIH   80 (108)
T ss_pred             CCcccccCCCCCCCCCCCccEEeCCccccccccceEEEEeccCCccHHHHHHHHHhhchhccccccceeeeEEeeehhhc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCcccccCccccccCCCCCCCCCC
Q psy11384         81 SKVVRNRSKSDRRIRTPPQRNFPR  104 (137)
Q Consensus        81 skVVRvRS~e~RK~R~pp~~~~~~  104 (137)
                      ++|||+||+|+||+|+||++|...
T Consensus        81 ~~iVRvRs~e~Rk~r~pp~r~~~~  104 (108)
T PTZ00172         81 SRVVRVRSREDRKIRTPPKRPFRP  104 (108)
T ss_pred             CCeeecCChHHccccCCCCCCCCC
Confidence            999999999999999999887543


No 4  
>PRK09335 30S ribosomal protein S26e; Provisional
Probab=100.00  E-value=1.5e-57  Score=332.53  Aligned_cols=94  Identities=32%  Similarity=0.631  Sum_probs=92.2

Q ss_pred             CCccccCCCCCCCCCCCccceeccCCCcccccccceeeceeecchhhHHhhhHHhhccccccccceeeEeEEEeeeeeee
Q psy11384          1 MTCKRRNGGRSKHGRGHVNPVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDITEASYYQSYQLPKLYAKLHYCVSCAIH   80 (137)
Q Consensus         1 M~kKRrNnGR~KkgrGhv~~V~C~NCgrcvPKDKAIKrf~irNiVEaaavRDiseAsV~~~y~lPKlyvKl~YCVSCAIH   80 (137)
                      ||+||+||||+|+|+|||++|+|+|||+|||||||||+|+|+||||+++++||+||++|    |||||+|+|||||||||
T Consensus         1 M~kKRrn~GR~K~~rGhv~~V~C~nCgr~vPKDKAIkrf~i~n~Ve~a~~rdl~~a~~~----lpk~~~k~~YCvSCAiH   76 (95)
T PRK09335          1 MPKKRENRGRRKGDKGHVGYVQCDNCGRRVPRDKAVCVTKMYSPVDPQLAKELEKKGAI----IARYPVTKCYCVNCAVH   76 (95)
T ss_pred             CCcccccCCCCCCCCCCCccEEeCCCCCcCcCCceEEEEEecCCCCHHHHHHHHhCcee----eeeeeeeeEEechhhhh
Confidence            99999999999999999999999999999999999999999999999999999999887    99999999999999999


Q ss_pred             cCcccccCccccccCCCC
Q psy11384         81 SKVVRNRSKSDRRIRTPP   98 (137)
Q Consensus        81 skVVRvRS~e~RK~R~pp   98 (137)
                      ++|||+||+|+||+|+|.
T Consensus        77 ~~IVrvRs~e~Rk~r~~~   94 (95)
T PRK09335         77 LGIIKIRPEEERKKKAPL   94 (95)
T ss_pred             ccccccCChHHcccccCC
Confidence            999999999999999864


No 5  
>KOG1768|consensus
Probab=100.00  E-value=2e-55  Score=330.15  Aligned_cols=111  Identities=75%  Similarity=1.194  Sum_probs=107.3

Q ss_pred             CCccccCCCCCCCCCCCccceeccCCCcccccccceeeceeecchhhHHhhhHHhhccccccccceeeEeEEEeeeeeee
Q psy11384          1 MTCKRRNGGRSKHGRGHVNPVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDITEASYYQSYQLPKLYAKLHYCVSCAIH   80 (137)
Q Consensus         1 M~kKRrNnGR~KkgrGhv~~V~C~NCgrcvPKDKAIKrf~irNiVEaaavRDiseAsV~~~y~lPKlyvKl~YCVSCAIH   80 (137)
                      ||+||+|+|++|+|+||+.+|+|+||++|||||||||+|+|+||||++++|||+|||||++|+|||||+|||||||||||
T Consensus         1 m~~kr~~~gr~k~~~g~v~~i~c~~c~~~~~kdKaIk~f~i~niVEaaavrdiseasv~d~y~~pKly~Klhycvscaih   80 (115)
T KOG1768|consen    1 MTKKRRNAGRNKKGRGHVIPIRCTNCGRCMPKDKAIKRFVIRNIVEAAAVRDISEASVFDAYVLPKLYVKLHYCVSCAIH   80 (115)
T ss_pred             CCcccccCCCCCCCCcceeeeeeccccccchHHHHHHHHHHHHHHHHHHhhhhhhheeccccccccccceeeeeEeeeee
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCcccccCccccccCCCCCCCCCCCCCCCcc
Q psy11384         81 SKVVRNRSKSDRRIRTPPQRNFPRSVSLTEG  111 (137)
Q Consensus        81 skVVRvRS~e~RK~R~pp~~~~~~~~~~~~~  111 (137)
                      ++|||+||+|.||+|+||++|.+++++.++.
T Consensus        81 skVvR~rS~e~rrir~pp~rf~~~~~~~~~~  111 (115)
T KOG1768|consen   81 SKVVRVRSREARRIRTPPPRFSPRAPSLRPP  111 (115)
T ss_pred             eeeeccchhhhhcccCCCcccCccccccCCC
Confidence            9999999999999999999999877765543


No 6  
>COG4830 RPS26B Ribosomal protein S26 [Translation, ribosomal structure and biogenesis]
Probab=100.00  E-value=4e-52  Score=308.65  Aligned_cols=97  Identities=63%  Similarity=1.074  Sum_probs=96.7

Q ss_pred             CCccccCCCCCCCCCCCccceeccCCCcccccccceeeceeecchhhHHhhhHHhhccccccccceeeEeEEEeeeeeee
Q psy11384          1 MTCKRRNGGRSKHGRGHVNPVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDITEASYYQSYQLPKLYAKLHYCVSCAIH   80 (137)
Q Consensus         1 M~kKRrNnGR~KkgrGhv~~V~C~NCgrcvPKDKAIKrf~irNiVEaaavRDiseAsV~~~y~lPKlyvKl~YCVSCAIH   80 (137)
                      |||||+||||+|+||||+.+|+|+|||..||||||||+|.|+|+||+|+++||++|+||+.|.+||+|.|++||||||||
T Consensus         1 mpkkR~N~GR~K~~rGhv~~v~CdnCg~~vPkdKAikr~~i~s~Ve~a~~rdL~~asIy~~y~vpk~~~k~qyCVsCAih   80 (108)
T COG4830           1 MPKKRRNRGRNKKGRGHVKYVRCDNCGKAVPKDKAIKRTAIRSPVEAAAARDLSEASIYSEYAVPKTYNKLQYCVSCAIH   80 (108)
T ss_pred             CcchhhhcCCCCCCCCCccceeeccccccCCccceeeEeeccCcccHHHHHHHhhceeeeeeeccccccceeeeeeeeee
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCcccccCccccccCCC
Q psy11384         81 SKVVRNRSKSDRRIRTP   97 (137)
Q Consensus        81 skVVRvRS~e~RK~R~p   97 (137)
                      ++|||+||+|+||++.|
T Consensus        81 ~~IvrVRSre~RK~r~p   97 (108)
T COG4830          81 ARIVRVRSREERKIRAP   97 (108)
T ss_pred             eeEEEEecchhhhhcCC
Confidence            99999999999999999


No 7  
>COG1400 SEC65 Signal recognition particle 19 kDa protein [Intracellular trafficking and secretion]
Probab=76.82  E-value=0.73  Score=34.03  Aligned_cols=26  Identities=35%  Similarity=0.585  Sum_probs=22.0

Q ss_pred             CcccccccceeeceeecchhhHHhhhHH
Q psy11384         27 ARCVPKDKAIKKFVIRNIVEAAAVRDIT   54 (137)
Q Consensus        27 grcvPKDKAIKrf~irNiVEaaavRDis   54 (137)
                      ||+|||+.||..+...+|+++  +++|-
T Consensus        20 GRrvpk~laV~~P~~~ei~~a--~~~LG   45 (93)
T COG1400          20 GRRVPKELAVENPSLEEIAEA--LRELG   45 (93)
T ss_pred             ccccchhhcccCCCHHHHHHH--HHHcC
Confidence            599999999999999999886  55554


No 8  
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=56.40  E-value=6.1  Score=25.38  Aligned_cols=13  Identities=38%  Similarity=0.728  Sum_probs=10.5

Q ss_pred             ccceeccCCCccc
Q psy11384         18 VNPVRCTNCARCV   30 (137)
Q Consensus        18 v~~V~C~NCgrcv   30 (137)
                      ...+.|+||||.+
T Consensus        44 ~~i~~Cp~CgRiL   56 (56)
T PF02591_consen   44 DEIVFCPNCGRIL   56 (56)
T ss_pred             CCeEECcCCCccC
Confidence            4678999999863


No 9  
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=55.00  E-value=6.1  Score=24.24  Aligned_cols=14  Identities=43%  Similarity=0.788  Sum_probs=8.9

Q ss_pred             CCCccceeccCCCc
Q psy11384         15 RGHVNPVRCTNCAR   28 (137)
Q Consensus        15 rGhv~~V~C~NCgr   28 (137)
                      |=|-++|-|++||-
T Consensus        16 R~~~~~isC~~CGP   29 (35)
T PF07503_consen   16 RFHYQFISCTNCGP   29 (35)
T ss_dssp             TTT-TT--BTTCC-
T ss_pred             cccCcCccCCCCCC
Confidence            46899999999994


No 10 
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=49.62  E-value=9.4  Score=23.29  Aligned_cols=15  Identities=40%  Similarity=0.691  Sum_probs=10.2

Q ss_pred             ccceeccCCCccccc
Q psy11384         18 VNPVRCTNCARCVPK   32 (137)
Q Consensus        18 v~~V~C~NCgrcvPK   32 (137)
                      ...+.|.||+|-|.-
T Consensus         2 ~~~~~C~nC~R~v~a   16 (33)
T PF08209_consen    2 SPYVECPNCGRPVAA   16 (33)
T ss_dssp             S-EEE-TTTSSEEEG
T ss_pred             CCeEECCCCcCCcch
Confidence            357899999997753


No 11 
>PF09889 DUF2116:  Uncharacterized protein containing a Zn-ribbon (DUF2116);  InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown. They contain a conserved zinc ribbon motif in the N-terminal part and a predicted transmembrane segment in the C-terminal part.
Probab=48.56  E-value=7.7  Score=26.39  Aligned_cols=17  Identities=24%  Similarity=0.690  Sum_probs=15.0

Q ss_pred             eeccCCCccccccccee
Q psy11384         21 VRCTNCARCVPKDKAIK   37 (137)
Q Consensus        21 V~C~NCgrcvPKDKAIK   37 (137)
                      -||-+||.-+|-|++.+
T Consensus         4 kHC~~CG~~Ip~~~~fC   20 (59)
T PF09889_consen    4 KHCPVCGKPIPPDESFC   20 (59)
T ss_pred             CcCCcCCCcCCcchhhh
Confidence            37999999999998876


No 12 
>TIGR01031 rpmF_bact ribosomal protein L32. This protein describes bacterial ribosomal protein L32. The noise cutoff is set low enough to include the equivalent protein from mitochondria and chloroplasts. No related proteins from the Archaea nor from the eukaryotic cytosol are detected by this model. This model is a fragment model; the putative L32 of some species shows similarity only toward the N-terminus.
Probab=48.11  E-value=14  Score=24.45  Aligned_cols=28  Identities=25%  Similarity=0.545  Sum_probs=18.7

Q ss_pred             CccccCCCCCCCCCCC------ccceeccCCCcc
Q psy11384          2 TCKRRNGGRSKHGRGH------VNPVRCTNCARC   29 (137)
Q Consensus         2 ~kKRrNnGR~KkgrGh------v~~V~C~NCgrc   29 (137)
                      ||+|-+..|..+=|.|      ...+.|.+||..
T Consensus         2 PKrk~Sksr~~~RRah~~kl~~p~l~~C~~cG~~   35 (55)
T TIGR01031         2 PKRKTSKSRKRKRRSHDAKLTAPTLVVCPNCGEF   35 (55)
T ss_pred             CCCcCCcccccchhcCcccccCCcceECCCCCCc
Confidence            5566665555555566      567889999963


No 13 
>PF04726 Microvir_J:  Microvirus J protein;  InterPro: IPR006815 This small protein is involved in DNA packaging, interacting with DNA via its hydrophobic C terminus. In bacteriophage phi-X174, J is present in 60 copies, and forms an S-shaped polypeptide chain without any secondary structure. It is thought to interact with DNA through simple charge interactions [].; GO: 0003677 DNA binding, 0019073 viral DNA genome packaging, 0019028 viral capsid; PDB: 1M06_J 1GFF_3 1RB8_J 2BPA_3.
Probab=44.49  E-value=12  Score=21.72  Aligned_cols=15  Identities=53%  Similarity=0.904  Sum_probs=7.9

Q ss_pred             CCccccCCCCCCCCC
Q psy11384          1 MTCKRRNGGRSKHGR   15 (137)
Q Consensus         1 M~kKRrNnGR~Kkgr   15 (137)
                      |-++||+.|++|+.|
T Consensus         1 ~k~~rrs~~~~kgar   15 (24)
T PF04726_consen    1 MKSKRRSGGKRKGAR   15 (24)
T ss_dssp             --GGGS---SSSSS-
T ss_pred             CcccccCCCccCceE
Confidence            567899999999876


No 14 
>PRK04016 DNA-directed RNA polymerase subunit N; Provisional
Probab=41.70  E-value=13  Score=25.77  Aligned_cols=14  Identities=36%  Similarity=0.999  Sum_probs=11.6

Q ss_pred             cceeccCCCccccc
Q psy11384         19 NPVRCTNCARCVPK   32 (137)
Q Consensus        19 ~~V~C~NCgrcvPK   32 (137)
                      -||+|..||+.+--
T Consensus         3 iPvRCFTCGkvi~~   16 (62)
T PRK04016          3 IPVRCFTCGKVIAE   16 (62)
T ss_pred             CCeEecCCCCChHH
Confidence            58999999997743


No 15 
>KOG2612|consensus
Probab=40.14  E-value=12  Score=28.27  Aligned_cols=15  Identities=33%  Similarity=0.625  Sum_probs=12.1

Q ss_pred             CccceeccCCCcccc
Q psy11384         17 HVNPVRCTNCARCVP   31 (137)
Q Consensus        17 hv~~V~C~NCgrcvP   31 (137)
                      ..+.++|.||+|.|.
T Consensus        71 k~~~~hCeNC~RdVa   85 (103)
T KOG2612|consen   71 KPMDCHCENCDRDVA   85 (103)
T ss_pred             CCccccCCCCccHHH
Confidence            456799999999764


No 16 
>PF01922 SRP19:  SRP19 protein;  InterPro: IPR002778  The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]. SRP recognises the signal sequence of the nascent polypeptide on the ribosome, retards its elongation, and docks the SRP-ribosome-polypeptide complex to the RER membrane via the SR receptor. Eukaryotic SRP consists of six polypeptides (SRP9, SRP14, SRP19, SRP54, SRP68 and SRP72) and a single 300 nucleotide 7S RNA molecule. The RNA component catalyses the interaction of SRP with its SR receptor []. In higher eukaryotes, the SRP complex consists of the Alu domain and the S domain linked by the SRP RNA. The Alu domain consists of a heterodimer of SRP9 and SRP14 bound to the 5' and 3' terminal sequences of SRP RNA. This domain is necessary for retarding the elongation of the nascent polypeptide chain, which gives SRP time to dock the ribosome-polypeptide complex to the RER membrane. In archaea, the SRP complex contains 7S RNA like its eukaryotic counterpart, yet only includes two of the six protein subunits found in the eukarytic complex: SRP19 and SRP54 []. This entry represents the SRP19 subunit. The SRP19 protein is unstructured but forms a compact core domain and two extended RNA-binding loops upon binding the signal recognition particle (SRP) RNA [].; GO: 0008312 7S RNA binding, 0006614 SRP-dependent cotranslational protein targeting to membrane, 0048500 signal recognition particle; PDB: 3DLU_A 3DLV_B 2J37_B 1MFQ_B 3KTV_D 1RY1_B 1JID_A 1KVV_A 1KVN_A 3KTW_B ....
Probab=39.23  E-value=9.2  Score=27.59  Aligned_cols=23  Identities=30%  Similarity=0.469  Sum_probs=14.4

Q ss_pred             CCcccccccceeeceeecchhhH
Q psy11384         26 CARCVPKDKAIKKFVIRNIVEAA   48 (137)
Q Consensus        26 CgrcvPKDKAIKrf~irNiVEaa   48 (137)
                      -||.|||+.|+..-.+..|.+|.
T Consensus        16 ~GRrv~k~~aV~~P~~~EI~~a~   38 (95)
T PF01922_consen   16 EGRRVPKELAVENPTLEEIADAC   38 (95)
T ss_dssp             TT--SSTTTSBSS--HHHHHHHH
T ss_pred             hccccChhhcCCCCCHHHHHHHH
Confidence            47999999999877766666553


No 17 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=39.14  E-value=13  Score=20.85  Aligned_cols=15  Identities=27%  Similarity=0.618  Sum_probs=10.8

Q ss_pred             ceeccCCCccccccc
Q psy11384         20 PVRCTNCARCVPKDK   34 (137)
Q Consensus        20 ~V~C~NCgrcvPKDK   34 (137)
                      .+.|.|||.-++.|-
T Consensus         2 ~~~Cp~Cg~~~~~~~   16 (26)
T PF13248_consen    2 EMFCPNCGAEIDPDA   16 (26)
T ss_pred             cCCCcccCCcCCccc
Confidence            357889998776663


No 18 
>COG1644 RPB10 DNA-directed RNA polymerase, subunit N (RpoN/RPB10) [Transcription]
Probab=38.34  E-value=14  Score=25.81  Aligned_cols=13  Identities=38%  Similarity=1.007  Sum_probs=10.8

Q ss_pred             cceeccCCCcccc
Q psy11384         19 NPVRCTNCARCVP   31 (137)
Q Consensus        19 ~~V~C~NCgrcvP   31 (137)
                      -||||-+||+.+-
T Consensus         3 iPiRCFsCGkvi~   15 (63)
T COG1644           3 IPVRCFSCGKVIG   15 (63)
T ss_pred             CceEeecCCCCHH
Confidence            4899999998764


No 19 
>COG4481 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=37.61  E-value=16  Score=25.30  Aligned_cols=15  Identities=33%  Similarity=0.813  Sum_probs=10.7

Q ss_pred             CCccceeccCCCccc
Q psy11384         16 GHVNPVRCTNCARCV   30 (137)
Q Consensus        16 Ghv~~V~C~NCgrcv   30 (137)
                      |---.|.|+|||+.|
T Consensus        30 GaDIkikC~nC~h~v   44 (60)
T COG4481          30 GADIKIKCENCGHSV   44 (60)
T ss_pred             cCcEEEEecCCCcEE
Confidence            333468899999853


No 20 
>PF13119 DUF3973:  Domain of unknown function (DUF3973)
Probab=36.53  E-value=16  Score=23.67  Aligned_cols=11  Identities=45%  Similarity=1.367  Sum_probs=7.9

Q ss_pred             EEEeeee-eeec
Q psy11384         71 LHYCVSC-AIHS   81 (137)
Q Consensus        71 l~YCVSC-AIHs   81 (137)
                      .+|||+| -||.
T Consensus         1 MyYCi~Cs~~h~   12 (41)
T PF13119_consen    1 MYYCINCSEIHH   12 (41)
T ss_pred             CEEEEEhHHhHH
Confidence            3799999 4553


No 21 
>PF10122 Mu-like_Com:  Mu-like prophage protein Com;  InterPro: IPR019294  Members of this entry belong to the Com family of proteins that act as translational regulators of mom [, ]. 
Probab=34.39  E-value=19  Score=24.16  Aligned_cols=18  Identities=22%  Similarity=0.724  Sum_probs=13.8

Q ss_pred             cceeccCCCcccccccce
Q psy11384         19 NPVRCTNCARCVPKDKAI   36 (137)
Q Consensus        19 ~~V~C~NCgrcvPKDKAI   36 (137)
                      +-|||.+|++++-+-...
T Consensus         3 ~eiRC~~CnklLa~~g~~   20 (51)
T PF10122_consen    3 KEIRCGHCNKLLAKAGEV   20 (51)
T ss_pred             cceeccchhHHHhhhcCc
Confidence            579999999988774333


No 22 
>PLN00032 DNA-directed RNA polymerase; Provisional
Probab=34.31  E-value=20  Score=25.54  Aligned_cols=12  Identities=42%  Similarity=1.124  Sum_probs=10.4

Q ss_pred             cceeccCCCccc
Q psy11384         19 NPVRCTNCARCV   30 (137)
Q Consensus        19 ~~V~C~NCgrcv   30 (137)
                      -||||-.||+.+
T Consensus         3 iPVRCFTCGkvi   14 (71)
T PLN00032          3 IPVRCFTCGKVI   14 (71)
T ss_pred             CceeecCCCCCc
Confidence            489999999876


No 23 
>COG1150 HdrC Heterodisulfide reductase, subunit C [Energy production and conversion]
Probab=33.75  E-value=22  Score=29.40  Aligned_cols=49  Identities=24%  Similarity=0.523  Sum_probs=35.2

Q ss_pred             ceeccCCCcc---cccccceeeceeecchhhHHhhhHHhhccccccccceeeEeEEEeeeee
Q psy11384         20 PVRCTNCARC---VPKDKAIKKFVIRNIVEAAAVRDITEASYYQSYQLPKLYAKLHYCVSCA   78 (137)
Q Consensus        20 ~V~C~NCgrc---vPKDKAIKrf~irNiVEaaavRDiseAsV~~~y~lPKlyvKl~YCVSCA   78 (137)
                      .-.|.+||-|   +|--.. -.|..|-||.-+...|..  .++....       +++|++|-
T Consensus        38 l~~C~QCG~CT~sCPs~r~-t~y~pR~ii~~~~~g~~d--~il~~~~-------lW~C~tCy   89 (195)
T COG1150          38 LEGCYQCGTCTGSCPSGRF-TDYSPRKIIRKARLGLVD--LILSSES-------LWACVTCY   89 (195)
T ss_pred             HhHhhccCcccCCCCCccc-CCCCHHHHHHHHHcccHH--HHhcCCc-------ceeeeech
Confidence            3347777765   687777 678888999888777766  4554443       48999993


No 24 
>PF07496 zf-CW:  CW-type Zinc Finger;  InterPro: IPR011124 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a CW-type zinc finger motif, named for its conserved cysteine and tryptophan residues. It is predicted to be a highly specialised mononuclear four-cysteine (C4) zinc finger that plays a role in DNA binding and/or promoting protein-protein interactions in complicated eukaryotic processes including chromatin methylation status and early embryonic development. Weak homology to members of IPR001965 from INTERPRO further evidences these predictions. The domain is found exclusively in vertebrates, vertebrate-infecting parasites and higher plants [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2RR4_A 2E61_A 2L7P_A.
Probab=33.30  E-value=20  Score=22.84  Aligned_cols=13  Identities=38%  Similarity=0.915  Sum_probs=7.7

Q ss_pred             ceeccCCC--ccccc
Q psy11384         20 PVRCTNCA--RCVPK   32 (137)
Q Consensus        20 ~V~C~NCg--rcvPK   32 (137)
                      -|+|++|+  |.||.
T Consensus         3 WVQCd~C~KWR~lp~   17 (50)
T PF07496_consen    3 WVQCDSCLKWRRLPE   17 (50)
T ss_dssp             EEE-TTT--EEEE-C
T ss_pred             EEECCCCCceeeCCh
Confidence            48999999  57773


No 25 
>PF01194 RNA_pol_N:  RNA polymerases N / 8 kDa subunit;  InterPro: IPR000268 In eukaryotes, there are three different forms of DNA-dependent RNA polymerases (2.7.7.6 from EC) transcribing different sets of genes. Each class of RNA polymerase is an assemblage of ten to twelve different polypeptides. In archaebacteria, there is generally a single form of RNA polymerase which also consists of an oligomeric assemblage of 10 to 13 polypeptides. Archaebacterial subunit N (gene rpoN) [] is a small protein of about 8 kDa, it is evolutionary related [] to a 8.3 kDa component shared by all three forms of eukaryotic RNA polymerases (gene RPB10 in yeast and POLR2J in mammals) as well as to African swine fever virus (ASFV) protein CP80R []. There is a conserved region which is located at the N-terminal extremity of these polymerase subunits; this region contains two cysteines that binds a zinc ion [].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_N 3HKZ_N 1EF4_A 3H0G_V 2Y0S_N 2R92_J 3M4O_J 3S2D_J 1R9S_J 1Y1W_J ....
Probab=33.19  E-value=18  Score=24.93  Aligned_cols=13  Identities=38%  Similarity=0.996  Sum_probs=9.6

Q ss_pred             cceeccCCCcccc
Q psy11384         19 NPVRCTNCARCVP   31 (137)
Q Consensus        19 ~~V~C~NCgrcvP   31 (137)
                      -||||-.||+.+-
T Consensus         3 iPVRCFTCGkvi~   15 (60)
T PF01194_consen    3 IPVRCFTCGKVIG   15 (60)
T ss_dssp             -SSS-STTTSBTC
T ss_pred             CceecCCCCCChh
Confidence            3899999999874


No 26 
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=33.14  E-value=14  Score=28.72  Aligned_cols=45  Identities=22%  Similarity=0.310  Sum_probs=25.1

Q ss_pred             ceeeceeecchhhHHhhhHHhhcccc----ccccceeeEeEEEeeeeeeec
Q psy11384         35 AIKKFVIRNIVEAAAVRDITEASYYQ----SYQLPKLYAKLHYCVSCAIHS   81 (137)
Q Consensus        35 AIKrf~irNiVEaaavRDiseAsV~~----~y~lPKlyvKl~YCVSCAIHs   81 (137)
                      +|+++.++--==...-.||++..-++    .-.||-  .-.|||+.||-|.
T Consensus        17 ~i~rtr~~grDlDqi~nDls~~Es~~Klp~Dp~lPG--lGqhYCieCaryf   65 (126)
T COG5112          17 RIKRTRLFGRDLDQIKNDLSTKESQKKLPYDPELPG--LGQHYCIECARYF   65 (126)
T ss_pred             HHHHHHHhcccHHHHHHhcchhhhhccCCCCCCCCC--CceeeeehhHHHH
Confidence            45555444311123456776644443    234554  5679999999774


No 27 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=30.09  E-value=23  Score=21.36  Aligned_cols=12  Identities=33%  Similarity=1.032  Sum_probs=9.0

Q ss_pred             ccceeccCCCcc
Q psy11384         18 VNPVRCTNCARC   29 (137)
Q Consensus        18 v~~V~C~NCgrc   29 (137)
                      ..+|+|.+||--
T Consensus        15 ~~~irC~~CG~R   26 (32)
T PF03604_consen   15 GDPIRCPECGHR   26 (32)
T ss_dssp             SSTSSBSSSS-S
T ss_pred             CCcEECCcCCCe
Confidence            457999999953


No 28 
>COG5134 Uncharacterized conserved protein [Function unknown]
Probab=29.99  E-value=28  Score=30.06  Aligned_cols=46  Identities=33%  Similarity=0.627  Sum_probs=28.8

Q ss_pred             cceeccCCCcccccccceeeceeecchhhHHhhhHHhhccccccccceeeEeEEEeeeee
Q psy11384         19 NPVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDITEASYYQSYQLPKLYAKLHYCVSCA   78 (137)
Q Consensus        19 ~~V~C~NCgrcvPKDKAIKrf~irNiVEaaavRDiseAsV~~~y~lPKlyvKl~YCVSCA   78 (137)
                      -+|+|-||+-.+||.+-   |        .++++|...--|.+   -|.|.=.--|.-|+
T Consensus        41 F~~RCL~C~~YI~K~~r---f--------NavkE~~~dK~y~~---~kiYRf~I~C~~C~   86 (272)
T COG5134          41 FPVRCLNCENYIQKGTR---F--------NAVKEEIGDKSYYT---TKIYRFSIKCHLCS   86 (272)
T ss_pred             cceeecchhhhhhcccc---h--------hHHHHHhcccccce---eEEEEEEEEccCCC
Confidence            36999999999999863   3        25677666433333   34554444455553


No 29 
>PRK12286 rpmF 50S ribosomal protein L32; Reviewed
Probab=29.13  E-value=37  Score=22.68  Aligned_cols=29  Identities=24%  Similarity=0.508  Sum_probs=16.6

Q ss_pred             CccccCCCCCCCCCCC-----ccceeccCCCccc
Q psy11384          2 TCKRRNGGRSKHGRGH-----VNPVRCTNCARCV   30 (137)
Q Consensus         2 ~kKRrNnGR~KkgrGh-----v~~V~C~NCgrcv   30 (137)
                      ||+|-+..|..+=|.|     ...+.|.+||-..
T Consensus         4 PKrk~S~srr~~RRsh~~l~~~~l~~C~~CG~~~   37 (57)
T PRK12286          4 PKRKTSKSRKRKRRAHFKLKAPGLVECPNCGEPK   37 (57)
T ss_pred             CcCcCChhhcchhcccccccCCcceECCCCCCcc
Confidence            4555554444444444     4556799998643


No 30 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=27.73  E-value=32  Score=23.72  Aligned_cols=26  Identities=38%  Similarity=0.883  Sum_probs=17.9

Q ss_pred             ccceeccCCCc-ccccccceeeceeecc
Q psy11384         18 VNPVRCTNCAR-CVPKDKAIKKFVIRNI   44 (137)
Q Consensus        18 v~~V~C~NCgr-cvPKDKAIKrf~irNi   44 (137)
                      +.+..|++||+ +.|.++|.+ |.=-|=
T Consensus         5 ~~~~~CtSCg~~i~~~~~~~~-F~CPnC   31 (59)
T PRK14890          5 MEPPKCTSCGIEIAPREKAVK-FLCPNC   31 (59)
T ss_pred             ccCccccCCCCcccCCCccCE-eeCCCC
Confidence            34557999998 566888876 655443


No 31 
>PF10589 NADH_4Fe-4S:  NADH-ubiquinone oxidoreductase-F iron-sulfur binding region;  InterPro: IPR019575  NADH:ubiquinone oxidoreductase (complex I) (1.6.5.3 from EC) is a respiratory-chain enzyme that catalyses the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane (NADH + ubiquinone = NAD+ + ubiquinol) []. Complex I is a major source of reactive oxygen species (ROS) that are predominantly formed by electron transfer from FMNH(2). Complex I is found in bacteria, cyanobacteria (as a NADH-plastoquinone oxidoreductase), archaea [], mitochondira, and in the hydrogenosome, a mitochondria-derived organelle. In general, the bacterial complex consists of 14 different subunits, while the mitochondrial complex contains homologues to these subunits in addition to approximately 31 additional proteins []. Mitochondrial complex I, which is located in the inner mitochondrial membrane, is the largest multimeric respiratory enzyme in the mitochondria, consisting of more than 40 subunits, one FMN co-factor and eight FeS clusters []. The assembly of mitochondrial complex I is an intricate process that requires the cooperation of the nuclear and mitochondrial genomes [, ]. Mitochondrial complex I can cycle between active and deactive forms that can be distinguished by the reactivity towards divalent cations and thiol-reactive agents. All redox prosthetic groups reside in the peripheral arm of the L-shaped structure. The NADH oxidation domain harbouring the FMN cofactor is connected via a chain of iron-sulphur clusters to the ubiquinone reduction site that is located in a large pocket formed by the PSST and 49kDa subunits of complex I []. This entry describes the F subunit of complexes that resemble NADH-quinone oxidoreductases. The electron acceptor is a quinone, ubiquinone, in mitochondria and most bacteria, including Escherichia coli, where the recommended gene symbol is nuoF. This family does not have any members in chloroplast or cyanobacteria, where the quinone may be plastoquinone and NADH may be replaced by NADPH, nor in Methanosarcina, where NADH is replaced by F420H2.  This entry represents the iron-sulphur binding domain of the F subunit.; GO: 0055114 oxidation-reduction process; PDB: 3IAS_S 2FUG_A 3I9V_A 3M9S_1 3IAM_A 2YBB_1.
Probab=27.50  E-value=20  Score=22.67  Aligned_cols=9  Identities=33%  Similarity=1.176  Sum_probs=3.8

Q ss_pred             cCCCccccc
Q psy11384         24 TNCARCVPK   32 (137)
Q Consensus        24 ~NCgrcvPK   32 (137)
                      .+||+|+|-
T Consensus        14 ESCGkC~PC   22 (46)
T PF10589_consen   14 ESCGKCTPC   22 (46)
T ss_dssp             H--S--HHH
T ss_pred             cCCCCCCCc
Confidence            579999994


No 32 
>KOG3408|consensus
Probab=27.12  E-value=19  Score=28.33  Aligned_cols=18  Identities=33%  Similarity=0.650  Sum_probs=13.6

Q ss_pred             cccceeeEeEEEeeeeeeec
Q psy11384         62 YQLPKLYAKLHYCVSCAIHS   81 (137)
Q Consensus        62 y~lPKlyvKl~YCVSCAIHs   81 (137)
                      +-||-  .-++||+-||-|.
T Consensus        50 ~dlPG--~GqfyCi~CaRyF   67 (129)
T KOG3408|consen   50 PDLPG--GGQFYCIECARYF   67 (129)
T ss_pred             CCCCC--Cceeehhhhhhhh
Confidence            45665  5689999999764


No 33 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=26.51  E-value=38  Score=23.58  Aligned_cols=34  Identities=35%  Similarity=0.588  Sum_probs=24.8

Q ss_pred             ccceeccCCCccc-ccccceeeceeecchhhHHhhh
Q psy11384         18 VNPVRCTNCARCV-PKDKAIKKFVIRNIVEAAAVRD   52 (137)
Q Consensus        18 v~~V~C~NCgrcv-PKDKAIKrf~irNiVEaaavRD   52 (137)
                      ..+-.|++||+-+ |..+|++ |.=-|==|....|.
T Consensus         7 ~~~~~CtSCg~~i~p~e~~v~-F~CPnCGe~~I~Rc   41 (61)
T COG2888           7 KDPPVCTSCGREIAPGETAVK-FPCPNCGEVEIYRC   41 (61)
T ss_pred             cCCceeccCCCEeccCCceeE-eeCCCCCceeeehh
Confidence            3466899999999 8888877 87777665554444


No 34 
>KOG3198|consensus
Probab=26.22  E-value=22  Score=28.56  Aligned_cols=31  Identities=23%  Similarity=0.462  Sum_probs=19.3

Q ss_pred             CcccccccceeeceeecchhhHHhhhHHhhccc
Q psy11384         27 ARCVPKDKAIKKFVIRNIVEAAAVRDITEASYY   59 (137)
Q Consensus        27 grcvPKDKAIKrf~irNiVEaaavRDiseAsV~   59 (137)
                      ||++||||||..=.-.+|-|  ++++|.=.+.+
T Consensus        32 GRripke~aVeNP~a~eI~D--vl~~lgl~~~~   62 (152)
T KOG3198|consen   32 GRRIPKEKAVENPLAKEIAD--VLRALGLNCLL   62 (152)
T ss_pred             ccccCHHHhhcCcchhHHHH--HHHHhCCcccc
Confidence            69999999987655555533  24444433333


No 35 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=25.42  E-value=32  Score=19.06  Aligned_cols=12  Identities=33%  Similarity=0.827  Sum_probs=9.3

Q ss_pred             eccCCCcccccc
Q psy11384         22 RCTNCARCVPKD   33 (137)
Q Consensus        22 ~C~NCgrcvPKD   33 (137)
                      .|.+||.-++.|
T Consensus         1 ~Cp~CG~~~~~~   12 (23)
T PF13240_consen    1 YCPNCGAEIEDD   12 (23)
T ss_pred             CCcccCCCCCCc
Confidence            388999888765


No 36 
>PF12230 PRP21_like_P:  Pre-mRNA splicing factor PRP21 like protein;  InterPro: IPR022030  This domain family is found in eukaryotes, and is typically between 212 and 238 amino acids in length. The family is found in association with PF01805 from PFAM. There are two completely conserved residues (W and H) that may be functionally important. PRP21 is required for assembly of the prespliceosome and it interacts with U2 snRNP and/or pre-mRNA in the prespliceosome. This family also contains proteins similar to PRP21, such as the mammalian SF3a. SF3a also interacts with U2 snRNP from the prespliceosome, converting it to its active form. ; PDB: 4DGW_B.
Probab=24.68  E-value=25  Score=28.18  Aligned_cols=31  Identities=10%  Similarity=0.245  Sum_probs=0.0

Q ss_pred             CCccceeccCCCcccccccceeeceeecchhh
Q psy11384         16 GHVNPVRCTNCARCVPKDKAIKKFVIRNIVEA   47 (137)
Q Consensus        16 Ghv~~V~C~NCgrcvPKDKAIKrf~irNiVEa   47 (137)
                      ..+..+.|..||..||-|+-=. -.--+++|+
T Consensus       164 ~~~~~~~cPitGe~IP~~e~~e-HmRi~LlDP  194 (229)
T PF12230_consen  164 PKEKMIICPITGEMIPADEMDE-HMRIELLDP  194 (229)
T ss_dssp             --------------------------------
T ss_pred             cccccccccccccccccccccc-ccccccccc
Confidence            4567899999999999998654 233344444


No 37 
>PF14832 Tautomerase_3:  Putative oxalocrotonate tautomerase enzyme; PDB: 3C6V_C 3N4D_I 3N4G_C 3N4H_A 2FLZ_C 3MF8_A 3MF7_A 2FLT_A.
Probab=23.20  E-value=60  Score=24.91  Aligned_cols=25  Identities=32%  Similarity=0.620  Sum_probs=18.3

Q ss_pred             HHhhhHHhhccccccccceeeEeEEEe
Q psy11384         48 AAVRDITEASYYQSYQLPKLYAKLHYC   74 (137)
Q Consensus        48 aavRDiseAsV~~~y~lPKlyvKl~YC   74 (137)
                      +++++|.+  +|.++-||.+||-..+.
T Consensus        20 ~LA~~IT~--~y~~~glP~FyV~V~F~   44 (136)
T PF14832_consen   20 ALAEAITD--IYTSIGLPAFYVNVRFI   44 (136)
T ss_dssp             HHHHHHHH--HHHHTTTTGGG-EEEEE
T ss_pred             HHHHHHHH--HHhCCCCCCEEEEEEEE
Confidence            46666666  67777899999988775


No 38 
>PF10262 Rdx:  Rdx family;  InterPro: IPR011893 This entry represents the Rdx family of selenoproteins, which includes mammalian selenoproteins SelW, SelV, SelT and SelH, bacterial SelW-like proteins and cysteine-containing proteins of unknown function in all three domains of life. Mammalian Rdx12 and its fish selenoprotein orthologues are also members of this family []. These proteins possess a thioredoxin-like fold and a conserved CXXC or CxxU (U is selenocysteine) motif near the N terminus, suggesting a redox function. Rdx proteins can use catalytic cysteine (or selenocysteine) to form transient mixed disulphides with substrate proteins. Selenium (Se) plays an essential role in cell survival and most of the effects of Se are probably mediated by selenoproteins.   Selenoprotein W (SelW) plays an important role in protection of neurons from oxidative stress during neuronal development [], [].   Selenoprotein T (SelT) is conserved from plants to humans. SelT is localized to the endoplasmic reticulum through a hydrophobic domain. The protein binds to UDP-glucose:glycoprotein glucosyltransferase (UGTR), the endoplasmic reticulum (ER)-resident protein, which is known to be involved in the quality control of protein folding [, ]. The function of SelT is unknown, although it may have a role in PACAP signaling during PC12 cell differentiation [, ].  Selenoprotein H (SelH) protects neurons against UVB-induced damage by inhibiting apoptotic cell death pathways, by preventing mitochondrial depolarization, and by promoting cell survival pathways [].; GO: 0008430 selenium binding, 0045454 cell redox homeostasis; PDB: 2OJL_B 2FA8_A 2P0G_C 2NPB_A 3DEX_C 2OKA_A 2OBK_G.
Probab=22.44  E-value=40  Score=22.64  Aligned_cols=19  Identities=21%  Similarity=0.677  Sum_probs=14.2

Q ss_pred             EeEEEeeeeeeecCccccc
Q psy11384         69 AKLHYCVSCAIHSKVVRNR   87 (137)
Q Consensus        69 vKl~YCVSCAIHskVVRvR   87 (137)
                      |...||.+|-.|.+.....
T Consensus         3 V~IeYC~~C~~~~~a~~l~   21 (76)
T PF10262_consen    3 VTIEYCTSCGYRPRALELA   21 (76)
T ss_dssp             EEEEEETTTTCHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHHH
Confidence            6789999998877655433


No 39 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=22.39  E-value=54  Score=19.72  Aligned_cols=14  Identities=29%  Similarity=0.712  Sum_probs=10.6

Q ss_pred             CCccceeccCCCcc
Q psy11384         16 GHVNPVRCTNCARC   29 (137)
Q Consensus        16 Ghv~~V~C~NCgrc   29 (137)
                      +....++|++||..
T Consensus        21 ~~g~~v~C~~C~~~   34 (36)
T PF13717_consen   21 PKGRKVRCSKCGHV   34 (36)
T ss_pred             CCCcEEECCCCCCE
Confidence            45568999999864


No 40 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=22.34  E-value=39  Score=18.86  Aligned_cols=14  Identities=36%  Similarity=0.624  Sum_probs=10.6

Q ss_pred             ceeccCCCcccccc
Q psy11384         20 PVRCTNCARCVPKD   33 (137)
Q Consensus        20 ~V~C~NCgrcvPKD   33 (137)
                      .+.|.+|||-..-|
T Consensus         2 l~~C~~CgR~F~~~   15 (25)
T PF13913_consen    2 LVPCPICGRKFNPD   15 (25)
T ss_pred             CCcCCCCCCEECHH
Confidence            57899999976443


No 41 
>TIGR02174 CXXU_selWTH selT/selW/selH selenoprotein domain. This model represents a domain found in both bacteria and animals, including animal proteins SelT, SelW, and SelH, all of which are selenoproteins. In a CXXC motif near the N-terminus of the domain, selenocysteine may replace the second Cys. Proteins with this domain may include an insert of about 70 amino acids. This model is broader than the current SelW model pfam05169 in Pfam.
Probab=21.67  E-value=38  Score=22.84  Aligned_cols=13  Identities=31%  Similarity=0.897  Sum_probs=9.5

Q ss_pred             EeEEEeeeeeeec
Q psy11384         69 AKLHYCVSCAIHS   81 (137)
Q Consensus        69 vKl~YCVSCAIHs   81 (137)
                      |...||.+|-...
T Consensus         1 V~IeyC~~C~y~~   13 (72)
T TIGR02174         1 VEIEYCGSCGYKP   13 (72)
T ss_pred             CEEEECCCCCChH
Confidence            4578999997443


No 42 
>KOG3497|consensus
Probab=21.59  E-value=40  Score=23.91  Aligned_cols=13  Identities=31%  Similarity=0.989  Sum_probs=10.5

Q ss_pred             cceeccCCCcccc
Q psy11384         19 NPVRCTNCARCVP   31 (137)
Q Consensus        19 ~~V~C~NCgrcvP   31 (137)
                      -||||-.||..+-
T Consensus         3 iPiRCFtCGKvig   15 (69)
T KOG3497|consen    3 IPIRCFTCGKVIG   15 (69)
T ss_pred             eeeEeeecccccc
Confidence            4899999998653


No 43 
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=21.47  E-value=43  Score=20.39  Aligned_cols=11  Identities=45%  Similarity=1.177  Sum_probs=5.3

Q ss_pred             ceeccCCCccc
Q psy11384         20 PVRCTNCARCV   30 (137)
Q Consensus        20 ~V~C~NCgrcv   30 (137)
                      +++|.+|+..+
T Consensus         2 p~rC~~C~ayl   12 (40)
T PF04810_consen    2 PVRCRRCRAYL   12 (40)
T ss_dssp             S-B-TTT--BS
T ss_pred             ccccCCCCCEE
Confidence            78899998654


No 44 
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=21.03  E-value=66  Score=20.79  Aligned_cols=19  Identities=26%  Similarity=0.494  Sum_probs=13.4

Q ss_pred             CCCccceeccCCCcccccc
Q psy11384         15 RGHVNPVRCTNCARCVPKD   33 (137)
Q Consensus        15 rGhv~~V~C~NCgrcvPKD   33 (137)
                      ....+...|.+||..+.+|
T Consensus        41 ~~~~r~~~C~~Cg~~~~rD   59 (69)
T PF07282_consen   41 RRSGRVFTCPNCGFEMDRD   59 (69)
T ss_pred             ccccceEEcCCCCCEECcH
Confidence            3455667788888877776


No 45 
>PRK00754 signal recognition particle protein Srp19; Provisional
Probab=20.85  E-value=28  Score=25.44  Aligned_cols=20  Identities=25%  Similarity=0.461  Sum_probs=13.7

Q ss_pred             Ccccccccceeeceeecchh
Q psy11384         27 ARCVPKDKAIKKFVIRNIVE   46 (137)
Q Consensus        27 grcvPKDKAIKrf~irNiVE   46 (137)
                      ||.|||+.|+..=.+..|.|
T Consensus        23 GRrv~k~~aV~~P~~~EI~~   42 (95)
T PRK00754         23 GRIISRKLAVKEPRLEEIIE   42 (95)
T ss_pred             cCccCHHHhccCCCHHHHHH
Confidence            69999999977544443333


No 46 
>PF10238 Eapp_C:  E2F-associated phosphoprotein;  InterPro: IPR019370 This entry represents E2F binding proteins. E2F transcription factors play an essential role in cell proliferation and apoptosis and their activity is frequently deregulated in human cancers. E2F activity is regulated by a variety of mechanisms, frequently mediated by proteins binding to individual members or a subgroup of the family. E2F-associated phosphoprotein (EAPP)interacts with a subset of E2F factors and influences E2F-dependent promoter activity. EAPP is present throughout the cell cycle but disappears during mitosis []. 
Probab=20.81  E-value=74  Score=24.75  Aligned_cols=12  Identities=42%  Similarity=1.154  Sum_probs=9.7

Q ss_pred             cceeccCCCccc
Q psy11384         19 NPVRCTNCARCV   30 (137)
Q Consensus        19 ~~V~C~NCgrcv   30 (137)
                      .||.|+.|+--|
T Consensus       108 hPV~Cs~C~TeV  119 (136)
T PF10238_consen  108 HPVKCSECSTEV  119 (136)
T ss_pred             eceecccCCCEE
Confidence            489999998654


No 47 
>KOG3286|consensus
Probab=20.33  E-value=63  Score=27.50  Aligned_cols=13  Identities=31%  Similarity=0.981  Sum_probs=10.7

Q ss_pred             EeEEEeeeeeeec
Q psy11384         69 AKLHYCVSCAIHS   81 (137)
Q Consensus        69 vKl~YCVSCAIHs   81 (137)
                      ++..|||||-.-.
T Consensus        72 l~i~fCvSCgYk~   84 (226)
T KOG3286|consen   72 LEINFCVSCGYKQ   84 (226)
T ss_pred             EEEEEEEecCcHH
Confidence            7889999997643


Done!