Query         psy11389
Match_columns 73
No_of_seqs    114 out of 474
Neff          5.4 
Searched_HMMs 46136
Date          Fri Aug 16 17:09:57 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy11389.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/11389hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF00075 RNase_H:  RNase H;  In  98.9 4.9E-10 1.1E-14   70.4   1.2   30    6-36    100-130 (132)
  2 PRK08719 ribonuclease H; Revie  98.9 7.6E-10 1.6E-14   74.0   1.9   30    7-37    116-145 (147)
  3 PRK00203 rnhA ribonuclease H;   98.8 1.1E-09 2.3E-14   72.5   0.8   31    7-38    111-141 (150)
  4 PRK06548 ribonuclease H; Provi  98.7 6.4E-09 1.4E-13   71.0   1.1   28    8-36    112-139 (161)
  5 COG0328 RnhA Ribonuclease HI [  98.4 1.6E-07 3.4E-12   64.2   1.7   28   10-38    117-144 (154)
  6 cd06222 RnaseH RNase H (RNase   98.4 2.8E-07   6E-12   54.8   2.5   29    7-36    101-129 (130)
  7 KOG3752|consensus               98.0   3E-06 6.6E-11   64.6   2.7   29    7-36    334-362 (371)
  8 PRK13907 rnhA ribonuclease H;   93.9   0.026 5.5E-07   35.7   0.9   23    9-36    102-124 (128)
  9 PF13456 RVT_3:  Reverse transc  93.1    0.04 8.7E-07   31.6   0.8   25    7-36     60-84  (87)
 10 PRK07708 hypothetical protein;  92.4   0.072 1.6E-06   37.8   1.5   24   10-38    184-207 (219)
 11 PRK07238 bifunctional RNase H/  87.5    0.26 5.7E-06   36.5   1.0   23    9-36    107-129 (372)
 12 COG0296 GlgB 1,4-alpha-glucan   50.1      11 0.00025   30.9   1.9   26    4-30    223-248 (628)
 13 COG0820 Predicted Fe-S-cluster  47.8      13 0.00027   28.6   1.7   37    3-40    248-284 (349)
 14 COG2988 Succinylglutamate desu  32.1      14 0.00031   28.2  -0.2   23   48-70     92-114 (324)
 15 KOG4095|consensus               28.3      73  0.0016   22.2   2.8   27   47-73     15-42  (165)
 16 PF10580 Neuromodulin_N:  Gap j  23.4      72  0.0016   16.5   1.6   21   15-36      4-24  (32)
 17 PF04714 BCL_N:  BCL7, N-termin  22.9 1.3E+02  0.0028   17.3   2.8   27   46-72     13-40  (52)
 18 COG4744 Uncharacterized conser  22.6      51  0.0011   21.9   1.2   13   11-28    107-119 (121)
 19 COG5575 ORC2 Origin recognitio  21.4      74  0.0016   25.6   2.0   26    2-32    503-528 (535)

No 1  
>PF00075 RNase_H:  RNase H;  InterPro: IPR002156 The RNase H domain is responsible for hydrolysis of the RNA portion of RNA x DNA hybrids, and this activity requires the presence of divalent cations (Mg2+ or Mn2+) that bind its active site. This domain is a part of a large family of homologous RNase H enzymes of which the RNase HI protein from Escherichia coli is the best characterised []. Secondary structure predictions for the enzymes from E. coli, yeast, human liver and diverse retroviruses (such as Rous sarcoma virus and the Foamy viruses) supported, in every case, the five beta-strands (1 to 5) and four or five alpha-helices (A, B/C, D, E) that have been identified by crystallography in the RNase H domain of Human immunodeficiency virus 1 (HIV-1) reverse transcriptase and in E. coli RNase H []. Reverse transcriptase (RT) is a modular enzyme carrying polymerase and ribonuclease H (RNase H) activities in separable domains. Reverse transcriptase (RT) converts the single-stranded RNA genome of a retrovirus into a double-stranded DNA copy for integration into the host genome. This process requires ribonuclease H as well as RNA- and DNA-directed DNA polymerase activities. Retroviral RNase H is synthesised as part of the POL polyprotein that contains; an aspartyl protease, a reverse transcriptase, RNase H and integrase. POL polyprotein undergoes specific enzymatic cleavage to yield the mature proteins. Bacterial RNase H 3.1.26.4 from EC catalyses endonucleolytic cleavage to 5'-phosphomonoester acting on RNA-DNA hybrids.  The 3D structure of the RNase H domain from diverse bacteria and retroviruses has been solved [, , ]. All have four beta strands and four to five alpha helices. The E. coli RNase H1 protein binds a single Mg2+ ion cofactor in the active site of the enzyme. The divalent cation is bound by the carboxyl groups of four acidic residues, Asp-10, Glu-48, Asp-70, and Asp-134 []. The first three acidic residues are highly conserved in all bacterial and retroviral RNase H sequences. ; GO: 0003676 nucleic acid binding, 0004523 ribonuclease H activity; PDB: 3LP3_B 2KW4_A 3P1G_A 1RIL_A 2RPI_A 4EQJ_G 4EP2_B 3OTY_P 3U3G_D 2ZQB_D ....
Probab=98.89  E-value=4.9e-10  Score=70.40  Aligned_cols=30  Identities=30%  Similarity=0.512  Sum_probs=27.0

Q ss_pred             ecCceeEEEEeeCCCCCC-ccchHHHHHhcCC
Q psy11389          6 DKNSYLRYLSNPICHCGI-KGNEIVDVAARNP   36 (73)
Q Consensus         6 ~~~~~v~~~Wip~~H~gi-~gNE~AD~~Ak~a   36 (73)
                      ..+..|.|.||| ||+|+ .|||.||+|||.|
T Consensus       100 ~~~~~v~~~~V~-~H~~~~~~N~~aD~lAk~a  130 (132)
T PF00075_consen  100 SRGIKVRFRWVP-GHSGVPQGNERADRLAKEA  130 (132)
T ss_dssp             HHSSEEEEEESS-SSSSSHHHHHHHHHHHHHH
T ss_pred             ccceEEeeeecc-CcCCCchhHHHHHHHHHHh
Confidence            457889999999 99999 6999999999865


No 2  
>PRK08719 ribonuclease H; Reviewed
Probab=98.88  E-value=7.6e-10  Score=73.97  Aligned_cols=30  Identities=30%  Similarity=0.505  Sum_probs=27.2

Q ss_pred             cCceeEEEEeeCCCCCCccchHHHHHhcCCC
Q psy11389          7 KNSYLRYLSNPICHCGIKGNEIVDVAARNPT   37 (73)
Q Consensus         7 ~~~~v~~~Wip~~H~gi~gNE~AD~~Ak~a~   37 (73)
                      ....|+|.||| ||+|++|||.||+||++|.
T Consensus       116 ~~~~i~~~~Vk-gH~g~~~Ne~aD~lA~~a~  145 (147)
T PRK08719        116 ARKYVEVEKVT-AHSGIEGNEAADMLAQAAA  145 (147)
T ss_pred             CCCcEEEEEec-CCCCChhHHHHHHHHHHHh
Confidence            35679999999 9999999999999999874


No 3  
>PRK00203 rnhA ribonuclease H; Reviewed
Probab=98.81  E-value=1.1e-09  Score=72.46  Aligned_cols=31  Identities=26%  Similarity=0.260  Sum_probs=27.7

Q ss_pred             cCceeEEEEeeCCCCCCccchHHHHHhcCCCC
Q psy11389          7 KNSYLRYLSNPICHCGIKGNEIVDVAARNPTN   38 (73)
Q Consensus         7 ~~~~v~~~Wip~~H~gi~gNE~AD~~Ak~a~~   38 (73)
                      ....|.|.||| ||+|++|||.||+|||+|..
T Consensus       111 ~~~~v~~~wV~-~H~~~~~N~~AD~lA~~a~~  141 (150)
T PRK00203        111 KRHQIKWHWVK-GHAGHPENERCDELARAGAE  141 (150)
T ss_pred             ccCceEEEEec-CCCCCHHHHHHHHHHHHHHH
Confidence            34689999999 99999999999999998843


No 4  
>PRK06548 ribonuclease H; Provisional
Probab=98.67  E-value=6.4e-09  Score=70.95  Aligned_cols=28  Identities=32%  Similarity=0.284  Sum_probs=26.3

Q ss_pred             CceeEEEEeeCCCCCCccchHHHHHhcCC
Q psy11389          8 NSYLRYLSNPICHCGIKGNEIVDVAARNP   36 (73)
Q Consensus         8 ~~~v~~~Wip~~H~gi~gNE~AD~~Ak~a   36 (73)
                      ...|+|.||| ||+|++|||.||+||+++
T Consensus       112 ~~~v~~~wVk-gHsg~~gNe~aD~LA~~a  139 (161)
T PRK06548        112 NRNIRMSWVN-AHTGHPLNEAADSLARQA  139 (161)
T ss_pred             cCceEEEEEe-cCCCCHHHHHHHHHHHHH
Confidence            4579999999 999999999999999998


No 5  
>COG0328 RnhA Ribonuclease HI [DNA replication, recombination, and repair]
Probab=98.37  E-value=1.6e-07  Score=64.18  Aligned_cols=28  Identities=25%  Similarity=0.211  Sum_probs=26.1

Q ss_pred             eeEEEEeeCCCCCCccchHHHHHhcCCCC
Q psy11389         10 YLRYLSNPICHCGIKGNEIVDVAARNPTN   38 (73)
Q Consensus        10 ~v~~~Wip~~H~gi~gNE~AD~~Ak~a~~   38 (73)
                      .|.+.||| ||+|.++||.||+||+.+..
T Consensus       117 ~v~~~WVk-gH~g~~~NeraD~LA~~~~~  144 (154)
T COG0328         117 LVFWEWVK-GHAGHPENERADQLAREAAR  144 (154)
T ss_pred             eEEEEEee-CCCCChHHHHHHHHHHHHHH
Confidence            89999999 99999999999999998843


No 6  
>cd06222 RnaseH RNase H (RNase HI) is an endonuclease that cleaves the RNA strand of an RNA/DNA hybrid in a not sequence-specific manner. One of the important functions of RNase H is to remove Okazaki fragments during DNA replication.  RNase H knockout mice lack mitochondrial DNA replication and die as embryos. The retroviral reverse transcriptase contains an RNase H domain that plays an important role in converting a single stranded retroviral genomic RNA into a dsDNA for integration into host chromosomes. RNase H inhibitors have been explored as an anti-HIV drug target because RNase H inactivation inhibits reverse transcription.
Probab=98.37  E-value=2.8e-07  Score=54.83  Aligned_cols=29  Identities=34%  Similarity=0.526  Sum_probs=26.6

Q ss_pred             cCceeEEEEeeCCCCCCccchHHHHHhcCC
Q psy11389          7 KNSYLRYLSNPICHCGIKGNEIVDVAARNP   36 (73)
Q Consensus         7 ~~~~v~~~Wip~~H~gi~gNE~AD~~Ak~a   36 (73)
                      ....+.|.||| +|+|+++|+.||.+||.+
T Consensus       101 ~~~~~~i~~v~-~h~~~~~n~~ad~la~~~  129 (130)
T cd06222         101 RFHKVRFEWVP-GHSGIEGNERADALAKEA  129 (130)
T ss_pred             CCCeEEEEEcC-CCCCCcchHHHHHHHHhh
Confidence            46789999999 999999999999999875


No 7  
>KOG3752|consensus
Probab=98.04  E-value=3e-06  Score=64.65  Aligned_cols=29  Identities=34%  Similarity=0.393  Sum_probs=27.2

Q ss_pred             cCceeEEEEeeCCCCCCccchHHHHHhcCC
Q psy11389          7 KNSYLRYLSNPICHCGIKGNEIVDVAARNP   36 (73)
Q Consensus         7 ~~~~v~~~Wip~~H~gi~gNE~AD~~Ak~a   36 (73)
                      +++.|++.||| ||.||.|||+||.||++.
T Consensus       334 ~~~~vq~~~V~-Gh~gi~gne~Ad~lARkg  362 (371)
T KOG3752|consen  334 SNKKVQQEYVG-GHSGILGNEMADALARKG  362 (371)
T ss_pred             ccCceEEEEec-CcCCcchHHHHHHHHhhh
Confidence            46899999999 999999999999999987


No 8  
>PRK13907 rnhA ribonuclease H; Provisional
Probab=93.92  E-value=0.026  Score=35.71  Aligned_cols=23  Identities=22%  Similarity=0.222  Sum_probs=19.2

Q ss_pred             ceeEEEEeeCCCCCCccchHHHHHhcCC
Q psy11389          9 SYLRYLSNPICHCGIKGNEIVDVAARNP   36 (73)
Q Consensus         9 ~~v~~~Wip~~H~gi~gNE~AD~~Ak~a   36 (73)
                      ..+.|.||| .    ++|+.||.+|+.|
T Consensus       102 ~~~~~~~v~-r----~~N~~Ad~LA~~a  124 (128)
T PRK13907        102 DLFFIKWIP-S----SQNKVADELARKA  124 (128)
T ss_pred             CceEEEEcC-c----hhchhHHHHHHHH
Confidence            356679999 5    6999999999876


No 9  
>PF13456 RVT_3:  Reverse transcriptase-like; PDB: 3ALY_A 2EHG_A 3HST_B.
Probab=93.15  E-value=0.04  Score=31.62  Aligned_cols=25  Identities=16%  Similarity=0.133  Sum_probs=19.4

Q ss_pred             cCceeEEEEeeCCCCCCccchHHHHHhcCC
Q psy11389          7 KNSYLRYLSNPICHCGIKGNEIVDVAARNP   36 (73)
Q Consensus         7 ~~~~v~~~Wip~~H~gi~gNE~AD~~Ak~a   36 (73)
                      .-..+.|.|||     =++|..||.+||.|
T Consensus        60 ~~~~~~~~~i~-----r~~N~~A~~LA~~a   84 (87)
T PF13456_consen   60 RFWNVSVSHIP-----REQNKVADALAKFA   84 (87)
T ss_dssp             CCSCEEEEE-------GGGSHHHHHHHHHH
T ss_pred             cccceEEEEEC-----hHHhHHHHHHHHHH
Confidence            34678999999     78999999999864


No 10 
>PRK07708 hypothetical protein; Validated
Probab=92.41  E-value=0.072  Score=37.82  Aligned_cols=24  Identities=21%  Similarity=0.055  Sum_probs=20.4

Q ss_pred             eeEEEEeeCCCCCCccchHHHHHhcCCCC
Q psy11389         10 YLRYLSNPICHCGIKGNEIVDVAARNPTN   38 (73)
Q Consensus        10 ~v~~~Wip~~H~gi~gNE~AD~~Ak~a~~   38 (73)
                      .+.|.|||     -..|+.||+||+.|..
T Consensus       184 ~~~~~~Vp-----R~~N~~AD~LAk~Al~  207 (219)
T PRK07708        184 TPVYEPIS-----RKQNKEADQLATQALE  207 (219)
T ss_pred             eEEEEECC-----chhhhHHHHHHHHHHh
Confidence            47788999     5789999999999944


No 11 
>PRK07238 bifunctional RNase H/acid phosphatase; Provisional
Probab=87.52  E-value=0.26  Score=36.49  Aligned_cols=23  Identities=22%  Similarity=0.171  Sum_probs=20.5

Q ss_pred             ceeEEEEeeCCCCCCccchHHHHHhcCC
Q psy11389          9 SYLRYLSNPICHCGIKGNEIVDVAARNP   36 (73)
Q Consensus         9 ~~v~~~Wip~~H~gi~gNE~AD~~Ak~a   36 (73)
                      ..+.|.||| .    .+|+.||.||+.|
T Consensus       107 ~~~~i~~v~-r----~~N~~AD~LA~~a  129 (372)
T PRK07238        107 GRVTYTWIP-R----ARNAHADRLANEA  129 (372)
T ss_pred             CceEEEECC-c----hhhhHHHHHHHHH
Confidence            578999999 4    7899999999987


No 12 
>COG0296 GlgB 1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism]
Probab=50.14  E-value=11  Score=30.93  Aligned_cols=26  Identities=15%  Similarity=0.001  Sum_probs=22.5

Q ss_pred             EeecCceeEEEEeeCCCCCCccchHHH
Q psy11389          4 ILDKNSYLRYLSNPICHCGIKGNEIVD   30 (73)
Q Consensus         4 ~~~~~~~v~~~Wip~~H~gi~gNE~AD   30 (73)
                      .|+.|+.|-+=||| +|.+..||=.+-
T Consensus       223 aH~~GIgViLD~V~-~HF~~d~~~L~~  248 (628)
T COG0296         223 AHQAGIGVILDWVP-NHFPPDGNYLAR  248 (628)
T ss_pred             HHHcCCEEEEEecC-CcCCCCcchhhh
Confidence            36789999999999 999999987664


No 13 
>COG0820 Predicted Fe-S-cluster redox enzyme [General function prediction only]
Probab=47.83  E-value=13  Score=28.65  Aligned_cols=37  Identities=8%  Similarity=-0.094  Sum_probs=31.8

Q ss_pred             eEeecCceeEEEEeeCCCCCCccchHHHHHhcCCCCCC
Q psy11389          3 YILDKNSYLRYLSNPICHCGIKGNEIVDVAARNPTNAT   40 (73)
Q Consensus         3 ~~~~~~~~v~~~Wip~~H~gi~gNE~AD~~Ak~a~~~~   40 (73)
                      |..+++.+|+|.++=+.+.+.. -|.|++||+...+.+
T Consensus       248 Y~~~t~~rVt~EY~Ll~~VND~-~e~A~~L~~ll~~~~  284 (349)
T COG0820         248 YPEKSGRRVTFEYVLLDGVNDS-LEHAKELAKLLKGIP  284 (349)
T ss_pred             hhhccCceEEEEeeecccccCC-HHHHHHHHHHhcCCC
Confidence            7778899999999998888887 999999999885443


No 14 
>COG2988 Succinylglutamate desuccinylase [Amino acid transport and metabolism]
Probab=32.07  E-value=14  Score=28.22  Aligned_cols=23  Identities=9%  Similarity=0.109  Sum_probs=17.4

Q ss_pred             HhHHHHHHHHHHHHHHhhcccCC
Q psy11389         48 EDFKPFVASLMNSEWQSQWDNVP   70 (73)
Q Consensus        48 ~d~k~~ik~~~~~~Wq~~W~~~~   70 (73)
                      ..=+|+|.+-++...--+|++.+
T Consensus        92 ~~gkRYieqDlNR~F~gr~q~~~  114 (324)
T COG2988          92 AAGKRYIEQDLNRMFGGRPQSFS  114 (324)
T ss_pred             HhchHHHhhhHHHHhCCCcccCC
Confidence            34578888888888877777666


No 15 
>KOG4095|consensus
Probab=28.34  E-value=73  Score=22.20  Aligned_cols=27  Identities=26%  Similarity=0.668  Sum_probs=19.6

Q ss_pred             HHhHHHHHHHHHH-HHHHhhcccCCCCC
Q psy11389         47 PEDFKPFVASLMN-SEWQSQWDNVPNTN   73 (73)
Q Consensus        47 ~~d~k~~ik~~~~-~~Wq~~W~~~~~tn   73 (73)
                      -.|+|+.+..+-+ ..|++.|-.+.+|+
T Consensus        15 KDDIKkVMaaiEKVRrWEKKwVtvgDTs   42 (165)
T KOG4095|consen   15 KDDIKKVMAAIEKVRRWEKKWVTVGDTS   42 (165)
T ss_pred             HHHHHHHHHHHHHHHHHhhheEeecccc
Confidence            3567776654433 58999999999885


No 16 
>PF10580 Neuromodulin_N:  Gap junction protein N-terminal region;  InterPro: IPR018947 Neuromodulin is a component of the motile growth cones. It is membrane protein whose expression is widely correlated with successful axon elongation []. It is a crucial component of an effective regeneration response in the nervous system []. Although its function is uncertain, the N-terminal region is well conserved and contains both a calmodulin binding domain, and sites for acylation, membrane attachment and protein kinase C phosphorylation. Structure predictions suggest that the C-terminal region may exist as an extended, negatively-charged rod with some similarity to the side arms of neurofilaments, indicating that the biological role of neuromodulin may depend on its ability to form a dynamic membrane-cytoplasm-calmodulin complex []. This entry represents the neuromodulin N-terminal domain.
Probab=23.43  E-value=72  Score=16.53  Aligned_cols=21  Identities=14%  Similarity=0.001  Sum_probs=15.2

Q ss_pred             EeeCCCCCCccchHHHHHhcCC
Q psy11389         15 SNPICHCGIKGNEIVDVAARNP   36 (73)
Q Consensus        15 Wip~~H~gi~gNE~AD~~Ak~a   36 (73)
                      .+. .+..++-||.||+-..+-
T Consensus         4 c~r-~tk~VEKNeeadQkieqD   24 (32)
T PF10580_consen    4 CIR-RTKPVEKNEEADQKIEQD   24 (32)
T ss_pred             eee-ccccccccchhhhhhhhc
Confidence            344 666789999999866544


No 17 
>PF04714 BCL_N:  BCL7, N-terminal conserver region;  InterPro: IPR006804 The members of this group of sequences contain a conserved N-terminal domain which is found in the BCL7 family. The function of BCL7 proteins is unknown, though they may be involved in early development. Notably, BCL7B is commonly hemizygously deleted in patients with Williams syndrome [].
Probab=22.94  E-value=1.3e+02  Score=17.26  Aligned_cols=27  Identities=30%  Similarity=0.684  Sum_probs=19.5

Q ss_pred             CHHhHHHHHHHHHH-HHHHhhcccCCCC
Q psy11389         46 TPEDFKPFVASLMN-SEWQSQWDNVPNT   72 (73)
Q Consensus        46 t~~d~k~~ik~~~~-~~Wq~~W~~~~~t   72 (73)
                      +-.|+|+.+...-+ ..|+..|-.+.+|
T Consensus        13 ~KddiKrv~~~iekVr~wEKKWVtv~dt   40 (52)
T PF04714_consen   13 AKDDIKRVMASIEKVRKWEKKWVTVGDT   40 (52)
T ss_pred             hhHHHHHHHHHHHHHHHHhhceEEeccc
Confidence            45678887665432 6899999988776


No 18 
>COG4744 Uncharacterized conserved protein [Function unknown]
Probab=22.58  E-value=51  Score=21.93  Aligned_cols=13  Identities=38%  Similarity=0.434  Sum_probs=9.6

Q ss_pred             eEEEEeeCCCCCCccchH
Q psy11389         11 LRYLSNPICHCGIKGNEI   28 (73)
Q Consensus        11 v~~~Wip~~H~gi~gNE~   28 (73)
                      =+++||| |    +|||.
T Consensus       107 gr~I~Vp-~----~~~~~  119 (121)
T COG4744         107 GRVIYVP-E----EGNEA  119 (121)
T ss_pred             CeEEEec-C----CCCcC
Confidence            3689999 7    67763


No 19 
>COG5575 ORC2 Origin recognition complex, subunit 2 [DNA replication, recombination, and repair]
Probab=21.37  E-value=74  Score=25.65  Aligned_cols=26  Identities=19%  Similarity=0.176  Sum_probs=20.1

Q ss_pred             eeEeecCceeEEEEeeCCCCCCccchHHHHH
Q psy11389          2 VYILDKNSYLRYLSNPICHCGIKGNEIVDVA   32 (73)
Q Consensus         2 ~~~~~~~~~v~~~Wip~~H~gi~gNE~AD~~   32 (73)
                      +=|...+..+.++|||     -+.||.+..|
T Consensus       503 ~~i~rn~S~~eI~wvp-----y~~nele~lL  528 (535)
T COG5575         503 LKIKRNGSEIEICWVP-----YERNELEGLL  528 (535)
T ss_pred             hheeccCCccEEEEee-----ccHHHHHHHH
Confidence            3455678899999999     7888877655


Done!