Query         psy11391
Match_columns 112
No_of_seqs    105 out of 193
Neff          5.2 
Searched_HMMs 46136
Date          Fri Aug 16 17:13:20 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy11391.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/11391hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF08292 RNA_pol_Rbc25:  RNA po 100.0   1E-39 2.3E-44  233.8   6.7   99    2-107    21-121 (122)
  2 KOG3297|consensus              100.0 4.8E-36   1E-40  228.2   8.5  100    2-108    99-199 (202)
  3 PTZ00162 DNA-directed RNA poly  99.6 3.2E-16   7E-21  118.0   6.3   73    2-105    99-171 (176)
  4 cd04462 S1_RNAPII_Rpb7 S1_RNAP  99.5 3.6E-14 7.7E-19   96.1   6.4   66    2-103    19-88  (88)
  5 TIGR00448 rpoE DNA-directed RN  99.5 5.7E-14 1.2E-18  105.0   7.1   78    2-108    99-176 (179)
  6 PRK08563 DNA-directed RNA poly  99.4 5.1E-13 1.1E-17   99.9   5.8   78    1-107    98-175 (187)
  7 COG1095 RPB7 DNA-directed RNA   99.1 7.5E-11 1.6E-15   90.0   5.8   78    2-108    99-176 (183)
  8 KOG3298|consensus               96.0   0.026 5.6E-07   42.9   6.2   71    4-105    95-170 (170)
  9 cd04460 S1_RpoE S1_RpoE: RpoE,  92.6    0.19 4.2E-06   33.6   3.7   72    8-108    22-94  (99)
 10 TIGR02866 CoxB cytochrome c ox  84.8     1.3 2.8E-05   33.6   3.6   32   28-59     98-135 (201)
 11 PF02918 Pertussis_S2S3:  Pertu  83.5     1.1 2.4E-05   31.9   2.5   41   41-96     64-104 (109)
 12 TIGR01433 CyoA cytochrome o ub  79.7     2.4 5.2E-05   33.1   3.4   32   28-59    122-157 (226)
 13 PRK09750 hypothetical protein;  79.4       2 4.3E-05   27.8   2.4   21   86-110     3-23  (64)
 14 TIGR01432 QOXA cytochrome aa3   77.8     2.6 5.7E-05   32.4   3.1   32   28-59    113-148 (217)
 15 MTH00051 COX2 cytochrome c oxi  77.5     3.5 7.6E-05   32.3   3.8   18   41-58    144-161 (234)
 16 PF00116 COX2:  Cytochrome C ox  77.1     2.1 4.6E-05   30.1   2.3   18   41-58     46-63  (120)
 17 MTH00047 COX2 cytochrome c oxi  76.2     3.1 6.7E-05   31.9   3.1   32   28-59     89-134 (194)
 18 MTH00154 COX2 cytochrome c oxi  75.4     4.2   9E-05   31.7   3.7   19   41-59    140-158 (227)
 19 MTH00038 COX2 cytochrome c oxi  73.7     4.8  0.0001   31.4   3.7   19   41-59    140-158 (229)
 20 MTH00140 COX2 cytochrome c oxi  73.6     4.6 9.9E-05   31.4   3.5   18   41-58    140-157 (228)
 21 PRK10525 cytochrome o ubiquino  71.5       5 0.00011   33.1   3.4   33   28-60    134-170 (315)
 22 MTH00139 COX2 cytochrome c oxi  71.0       6 0.00013   30.7   3.6   19   41-59    140-158 (226)
 23 MTH00117 COX2 cytochrome c oxi  70.6     5.6 0.00012   31.0   3.4   19   41-59    140-158 (227)
 24 MTH00185 COX2 cytochrome c oxi  70.3     6.2 0.00014   30.9   3.6   19   41-59    140-158 (230)
 25 MTH00076 COX2 cytochrome c oxi  70.1     6.2 0.00013   30.8   3.6   19   41-59    140-158 (228)
 26 MTH00129 COX2 cytochrome c oxi  69.8       6 0.00013   30.9   3.4   19   41-59    140-158 (230)
 27 MTH00168 COX2 cytochrome c oxi  68.9     6.1 0.00013   30.7   3.3   19   41-59    140-158 (225)
 28 MTH00023 COX2 cytochrome c oxi  68.6     6.5 0.00014   30.9   3.4   19   41-59    151-169 (240)
 29 MTH00008 COX2 cytochrome c oxi  67.7     5.1 0.00011   31.3   2.6   17   41-57    140-156 (228)
 30 PF06688 DUF1187:  Protein of u  61.9     8.4 0.00018   24.8   2.3   20   87-110     1-20  (61)
 31 MTH00080 COX2 cytochrome c oxi  61.5     9.7 0.00021   29.9   3.2   19   41-59    143-161 (231)
 32 MTH00098 COX2 cytochrome c oxi  59.1     7.8 0.00017   30.3   2.2   19   41-59    140-158 (227)
 33 cd04454 S1_Rrp4_like S1_Rrp4_l  53.1      24 0.00053   22.3   3.5   16   44-59     50-65  (82)
 34 MTH00027 COX2 cytochrome c oxi  53.0      16 0.00034   29.3   3.1   19   41-59    174-192 (262)
 35 cd05791 S1_CSL4 S1_CSL4: CSL4,  49.2      27 0.00059   23.3   3.4   34   43-105    59-92  (92)
 36 COG1622 CyoA Heme/copper-type   44.8      30 0.00066   27.5   3.5   31   28-58    120-154 (247)
 37 cd05688 S1_RPS1_repeat_ec3 S1_  44.3      30 0.00066   20.3   2.8   16   44-59     44-59  (68)
 38 PRK15266 subtilase cytotoxin s  43.2      18 0.00039   26.7   1.8   49   40-104    86-134 (135)
 39 PRK15265 subtilase cytotoxin s  43.1      14 0.00031   27.2   1.3   23   41-63     83-105 (134)
 40 cd00164 S1_like S1_like: Ribos  42.5      31 0.00066   19.5   2.5   17   43-59     40-56  (65)
 41 smart00316 S1 Ribosomal protei  41.5      34 0.00075   19.7   2.7   17   43-59     45-61  (72)
 42 cd04471 S1_RNase_R S1_RNase_R:  41.1      52  0.0011   20.2   3.6   43   11-59     29-72  (83)
 43 PRK04163 exosome complex RNA-b  37.2      57  0.0012   25.4   3.9   18   42-59    109-126 (235)
 44 PF00975 Thioesterase:  Thioest  36.5      12 0.00027   27.1   0.2   13   85-97     66-78  (229)
 45 cd05789 S1_Rrp4 S1_Rrp4: Rrp4   34.2      59  0.0013   20.5   3.1   16   44-59     54-69  (86)
 46 cd05691 S1_RPS1_repeat_ec6 S1_  33.8      47   0.001   19.9   2.5   17   44-60     44-60  (73)
 47 cd05708 S1_Rrp5_repeat_sc12 S1  32.5      57  0.0012   19.7   2.7   17   43-59     46-62  (77)
 48 cd04452 S1_IF2_alpha S1_IF2_al  31.9      58  0.0013   19.8   2.7   16   44-59     49-64  (76)
 49 cd05705 S1_Rrp5_repeat_hs14 S1  29.6      59  0.0013   20.5   2.5   17   43-59     49-65  (74)
 50 PRK09521 exosome complex RNA-b  29.5 1.1E+02  0.0024   22.7   4.3   16   44-59    118-133 (189)
 51 PF14326 DUF4384:  Domain of un  29.4      45 0.00098   21.5   1.9   14   45-58      3-16  (83)
 52 PF00575 S1:  S1 RNA binding do  28.8      58  0.0012   19.8   2.3   18   42-59     46-63  (74)
 53 cd05687 S1_RPS1_repeat_ec1_hs1  28.5      64  0.0014   19.4   2.4   16   44-59     44-59  (70)
 54 KOG3400|consensus               28.3 1.3E+02  0.0029   22.4   4.4   57    6-66      5-71  (143)
 55 COG3319 Thioesterase domains o  27.8      37  0.0008   27.1   1.5   16   82-97     62-77  (257)
 56 cd05692 S1_RPS1_repeat_hs4 S1_  27.8      63  0.0014   18.7   2.3   16   44-59     44-59  (69)
 57 PF08206 OB_RNB:  Ribonuclease   27.7     9.1  0.0002   23.5  -1.6   14    5-18     17-30  (58)
 58 cd05698 S1_Rrp5_repeat_hs6_sc5  27.3      61  0.0013   19.5   2.2   16   44-59     44-59  (70)
 59 cd05697 S1_Rrp5_repeat_hs5 S1_  26.5      74  0.0016   19.2   2.5   17   43-59     43-59  (69)
 60 cd05686 S1_pNO40 S1_pNO40: pNO  25.1      83  0.0018   19.4   2.6   17   43-59     47-63  (73)
 61 cd05706 S1_Rrp5_repeat_sc10 S1  24.5      83  0.0018   19.1   2.4   16   44-59     47-62  (73)
 62 cd04472 S1_PNPase S1_PNPase: P  24.2      81  0.0018   18.4   2.3   16   44-59     44-59  (68)
 63 PF01835 A2M_N:  MG2 domain;  I  23.8      63  0.0014   20.9   1.9   18   42-59      8-25  (99)
 64 PRK15458 tagatose 6-phosphate   23.7      35 0.00077   29.5   0.8   23   82-110    78-100 (426)
 65 TIGR03834 EAGR_box EAGR box. T  23.1      59  0.0013   17.9   1.3   11   22-33      8-18  (28)
 66 cd05685 S1_Tex S1_Tex: The C-t  22.9      92   0.002   18.0   2.3   17   43-59     43-59  (68)
 67 cd05690 S1_RPS1_repeat_ec5 S1_  22.7 1.1E+02  0.0024   18.1   2.8   17   43-59     44-60  (69)
 68 PRK15267 subtilase cytotoxin s  22.3      53  0.0011   24.4   1.3   24   40-63     88-111 (141)
 69 cd05707 S1_Rrp5_repeat_sc11 S1  22.2      97  0.0021   18.6   2.4   17   43-59     43-59  (68)
 70 TIGR02810 agaZ_gatZ D-tagatose  22.0      43 0.00093   29.0   0.9   23   82-110    74-96  (420)
 71 KOG3409|consensus               21.9 1.7E+02  0.0037   22.8   4.1   13   45-57    123-135 (193)
 72 PF12306 PixA:  Inclusion body   21.6 1.3E+02  0.0028   22.4   3.3   18   41-58     58-75  (172)
 73 cd05704 S1_Rrp5_repeat_hs13 S1  21.3      86  0.0019   19.5   2.0   16   44-59     48-63  (72)
 74 cd04461 S1_Rrp5_repeat_hs8_sc7  21.0      96  0.0021   19.5   2.3   17   43-59     57-73  (83)

No 1  
>PF08292 RNA_pol_Rbc25:  RNA polymerase III subunit Rpc25;  InterPro: IPR013238 Rpc25 is a strongly conserved subunit of RNA polymerase III and has homology to Rpa43 in RNA polymerase I, Rpb7 in RNA polymerase II and the archaeal RpoE subunit. Rpc25 is required for transcription initiation and is not essential for the elongating properties of RNA polymerase III [].; PDB: 2CKZ_D 3AYH_B.
Probab=100.00  E-value=1e-39  Score=233.83  Aligned_cols=99  Identities=45%  Similarity=0.882  Sum_probs=66.7

Q ss_pred             eeecCcceeeeCCCCCCCCCCCCcccceEEEeccCCCCceeeeeCCCCeEEEEEceEEeeecCCCCCCCcCC--CCCCCC
Q psy11391          2 VTLGFFEDILIPPEGLQQPSRFDEKEQVWVWEFDNEGDKHDLFMDPGDKIKFRVTSELFTETSPISCPDIHD--GAPGSE   79 (112)
Q Consensus         2 vslgFFdDI~IP~~~L~~ps~fd~~e~~W~W~~~~ed~~~~l~~d~ge~IRFRV~~~~F~d~~P~~p~~~e~--~~~~~~   79 (112)
                      ||||||||||||+++||+||.||+++|+|+|+|+   ++++||||.|++|||||++++|+|+.|..+..+++  .....+
T Consensus        21 vslgFFddI~IP~~~L~~ps~fd~~~~~W~W~~~---~~~~l~~d~ge~IRFRV~~~~f~d~~p~~~~~~~~~~~~~~~~   97 (122)
T PF08292_consen   21 VSLGFFDDIFIPPSLLPEPSRFDEEEQAWVWEYD---EEQELFFDIGEEIRFRVESEIFPDVPPTPPPSAEASGEEEEEE   97 (122)
T ss_dssp             EEECCEEEEEEECCCC-TTEEEECCCTEEEEEES---SSEEEEE-TT-EEEEEEEEEEE---------------------
T ss_pred             EEecccccEEECHHHCCCCCccCccCCEEEEECC---CCceeEccCCCEEEEEEeEEEEecCCCCCcccccccccccccc
Confidence            8999999999999999999999999999999995   25899999999999999999999999998763321  112234


Q ss_pred             CCCCCCCeEEEeccceeeeCCCCceeee
Q psy11391         80 VDTPKIPYSYGYYSLAVLRTQLLSPVRF  107 (112)
Q Consensus        80 ~~~~~~Py~I~~~~~gs~~~~GLGpv~W  107 (112)
                      ..++++||+|+    |||+++||||++|
T Consensus        98 ~~~~~~Py~I~----gs~~~~GLG~~sW  121 (122)
T PF08292_consen   98 EDEPKPPYQII----GSINEDGLGLVSW  121 (122)
T ss_dssp             ------SEEEE----EEB-STT-EEGGG
T ss_pred             cccCCCCeEEE----EEecCCCCccccc
Confidence            67889999999    9999999999999


No 2  
>KOG3297|consensus
Probab=100.00  E-value=4.8e-36  Score=228.16  Aligned_cols=100  Identities=39%  Similarity=0.748  Sum_probs=88.1

Q ss_pred             eeecCcceeeeCCCCCCCCCCCCcccceEEEeccCCCC-ceeeeeCCCCeEEEEEceEEeeecCCCCCCCcCCCCCCCCC
Q psy11391          2 VTLGFFEDILIPPEGLQQPSRFDEKEQVWVWEFDNEGD-KHDLFMDPGDKIKFRVTSELFTETSPISCPDIHDGAPGSEV   80 (112)
Q Consensus         2 vslgFFdDI~IP~~~L~~ps~fd~~e~~W~W~~~~ed~-~~~l~~d~ge~IRFRV~~~~F~d~~P~~p~~~e~~~~~~~~   80 (112)
                      ||||||||||||+++||+||+|++++|+|+|+|+.||+ +++||||.|+.|||||+++.|.|++|.+...+. +  .++.
T Consensus        99 vtl~FFdDI~IP~~~L~~p~~f~~~e~vWVWey~~Edg~~~~Ly~D~~e~IRFRV~~e~f~d~~p~~~~~~~-t--~~e~  175 (202)
T KOG3297|consen   99 VTLGFFDDIFIPKEMLPEPCVFEPDEQVWVWEYEQEDGPGTKLYFDVGEEIRFRVEDESFVDVSPEGNSTAI-T--GAED  175 (202)
T ss_pred             EEEEeeeceeechhhCCCCcccccccEEEEEEecccCCCCceeEecCCCeEEEEEeeecccccCcccccccc-c--cccc
Confidence            78999999999999999999999999999999998877 589999999999999999999999998732221 1  1235


Q ss_pred             CCCCCCeEEEeccceeeeCCCCceeeee
Q psy11391         81 DTPKIPYSYGYYSLAVLRTQLLSPVRFQ  108 (112)
Q Consensus        81 ~~~~~Py~I~~~~~gs~~~~GLGpv~W~  108 (112)
                      .++.+||+|+    |||+++||||++|=
T Consensus       176 ~e~~~py~l~----gs~~~~GLG~lsWW  199 (202)
T KOG3297|consen  176 PEKESPYTLL----GSMNEDGLGPLSWW  199 (202)
T ss_pred             cccCCCeEEE----EEecCCCCccchhh
Confidence            5678899999    99999999999993


No 3  
>PTZ00162 DNA-directed RNA polymerase II subunit 7; Provisional
Probab=99.64  E-value=3.2e-16  Score=117.95  Aligned_cols=73  Identities=10%  Similarity=0.239  Sum_probs=64.5

Q ss_pred             eeecCcceeeeCCCCCCCCCCCCcccceEEEeccCCCCceeeeeCCCCeEEEEEceEEeeecCCCCCCCcCCCCCCCCCC
Q psy11391          2 VTLGFFEDILIPPEGLQQPSRFDEKEQVWVWEFDNEGDKHDLFMDPGDKIKFRVTSELFTETSPISCPDIHDGAPGSEVD   81 (112)
Q Consensus         2 vslgFFdDI~IP~~~L~~ps~fd~~e~~W~W~~~~ed~~~~l~~d~ge~IRFRV~~~~F~d~~P~~p~~~e~~~~~~~~~   81 (112)
                      |++|||| ||||.++||+++.||++++.|+|..+    +++++++.|+.|||||.++.|...                  
T Consensus        99 v~~Gp~~-ifI~~~~l~~~~~fd~~~~~~~~~~~----~~~~~i~~g~~VR~rV~~v~~~~~------------------  155 (176)
T PTZ00162         99 AQAGPLK-AFVSRSAIPPDFVYDSDSAYPCYISS----DGQIQIKPNTEVRLRLQGVRYDAS------------------  155 (176)
T ss_pred             EEeeCeE-EEEcHHHCCCccEECCCCCcceEecC----CCcEEECCCCEEEEEEEEEEecCC------------------
Confidence            7899999 99999999999999999999999932    247999999999999999996542                  


Q ss_pred             CCCCCeEEEeccceeeeCCCCcee
Q psy11391         82 TPKIPYSYGYYSLAVLRTQLLSPV  105 (112)
Q Consensus        82 ~~~~Py~I~~~~~gs~~~~GLGpv  105 (112)
                          -..++    |+|++++||++
T Consensus       156 ----~~~~i----~T~~~~~LG~~  171 (176)
T PTZ00162        156 ----NLFAI----ATINSDYLGPI  171 (176)
T ss_pred             ----CcEEE----EEecCCCcCcc
Confidence                04778    99999999997


No 4  
>cd04462 S1_RNAPII_Rpb7 S1_RNAPII_Rpb7: Eukaryotic RNA polymerase II (RNAPII) Rpb7 subunit C-terminal S1 domain. RNAPII is composed of 12 subunits (Rpb1-12). Rpb4 and Rpb7 form a heterodimer that associate with the RNAPII core. Rpb7 is a homolog of the Rpc25 of RNA polymerase III, RpoE of the archaeal RNA polymerase, and Rpa43 of eukaryotic RNA polymerase I. Rpb7 has two domains, an N-terminal ribonucleoprotein (RNP) domain and a C-terminal S1 domain, both of which bind single-stranded RNA. It is possible that the S1 domain interacts with the nascent RNA transcript, assisted by the RNP domain. In yeast, Rpb4/Rpb7 is necessary for promoter-directed transcription initiation. They also play a role in regulating transcription-coupled repair in the Rad26-dependent pathway, in efficient mRNA export, and in transcription termination.
Probab=99.51  E-value=3.6e-14  Score=96.14  Aligned_cols=66  Identities=12%  Similarity=0.279  Sum_probs=55.3

Q ss_pred             eeec----CcceeeeCCCCCCCCCCCCcccceEEEeccCCCCceeeeeCCCCeEEEEEceEEeeecCCCCCCCcCCCCCC
Q psy11391          2 VTLG----FFEDILIPPEGLQQPSRFDEKEQVWVWEFDNEGDKHDLFMDPGDKIKFRVTSELFTETSPISCPDIHDGAPG   77 (112)
Q Consensus         2 vslg----FFdDI~IP~~~L~~ps~fd~~e~~W~W~~~~ed~~~~l~~d~ge~IRFRV~~~~F~d~~P~~p~~~e~~~~~   77 (112)
                      |++|    ||++++||++++++|     +++.|+|..+     ++++++.|+.|||||.+++|. ..             
T Consensus        19 v~~Gpl~~f~~~~~ip~~~~~~~-----~~~~~~~~~~-----~~~~i~~g~~VR~rV~~v~~~-~~-------------   74 (88)
T cd04462          19 AEVGPLSIFISRHLIPSDMEFDP-----NASPPCFTSN-----EDIVIKKDTEVRLKIIGTRVD-AT-------------   74 (88)
T ss_pred             EEEcCceEEEEeeecCccceECC-----cCCCCeEeCC-----CcEEECCCCEEEEEEEEEEEc-cC-------------
Confidence            6888    999999999999877     6688999732     479999999999999999973 20             


Q ss_pred             CCCCCCCCCeEEEeccceeeeCCCCc
Q psy11391         78 SEVDTPKIPYSYGYYSLAVLRTQLLS  103 (112)
Q Consensus        78 ~~~~~~~~Py~I~~~~~gs~~~~GLG  103 (112)
                              -+..+    |+|++++||
T Consensus        75 --------~~~~i----gt~~~~~LG   88 (88)
T cd04462          75 --------DIFAI----GTIKDDYLG   88 (88)
T ss_pred             --------ceEEE----EEccCCCCC
Confidence                    15667    999999998


No 5  
>TIGR00448 rpoE DNA-directed RNA polymerase (rpoE), archaeal and eukaryotic form. This family seems to be confined to the archea and eukaryotic taxa and are quite dissimilar to E.coli rpoE.
Probab=99.50  E-value=5.7e-14  Score=104.97  Aligned_cols=78  Identities=22%  Similarity=0.367  Sum_probs=68.3

Q ss_pred             eeecCcceeeeCCCCCCCCCCCCcccceEEEeccCCCCceeeeeCCCCeEEEEEceEEeeecCCCCCCCcCCCCCCCCCC
Q psy11391          2 VTLGFFEDILIPPEGLQQPSRFDEKEQVWVWEFDNEGDKHDLFMDPGDKIKFRVTSELFTETSPISCPDIHDGAPGSEVD   81 (112)
Q Consensus         2 vslgFFdDI~IP~~~L~~ps~fd~~e~~W~W~~~~ed~~~~l~~d~ge~IRFRV~~~~F~d~~P~~p~~~e~~~~~~~~~   81 (112)
                      |+||||+++++|.+++++++.||++++.|+|.-      .+.+|+.|+.|||||.++.|.+..|                
T Consensus        99 V~lg~~~gi~~~~~l~~~~~~~d~~~~~~~~~~------~~~~~~~Gd~VrvrV~~v~~~~~~~----------------  156 (179)
T TIGR00448        99 VSLGPFDGLFHVSQVTDDYCYYDPKESALIGKE------TKKVLDEGDKVRARIVALSLKDRRP----------------  156 (179)
T ss_pred             EEeCCceEEEEcHHhCCCceEEccccceEEEcc------CCeEEcCCCEEEEEEEEEEccCCCC----------------
Confidence            688999999999999999999999999999952      3689999999999999999876532                


Q ss_pred             CCCCCeEEEeccceeeeCCCCceeeee
Q psy11391         82 TPKIPYSYGYYSLAVLRTQLLSPVRFQ  108 (112)
Q Consensus        82 ~~~~Py~I~~~~~gs~~~~GLGpv~W~  108 (112)
                         ..-+|.    +||+++|||++.|-
T Consensus       157 ---~~~~I~----lt~k~~~LG~~~w~  176 (179)
T TIGR00448       157 ---EGSKIG----LTMRQPLLGKLEWI  176 (179)
T ss_pred             ---CcceEE----EEeccCcCCccccc
Confidence               124578    99999999999995


No 6  
>PRK08563 DNA-directed RNA polymerase subunit E'; Provisional
Probab=99.39  E-value=5.1e-13  Score=99.92  Aligned_cols=78  Identities=17%  Similarity=0.260  Sum_probs=67.6

Q ss_pred             CeeecCcceeeeCCCCCCCCCCCCcccceEEEeccCCCCceeeeeCCCCeEEEEEceEEeeecCCCCCCCcCCCCCCCCC
Q psy11391          1 MVTLGFFEDILIPPEGLQQPSRFDEKEQVWVWEFDNEGDKHDLFMDPGDKIKFRVTSELFTETSPISCPDIHDGAPGSEV   80 (112)
Q Consensus         1 ~vslgFFdDI~IP~~~L~~ps~fd~~e~~W~W~~~~ed~~~~l~~d~ge~IRFRV~~~~F~d~~P~~p~~~e~~~~~~~~   80 (112)
                      .|+||||+.++.+.+++++++.||+++++|+|+-      ...+++.|+.|||||.++.+.+..|.              
T Consensus        98 ~V~lg~~~g~v~~~~l~~~~~~~d~~~~~~~~~~------~~~~i~~Gd~VrvrV~~v~~~~~~~~--------------  157 (187)
T PRK08563         98 FVRIGPVDGLLHISQIMDDYISYDPKNGRLIGKE------SKRVLKVGDVVRARIVAVSLKERRPR--------------  157 (187)
T ss_pred             EEEEeCceEEEEcHHcCCCceEEccccceEEEcc------CCeEEcCCCEEEEEEEEEEcccCCCC--------------
Confidence            3789999999999999999999999999999983      36899999999999999997654321              


Q ss_pred             CCCCCCeEEEeccceeeeCCCCceeee
Q psy11391         81 DTPKIPYSYGYYSLAVLRTQLLSPVRF  107 (112)
Q Consensus        81 ~~~~~Py~I~~~~~gs~~~~GLGpv~W  107 (112)
                           ..+|.    +||+++|||+++|
T Consensus       158 -----~~~I~----ls~~~~~LG~~~w  175 (187)
T PRK08563        158 -----GSKIG----LTMRQPGLGKLEW  175 (187)
T ss_pred             -----CCEEE----EEecCCCCCcHHH
Confidence                 14888    9999999999998


No 7  
>COG1095 RPB7 DNA-directed RNA polymerase, subunit E' [Transcription]
Probab=99.14  E-value=7.5e-11  Score=90.00  Aligned_cols=78  Identities=19%  Similarity=0.230  Sum_probs=68.2

Q ss_pred             eeecCcceeeeCCCCCCCCCCCCcccceEEEeccCCCCceeeeeCCCCeEEEEEceEEeeecCCCCCCCcCCCCCCCCCC
Q psy11391          2 VTLGFFEDILIPPEGLQQPSRFDEKEQVWVWEFDNEGDKHDLFMDPGDKIKFRVTSELFTETSPISCPDIHDGAPGSEVD   81 (112)
Q Consensus         2 vslgFFdDI~IP~~~L~~ps~fd~~e~~W~W~~~~ed~~~~l~~d~ge~IRFRV~~~~F~d~~P~~p~~~e~~~~~~~~~   81 (112)
                      |++| +.|++||.+.+++. .++.+++.|.|..+    +++++++.|+.|||||+++.+....|.               
T Consensus        99 V~ig-p~dglvh~sqi~dd-~~~~d~~~~~~~g~----~tk~~i~~gd~VR~RIv~~s~~~~~~~---------------  157 (183)
T COG1095          99 VRIG-PLDGLVHVSQIMDD-YIDYDEKNKVLIGE----ETKRVLKVGDKVRARIVGVSLKSRRPR---------------  157 (183)
T ss_pred             EEec-cccccccHhhccCc-ccccCcccceeeec----ccceEEecCCEEEEEEEEEecccCccc---------------
Confidence            6777 78899999999999 99999999999997    378999999999999999998877651               


Q ss_pred             CCCCCeEEEeccceeeeCCCCceeeee
Q psy11391         82 TPKIPYSYGYYSLAVLRTQLLSPVRFQ  108 (112)
Q Consensus        82 ~~~~Py~I~~~~~gs~~~~GLGpv~W~  108 (112)
                          -=.|.    ++|+++|||.+.|-
T Consensus       158 ----~~~I~----lTmrq~~LGklew~  176 (183)
T COG1095         158 ----ESKIG----LTMRQPGLGKLEWI  176 (183)
T ss_pred             ----cceEE----EEeccccCCcchhh
Confidence                13577    99999999999994


No 8  
>KOG3298|consensus
Probab=95.97  E-value=0.026  Score=42.93  Aligned_cols=71  Identities=18%  Similarity=0.341  Sum_probs=52.3

Q ss_pred             ecCcce-----eeeCCCCCCCCCCCCcccceEEEeccCCCCceeeeeCCCCeEEEEEceEEeeecCCCCCCCcCCCCCCC
Q psy11391          4 LGFFED-----ILIPPEGLQQPSRFDEKEQVWVWEFDNEGDKHDLFMDPGDKIKFRVTSELFTETSPISCPDIHDGAPGS   78 (112)
Q Consensus         4 lgFFdD-----I~IP~~~L~~ps~fd~~e~~W~W~~~~ed~~~~l~~d~ge~IRFRV~~~~F~d~~P~~p~~~e~~~~~~   78 (112)
                      +|||=+     +|+-.|+.|+--.||+.++-=  .|..+|+ +  -+..|.+|||+|...+|...               
T Consensus        95 ~G~F~~~GPl~~f~sshl~ppd~~f~p~~n~P--~f~~~d~-s--~I~~~~~VR~kiigtr~~~~---------------  154 (170)
T KOG3298|consen   95 MGVFARSGPLEVFYSSHLKPPDYEFDPGENPP--NFQTEDE-S--VIQKGVEVRLKIIGTRVDET---------------  154 (170)
T ss_pred             eeEEEeccceEeeeecccCCCCcccCCCCCCC--ccccccc-c--eeeeCcEEEEEEEEEEEeee---------------
Confidence            466654     588999999999999987741  1332222 2  68899999999999996433               


Q ss_pred             CCCCCCCCeEEEeccceeeeCCCCcee
Q psy11391         79 EVDTPKIPYSYGYYSLAVLRTQLLSPV  105 (112)
Q Consensus        79 ~~~~~~~Py~I~~~~~gs~~~~GLGpv  105 (112)
                             ++--+    ||+.++=|||+
T Consensus       155 -------~i~al----gtl~~D~LG~i  170 (170)
T KOG3298|consen  155 -------EIFAL----GTLKGDYLGPI  170 (170)
T ss_pred             -------eEEEE----EEecCcccccC
Confidence                   34444    99999999985


No 9  
>cd04460 S1_RpoE S1_RpoE: RpoE, S1-like RNA-binding domain. S1-like RNA-binding domains are found in a wide variety of RNA-associated proteins. RpoE is subunit E of archaeal RNA polymerase. Archaeal cells contain a single RNA polymerase made up of 12 subunits, which are homologous to the 12 subunits (RPB1-12) of eukaryotic RNA polymerase II. RpoE is homologous to Rpa43 of eukaryotic RNA polymerase I, RPB7 of eukaryotic RNA polymerase II, and Rpc25 of eukaryotic RNA polymerase III. RpoE is composed of two domains, the N-terminal RNP (ribonucleoprotein) domain and the C-terminal S1 domain. This S1 domain binds ssRNA and ssDNA. This family is classified based on the C-terminal S1 domain. The function of RpoE is not fully understood. In eukaryotes, RPB7 and RPB4 form a heterodimer that reversibly associates with the RNA polymerase II core.
Probab=92.59  E-value=0.19  Score=33.62  Aligned_cols=72  Identities=18%  Similarity=0.242  Sum_probs=43.4

Q ss_pred             ceeeeCCCCCCC-CCCCCcccceEEEeccCCCCceeeeeCCCCeEEEEEceEEeeecCCCCCCCcCCCCCCCCCCCCCCC
Q psy11391          8 EDILIPPEGLQQ-PSRFDEKEQVWVWEFDNEGDKHDLFMDPGDKIKFRVTSELFTETSPISCPDIHDGAPGSEVDTPKIP   86 (112)
Q Consensus         8 dDI~IP~~~L~~-ps~fd~~e~~W~W~~~~ed~~~~l~~d~ge~IRFRV~~~~F~d~~P~~p~~~e~~~~~~~~~~~~~P   86 (112)
                      -+.++|...|.. ...|++....|+=..      ..-.|..|+.|+++|.+..-....|+                 .  
T Consensus        22 v~G~v~~~~l~~~~~~~~~~~~~~~~~~------~~~~~~~Gd~v~vkI~~vd~~~~~~~-----------------~--   76 (99)
T cd04460          22 VDGLLHISQIMDDYISYDPKNKRLIGEE------TKRVLKVGDVVRARIVAVSLKERRPR-----------------E--   76 (99)
T ss_pred             eEEEEEEEEccCCceEechhheeecccC------cCCEECCCCEEEEEEEEEeHHHCcCC-----------------C--
Confidence            455677666643 233455444443222      23567999999999988871111000                 1  


Q ss_pred             eEEEeccceeeeCCCCceeeee
Q psy11391         87 YSYGYYSLAVLRTQLLSPVRFQ  108 (112)
Q Consensus        87 y~I~~~~~gs~~~~GLGpv~W~  108 (112)
                      .+|.    -|+.+.+|||+.|-
T Consensus        77 ~~i~----ls~k~~~~g~~~~~   94 (99)
T cd04460          77 SKIG----LTMRQPGLGKLEWI   94 (99)
T ss_pred             ceEE----EEEecCCCCcHHHh
Confidence            2344    46999999999994


No 10 
>TIGR02866 CoxB cytochrome c oxidase, subunit II. Cytochrome c oxidase is the terminal electron acceptor of mitochondria (and one of several possible acceptors in prokaryotes) in the electron transport chain of aerobic respiration. The enzyme couples the oxidation of reduced cytochrome c with the reduction of molecular oxygen to water. This process results in the pumping of four protons across the membrane which are used in the proton gradient powered synthesis of ATP. The oxidase contains two heme a cofactors and three copper atoms as well as other bound ions.
Probab=84.79  E-value=1.3  Score=33.56  Aligned_cols=32  Identities=28%  Similarity=0.675  Sum_probs=25.4

Q ss_pred             ceEEEeccCCCC------ceeeeeCCCCeEEEEEceEE
Q psy11391         28 QVWVWEFDNEGD------KHDLFMDPGDKIKFRVTSEL   59 (112)
Q Consensus        28 ~~W~W~~~~ed~------~~~l~~d~ge~IRFRV~~~~   59 (112)
                      +.|.|.++..+.      .++|.+-.|++|||++.+..
T Consensus        98 ~qw~W~f~Y~~~~~~~~~~~~l~vp~g~~v~~~~ts~D  135 (201)
T TIGR02866        98 HQWYWSFDYPESRRGFTTVNELVVPAGTPVRLQVTSKD  135 (201)
T ss_pred             EEeEEEEEcCCcCCCccccCEEEEEcCCEEEEEEEeCc
Confidence            469998765443      36899999999999999843


No 11 
>PF02918 Pertussis_S2S3:  Pertussis toxin, subunit 2 and 3, C-terminal domain;  InterPro: IPR020063 A large group of bacterial exotoxins are referred to as "A/B toxins", essentially because they are formed from two subunits []. The "A" subunit possesses enzyme activity, and is transferred to the host cell following a conformational change in the membrane-bound transport "B" subunit [].  Bordetella pertussis is the causative agent of whooping cough, and is a Gram-negative aerobic coccus. Its major virulence factor is the pertussis toxin, an A/B exotoxin that mediates both colonisation and toxaemic stages of the the disease [, ]. Recombinant, inactive forms of the 5 subunits that make up the toxin have proven to be good vaccines. The S2 and S3 subunits of the toxin form part of the "B" moiety. They are responsible for binding the whole toxin to host cells prior to invasion, and are classed as adhesins []. S2 attaches to a host receptor called lactosylceramide. It has also been speculated that the S3 unit may preferentially bind phagocytes. The crystal structure of pertussis toxin has been determined to 2.9A resolution []. The catalytic A-subunit (S1) shares structural similarity with other ADP-ribosylating bacterial toxins, although differences in the C-terminal portion explain its unique activation mechanism. Despite its heterogeneous subunit composition, the structure of the cell-binding B-oligomer (S2, S3, two copies of S4, and S5) resembles the symmetrical B-pentamers of the cholera and shiga toxin families, but it interacts differently with the A-subunit and there is virtually no sequence similarity between B-subunits of the different toxins. Two peripheral domains that are unique to the pertussis toxin B-oligomer share structural similarity with a calcium-dependent eukaryotic lectin, and reveal possible receptor-binding sites.; GO: 0009405 pathogenesis, 0005576 extracellular region; PDB: 1BCP_H 1PRT_H 1PTO_B.
Probab=83.45  E-value=1.1  Score=31.93  Aligned_cols=41  Identities=15%  Similarity=0.154  Sum_probs=27.8

Q ss_pred             eeeeeCCCCeEEEEEceEEeeecCCCCCCCcCCCCCCCCCCCCCCCeEEEecccee
Q psy11391         41 HDLFMDPGDKIKFRVTSELFTETSPISCPDIHDGAPGSEVDTPKIPYSYGYYSLAV   96 (112)
Q Consensus        41 ~~l~~d~ge~IRFRV~~~~F~d~~P~~p~~~e~~~~~~~~~~~~~Py~I~~~~~gs   96 (112)
                      .++|+-.|..||.-|..++|.+..               ....++.|.|+|.|.++
T Consensus        64 ~~~~y~tGl~VRVhV~k~~~~~~~---------------~~~tf~a~aL~gissCn  104 (109)
T PF02918_consen   64 LYYFYSTGLAVRVHVSKDEWYYPA---------------FDATFSAYALTGISSCN  104 (109)
T ss_dssp             HHHHHHCT-EEEEEEEEEEEE--S---------------TT-SS-EEEEEEEEE--
T ss_pred             HHHHHHcCcEEEEEEecccccChh---------------hhcCcchheeeeeeecC
Confidence            478899999999999999999884               22346789999766544


No 12 
>TIGR01433 CyoA cytochrome o ubiquinol oxidase subunit II. This enzyme catalyzes the oxidation of ubiquinol with the concomitant reduction of molecular oxygen to water. This acts as the terminal electron acceptor in the respiratory chain. Subunit II is responsible for binding and oxidation of the ubiquinone substrate. This sequence is closely related to QoxA, which oxidizes quinol in gram positive bacteria but which is in complex with subunits which utilize cytochromes a in the reduction of molecular oxygen. Slightly more distantly related is subunit II of cytochrome c oxidase which uses cyt. c as the oxidant.
Probab=79.70  E-value=2.4  Score=33.12  Aligned_cols=32  Identities=22%  Similarity=0.454  Sum_probs=25.9

Q ss_pred             ceEEEeccCCCC----ceeeeeCCCCeEEEEEceEE
Q psy11391         28 QVWVWEFDNEGD----KHDLFMDPGDKIKFRVTSEL   59 (112)
Q Consensus        28 ~~W~W~~~~ed~----~~~l~~d~ge~IRFRV~~~~   59 (112)
                      +.|.|.|+..+.    .++|.+-.|..|||++.+..
T Consensus       122 ~QW~W~f~Yp~~~~~~~nel~lP~g~pV~~~ltS~D  157 (226)
T TIGR01433       122 LDWKWLFIYPEQGIATVNEIAFPVNTPINFKITSNS  157 (226)
T ss_pred             EeceEEEEcCCCCccccceEEEECCCEEEEEEEECc
Confidence            369998776442    37999999999999999865


No 13 
>PRK09750 hypothetical protein; Provisional
Probab=79.39  E-value=2  Score=27.84  Aligned_cols=21  Identities=14%  Similarity=0.237  Sum_probs=19.5

Q ss_pred             CeEEEeccceeeeCCCCceeeeeee
Q psy11391         86 PYSYGYYSLAVLRTQLLSPVRFQHV  110 (112)
Q Consensus        86 Py~I~~~~~gs~~~~GLGpv~W~~~  110 (112)
                      -|.|+    |.|.-.|=+|+.|-|.
T Consensus         3 kY~I~----Ati~KpGg~P~~W~r~   23 (64)
T PRK09750          3 MYKIT----ATIEKEGGTPTNWTRY   23 (64)
T ss_pred             eeEEE----EEEECCCCCccceeEe
Confidence            59999    9999999999999885


No 14 
>TIGR01432 QOXA cytochrome aa3 quinol oxidase, subunit II. This enzyme catalyzes the oxidation of quinol with the concomitant reduction of molecular oxygen to water. This acts as the terminal electron acceptor in the respiratory chain. This subunit contains two transmembrane helices and a large external domain responsible for the binding and oxidation of quinol. QuoX is (presently) only found in gram positive bacteria of the Bacillus/Staphylococcus group. Like CyoA, the ubiquinol oxidase found in proteobacteria, the residues responsible for the ligation of Cu(a) and cytochrome c (found in the related cyt. c oxidases) are absent. Unlike CyoA, QoxA is in complex with a subunit I which contains cytochromes a similar to the cyt. c oxidases (as opposed to cytochromes b).
Probab=77.84  E-value=2.6  Score=32.38  Aligned_cols=32  Identities=19%  Similarity=0.385  Sum_probs=26.0

Q ss_pred             ceEEEeccCCCC----ceeeeeCCCCeEEEEEceEE
Q psy11391         28 QVWVWEFDNEGD----KHDLFMDPGDKIKFRVTSEL   59 (112)
Q Consensus        28 ~~W~W~~~~ed~----~~~l~~d~ge~IRFRV~~~~   59 (112)
                      +.|.|.|+..++    .++|.+-.|..|||++.+-.
T Consensus       113 ~qw~W~~~Yp~~~~~~~n~l~iP~g~~v~~~ltS~D  148 (217)
T TIGR01432       113 ADWKWFFSYPDEHIETVNYLNIPKDRPVLFKLQSAD  148 (217)
T ss_pred             EeeeEEEEeCCCCcceeCcEEEECCCEEEEEEECCc
Confidence            469999876443    26899999999999999864


No 15 
>MTH00051 COX2 cytochrome c oxidase subunit II; Provisional
Probab=77.54  E-value=3.5  Score=32.31  Aligned_cols=18  Identities=17%  Similarity=0.287  Sum_probs=16.0

Q ss_pred             eeeeeCCCCeEEEEEceE
Q psy11391         41 HDLFMDPGDKIKFRVTSE   58 (112)
Q Consensus        41 ~~l~~d~ge~IRFRV~~~   58 (112)
                      ++|.+-.|..|||+|.+.
T Consensus       144 n~lvlP~~~~v~~~itS~  161 (234)
T MTH00051        144 NRLIVPIQTQVRVLVTAA  161 (234)
T ss_pred             eEEEEecCcEEEEEEEeC
Confidence            578899999999999985


No 16 
>PF00116 COX2:  Cytochrome C oxidase subunit II, periplasmic domain This family corresponds to chains b and o.;  InterPro: IPR002429 Cytochrome c oxidase (1.9.3.1 from EC) [, ] is an oligomeric enzymatic complex which is a component of the respiratory chain and is involved in the transfer of electrons from cytochrome c to oxygen. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane. The number of polypeptides in the complex ranges from 3-4 (prokaryotes), up to 13(mammals). Subunit 2 (CO II) transfers the electrons from cytochrome c to the catalytic subunit 1. It contains two adjacent transmembrane regions in its N terminus and the major part of the protein is exposed to the periplasmic or to the mitochondrial intermembrane space, respectively. CO II provides the substrate-binding site and contains a copper centre called Cu(A), probably the primary acceptor in cytochrome c oxidase. An exception is the corresponding subunit of the cbb3-type oxidase which lacks the copper A redox-centre. Several bacterial CO II have a C-terminal extension that contains a covalently bound haem c.; GO: 0004129 cytochrome-c oxidase activity, 0005507 copper ion binding, 0016020 membrane; PDB: 3OMN_D 3OMA_B 3OMI_D 3OM3_B 3EHB_B 1AR1_B 1QLE_B 3HB3_B 2IWK_B 2IWF_A ....
Probab=77.07  E-value=2.1  Score=30.09  Aligned_cols=18  Identities=33%  Similarity=0.756  Sum_probs=16.0

Q ss_pred             eeeeeCCCCeEEEEEceE
Q psy11391         41 HDLFMDPGDKIKFRVTSE   58 (112)
Q Consensus        41 ~~l~~d~ge~IRFRV~~~   58 (112)
                      ++|.+..|.+|||++.+.
T Consensus        46 ~~l~lp~g~~v~~~ltS~   63 (120)
T PF00116_consen   46 NELVLPAGQPVRFHLTSE   63 (120)
T ss_dssp             SEEEEETTSEEEEEEEES
T ss_pred             ceecccccceEeEEEEcC
Confidence            578999999999999983


No 17 
>MTH00047 COX2 cytochrome c oxidase subunit II; Provisional
Probab=76.16  E-value=3.1  Score=31.90  Aligned_cols=32  Identities=22%  Similarity=0.337  Sum_probs=23.8

Q ss_pred             ceEEEeccCCCCc--------------eeeeeCCCCeEEEEEceEE
Q psy11391         28 QVWVWEFDNEGDK--------------HDLFMDPGDKIKFRVTSEL   59 (112)
Q Consensus        28 ~~W~W~~~~ed~~--------------~~l~~d~ge~IRFRV~~~~   59 (112)
                      +.|.|.|...+++              ++|.+-.|..|||++.+..
T Consensus        89 ~QW~W~f~Yp~~~~~~s~~~~~~~~~~~~l~lp~g~~v~~~ltS~D  134 (194)
T MTH00047         89 HQWYWSYEYSFGGSYDSFMTDDIFGVDKPLRLVYGVPYHLLVTSSD  134 (194)
T ss_pred             hheeEEEEcCCCcccccccchhhhccCceEEEeCCCEEEeeeecCc
Confidence            3699987753321              4688888999999999865


No 18 
>MTH00154 COX2 cytochrome c oxidase subunit II; Provisional
Probab=75.36  E-value=4.2  Score=31.75  Aligned_cols=19  Identities=16%  Similarity=0.261  Sum_probs=16.4

Q ss_pred             eeeeeCCCCeEEEEEceEE
Q psy11391         41 HDLFMDPGDKIKFRVTSEL   59 (112)
Q Consensus        41 ~~l~~d~ge~IRFRV~~~~   59 (112)
                      ++|.+-.|..|||++.+--
T Consensus       140 n~l~lP~~~~v~~~~tS~D  158 (227)
T MTH00154        140 NRLVLPMNTQIRILITAAD  158 (227)
T ss_pred             ceEEEecCCEEEEEEEcCc
Confidence            5789999999999998854


No 19 
>MTH00038 COX2 cytochrome c oxidase subunit II; Provisional
Probab=73.69  E-value=4.8  Score=31.39  Aligned_cols=19  Identities=21%  Similarity=0.179  Sum_probs=15.9

Q ss_pred             eeeeeCCCCeEEEEEceEE
Q psy11391         41 HDLFMDPGDKIKFRVTSEL   59 (112)
Q Consensus        41 ~~l~~d~ge~IRFRV~~~~   59 (112)
                      ++|.+-.|..|||++.+.-
T Consensus       140 n~lvlP~~~~v~~~~tS~D  158 (229)
T MTH00038        140 NRLVLPYQTPIRVLVSSAD  158 (229)
T ss_pred             ceEEEecCeEEEEEEEECC
Confidence            5788888899999998865


No 20 
>MTH00140 COX2 cytochrome c oxidase subunit II; Provisional
Probab=73.58  E-value=4.6  Score=31.37  Aligned_cols=18  Identities=22%  Similarity=0.189  Sum_probs=15.9

Q ss_pred             eeeeeCCCCeEEEEEceE
Q psy11391         41 HDLFMDPGDKIKFRVTSE   58 (112)
Q Consensus        41 ~~l~~d~ge~IRFRV~~~   58 (112)
                      ++|.+-.|..|||++.+.
T Consensus       140 n~l~lP~~~~v~~~~ts~  157 (228)
T MTH00140        140 NRLVLPYSVDTRVLVTSA  157 (228)
T ss_pred             CeEEEeeCcEEEEEEEcC
Confidence            578999999999999994


No 21 
>PRK10525 cytochrome o ubiquinol oxidase subunit II; Provisional
Probab=71.49  E-value=5  Score=33.11  Aligned_cols=33  Identities=21%  Similarity=0.393  Sum_probs=26.2

Q ss_pred             ceEEEeccCCCC----ceeeeeCCCCeEEEEEceEEe
Q psy11391         28 QVWVWEFDNEGD----KHDLFMDPGDKIKFRVTSELF   60 (112)
Q Consensus        28 ~~W~W~~~~ed~----~~~l~~d~ge~IRFRV~~~~F   60 (112)
                      ..|.|.|...|.    .++|.+-.|..|||++.+..-
T Consensus       134 ~QW~W~f~YP~~gi~t~NeL~iP~g~pV~f~lTS~DV  170 (315)
T PRK10525        134 MDWKWFFIYPEQGIATVNEIAFPANVPVYFKVTSNSV  170 (315)
T ss_pred             EeeeEEEEcCCCCceeeccEEEecCCEEEEEEEEchh
Confidence            359998865443    279999999999999998753


No 22 
>MTH00139 COX2 cytochrome c oxidase subunit II; Provisional
Probab=70.97  E-value=6  Score=30.69  Aligned_cols=19  Identities=16%  Similarity=0.162  Sum_probs=15.6

Q ss_pred             eeeeeCCCCeEEEEEceEE
Q psy11391         41 HDLFMDPGDKIKFRVTSEL   59 (112)
Q Consensus        41 ~~l~~d~ge~IRFRV~~~~   59 (112)
                      ++|.+-.|..|||++.+--
T Consensus       140 n~l~lP~~~~v~~~~tS~D  158 (226)
T MTH00139        140 NRLVLPYKSNIRALITAAD  158 (226)
T ss_pred             ceEEEecCCEEEEEEecCc
Confidence            5788888899999998754


No 23 
>MTH00117 COX2 cytochrome c oxidase subunit II; Provisional
Probab=70.63  E-value=5.6  Score=30.99  Aligned_cols=19  Identities=21%  Similarity=0.333  Sum_probs=16.2

Q ss_pred             eeeeeCCCCeEEEEEceEE
Q psy11391         41 HDLFMDPGDKIKFRVTSEL   59 (112)
Q Consensus        41 ~~l~~d~ge~IRFRV~~~~   59 (112)
                      ++|.+-.|..|||++.+.-
T Consensus       140 n~lvlP~~~~v~~~~tS~D  158 (227)
T MTH00117        140 HRMVIPMESPIRILITAED  158 (227)
T ss_pred             ceEEEecCceEEEEEEecc
Confidence            5788899999999998864


No 24 
>MTH00185 COX2 cytochrome c oxidase subunit II; Provisional
Probab=70.28  E-value=6.2  Score=30.86  Aligned_cols=19  Identities=21%  Similarity=0.301  Sum_probs=16.3

Q ss_pred             eeeeeCCCCeEEEEEceEE
Q psy11391         41 HDLFMDPGDKIKFRVTSEL   59 (112)
Q Consensus        41 ~~l~~d~ge~IRFRV~~~~   59 (112)
                      ++|.+-.|..|||+|.+..
T Consensus       140 n~lvlP~~~~v~~~~tS~D  158 (230)
T MTH00185        140 HRMVVPMESPIRVLITAED  158 (230)
T ss_pred             CeEEEecCCEEEEEEEcCc
Confidence            5788889999999998865


No 25 
>MTH00076 COX2 cytochrome c oxidase subunit II; Provisional
Probab=70.14  E-value=6.2  Score=30.81  Aligned_cols=19  Identities=16%  Similarity=0.244  Sum_probs=16.5

Q ss_pred             eeeeeCCCCeEEEEEceEE
Q psy11391         41 HDLFMDPGDKIKFRVTSEL   59 (112)
Q Consensus        41 ~~l~~d~ge~IRFRV~~~~   59 (112)
                      ++|.+-.|..|||+|.+..
T Consensus       140 n~l~lP~~~~v~~~~tS~D  158 (228)
T MTH00076        140 NRMVVPMESPIRMLITAED  158 (228)
T ss_pred             ceEEEecCCEEEEEEEecc
Confidence            5888999999999998865


No 26 
>MTH00129 COX2 cytochrome c oxidase subunit II; Provisional
Probab=69.79  E-value=6  Score=30.91  Aligned_cols=19  Identities=21%  Similarity=0.300  Sum_probs=16.4

Q ss_pred             eeeeeCCCCeEEEEEceEE
Q psy11391         41 HDLFMDPGDKIKFRVTSEL   59 (112)
Q Consensus        41 ~~l~~d~ge~IRFRV~~~~   59 (112)
                      ++|.+-.|..|||++.+..
T Consensus       140 n~lvlP~~~~v~~~~tS~D  158 (230)
T MTH00129        140 HRMVVPVESPIRVLVSAED  158 (230)
T ss_pred             ceEEEecCcEEEEEEEeCc
Confidence            5788999999999998865


No 27 
>MTH00168 COX2 cytochrome c oxidase subunit II; Provisional
Probab=68.87  E-value=6.1  Score=30.71  Aligned_cols=19  Identities=32%  Similarity=0.303  Sum_probs=15.9

Q ss_pred             eeeeeCCCCeEEEEEceEE
Q psy11391         41 HDLFMDPGDKIKFRVTSEL   59 (112)
Q Consensus        41 ~~l~~d~ge~IRFRV~~~~   59 (112)
                      ++|.+-.|..|||++.+.-
T Consensus       140 n~l~lP~~~~v~~~~tS~D  158 (225)
T MTH00168        140 NRLVLPMDSKIRVLVTSAD  158 (225)
T ss_pred             ceEEEecCCEEEEEEEeCC
Confidence            5788888999999998864


No 28 
>MTH00023 COX2 cytochrome c oxidase subunit II; Validated
Probab=68.60  E-value=6.5  Score=30.93  Aligned_cols=19  Identities=16%  Similarity=0.198  Sum_probs=16.2

Q ss_pred             eeeeeCCCCeEEEEEceEE
Q psy11391         41 HDLFMDPGDKIKFRVTSEL   59 (112)
Q Consensus        41 ~~l~~d~ge~IRFRV~~~~   59 (112)
                      ++|.+-.|..|||++.+.-
T Consensus       151 n~lvlP~~~~v~~~~tS~D  169 (240)
T MTH00023        151 NRLVVPINTHVRILVTGAD  169 (240)
T ss_pred             ceEEEecCCEEEEEEEcCC
Confidence            5788889999999998864


No 29 
>MTH00008 COX2 cytochrome c oxidase subunit II; Validated
Probab=67.66  E-value=5.1  Score=31.29  Aligned_cols=17  Identities=18%  Similarity=0.223  Sum_probs=15.3

Q ss_pred             eeeeeCCCCeEEEEEce
Q psy11391         41 HDLFMDPGDKIKFRVTS   57 (112)
Q Consensus        41 ~~l~~d~ge~IRFRV~~   57 (112)
                      ++|.+-.|..|||+|.+
T Consensus       140 n~lvlP~~~~v~~~~tS  156 (228)
T MTH00008        140 NRAVLPMQTEIRVLVTA  156 (228)
T ss_pred             ceEEEecCCEEEEEEEe
Confidence            57888889999999999


No 30 
>PF06688 DUF1187:  Protein of unknown function (DUF1187);  InterPro: IPR009572 This family consists of several short, hypothetical bacterial proteins of around 62 residues in length. Members of this family are found in Escherichia coli and Salmonella typhi. The function of this family is unknown.
Probab=61.91  E-value=8.4  Score=24.85  Aligned_cols=20  Identities=20%  Similarity=0.290  Sum_probs=18.5

Q ss_pred             eEEEeccceeeeCCCCceeeeeee
Q psy11391         87 YSYGYYSLAVLRTQLLSPVRFQHV  110 (112)
Q Consensus        87 y~I~~~~~gs~~~~GLGpv~W~~~  110 (112)
                      |+|+    |.|--.|=.||.|-+.
T Consensus         1 YkIt----AtI~KpG~~Pv~W~ry   20 (61)
T PF06688_consen    1 YKIT----ATIIKPGNTPVNWTRY   20 (61)
T ss_pred             CceE----EEEEcCCCCCeeeEEe
Confidence            8899    9999999999999874


No 31 
>MTH00080 COX2 cytochrome c oxidase subunit II; Provisional
Probab=61.50  E-value=9.7  Score=29.92  Aligned_cols=19  Identities=21%  Similarity=0.263  Sum_probs=15.3

Q ss_pred             eeeeeCCCCeEEEEEceEE
Q psy11391         41 HDLFMDPGDKIKFRVTSEL   59 (112)
Q Consensus        41 ~~l~~d~ge~IRFRV~~~~   59 (112)
                      ++|.+-.|..|||+|.+.-
T Consensus       143 n~l~lP~~~~v~~~itS~D  161 (231)
T MTH00080        143 NRCVLPCDTNIRFCITSSD  161 (231)
T ss_pred             CceEeecCcEEEEEEEeCc
Confidence            4567888999999998865


No 32 
>MTH00098 COX2 cytochrome c oxidase subunit II; Validated
Probab=59.14  E-value=7.8  Score=30.26  Aligned_cols=19  Identities=16%  Similarity=0.188  Sum_probs=16.4

Q ss_pred             eeeeeCCCCeEEEEEceEE
Q psy11391         41 HDLFMDPGDKIKFRVTSEL   59 (112)
Q Consensus        41 ~~l~~d~ge~IRFRV~~~~   59 (112)
                      ++|.+-.|..|||++.+..
T Consensus       140 n~lvlP~~~~v~~~~tS~D  158 (227)
T MTH00098        140 NRVVLPMEMPIRMLISSED  158 (227)
T ss_pred             ceEEecCCCEEEEEEEECc
Confidence            5788999999999998865


No 33 
>cd04454 S1_Rrp4_like S1_Rrp4_like: Rrp4-like, S1-like RNA-binding domain. S1-like RNA-binding domains are found in a wide variety of RNA-associated proteins. Rrp4 protein, and Rrp40 and Csl4 proteins, also represented in this group, are subunits of the exosome complex. The exosome plays a central role in 3' to 5' RNA processing and degradation in eukarytes and archaea. Its functions include the removal of incorrectly processed RNA and the maintenance of proper levels of mRNA, rRNA and a number of small RNA species. In Saccharomyces cerevisiae, the exosome includes nine core components, six of which are homologous to bacterial RNase PH. These form a hexameric ring structure. The other three subunits (RrP4, Rrp40, and Csl4) contain an S1 RNA binding domain and are part of the "S1 pore structure".
Probab=53.15  E-value=24  Score=22.29  Aligned_cols=16  Identities=38%  Similarity=0.372  Sum_probs=13.8

Q ss_pred             eeCCCCeEEEEEceEE
Q psy11391         44 FMDPGDKIKFRVTSEL   59 (112)
Q Consensus        44 ~~d~ge~IRFRV~~~~   59 (112)
                      .+..|+.|++||.+..
T Consensus        50 ~~~~GD~i~~~V~~~~   65 (82)
T cd04454          50 SLQPGDLILAKVISLG   65 (82)
T ss_pred             cCCCCCEEEEEEEEeC
Confidence            3689999999999876


No 34 
>MTH00027 COX2 cytochrome c oxidase subunit II; Provisional
Probab=53.01  E-value=16  Score=29.35  Aligned_cols=19  Identities=11%  Similarity=0.239  Sum_probs=15.5

Q ss_pred             eeeeeCCCCeEEEEEceEE
Q psy11391         41 HDLFMDPGDKIKFRVTSEL   59 (112)
Q Consensus        41 ~~l~~d~ge~IRFRV~~~~   59 (112)
                      ++|.+-.|..|||++.+--
T Consensus       174 n~lvlP~~~~v~~~ltS~D  192 (262)
T MTH00027        174 NRLILPVDTNVRVLITAAD  192 (262)
T ss_pred             ceEEEeeCcEEEEEEEcCc
Confidence            4788888899999998754


No 35 
>cd05791 S1_CSL4 S1_CSL4: CSL4, S1-like RNA-binding domain. S1-like RNA-binding domains are found in a wide variety of RNA-associated proteins. ScCSL4 protein is a subunit of the exosome complex. The exosome plays a central role in 3' to 5' RNA processing and degradation in eukarytes and archaea. Its functions include the removal of incorrectly processed RNA and the maintenance of proper levels of mRNA, rRNA and a number of small RNA species. In S. cerevisiae, the exosome includes nine core components, six of which are homologous to bacterial RNase PH. These form a hexameric ring structure. The other three subunits (RrP4, Rrp40, and Csl4) contain an S1 RNA binding domain and are part of the "S1 pore structure".
Probab=49.16  E-value=27  Score=23.27  Aligned_cols=34  Identities=24%  Similarity=0.257  Sum_probs=25.8

Q ss_pred             eeeCCCCeEEEEEceEEeeecCCCCCCCcCCCCCCCCCCCCCCCeEEEeccceeeeCCCCcee
Q psy11391         43 LFMDPGDKIKFRVTSELFTETSPISCPDIHDGAPGSEVDTPKIPYSYGYYSLAVLRTQLLSPV  105 (112)
Q Consensus        43 l~~d~ge~IRFRV~~~~F~d~~P~~p~~~e~~~~~~~~~~~~~Py~I~~~~~gs~~~~GLGpv  105 (112)
                      -+|..|+-||=||.+..            +           ..+|.++      +++.+||.|
T Consensus        59 ~~f~~GDiV~AkVis~~------------~-----------~~~~~Ls------t~~~~lGVv   92 (92)
T cd05791          59 KCFRPGDIVRAKVISLG------------D-----------ASSYYLS------TAENELGVV   92 (92)
T ss_pred             hhcCCCCEEEEEEEEcC------------C-----------CCCcEEE------ecCCCCccC
Confidence            36799999999998765            0           1357777      889999864


No 36 
>COG1622 CyoA Heme/copper-type cytochrome/quinol oxidases, subunit 2 [Energy production and conversion]
Probab=44.85  E-value=30  Score=27.51  Aligned_cols=31  Identities=26%  Similarity=0.577  Sum_probs=24.8

Q ss_pred             ceEEEeccCCCC----ceeeeeCCCCeEEEEEceE
Q psy11391         28 QVWVWEFDNEGD----KHDLFMDPGDKIKFRVTSE   58 (112)
Q Consensus        28 ~~W~W~~~~ed~----~~~l~~d~ge~IRFRV~~~   58 (112)
                      ..|.|.+...+.    .++|.+-.|..|||++.+-
T Consensus       120 ~qw~W~f~Yp~~~~~t~n~l~lPv~~~V~f~ltS~  154 (247)
T COG1622         120 YQWKWLFIYPDYGIATVNELVLPVGRPVRFKLTSA  154 (247)
T ss_pred             EEEEEEEEccCcCccccceEEEeCCCeEEEEEEec
Confidence            368887765442    3789999999999999986


No 37 
>cd05688 S1_RPS1_repeat_ec3 S1_RPS1_repeat_ec3: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture consists of 4-6 tandem S1 domains. In some bacteria, the tandem S1 array is located C-terminal to a 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (HMBPP reductase) domain. While RPS1 is found primarily in bacteria, proteins with tandem RPS1-like domains have been identified in plants and humans, however these lack the N-terminal HMBPP reductase domain. This CD includes S1 repeat 3 (ec3) of the Escherichia coli RPS1. Autoantibodies to double-stranded DNA from patients with systemic lupus erythematosus cross-react with the human RPS1 homolog.
Probab=44.33  E-value=30  Score=20.30  Aligned_cols=16  Identities=19%  Similarity=0.360  Sum_probs=14.5

Q ss_pred             eeCCCCeEEEEEceEE
Q psy11391         44 FMDPGDKIKFRVTSEL   59 (112)
Q Consensus        44 ~~d~ge~IRFRV~~~~   59 (112)
                      .|.+|+.|+++|.++.
T Consensus        44 ~~~~Gd~v~v~i~~vd   59 (68)
T cd05688          44 VVNVGDEVEVKVLKID   59 (68)
T ss_pred             EECCCCEEEEEEEEEE
Confidence            5799999999999886


No 38 
>PRK15266 subtilase cytotoxin subunit B; Provisional
Probab=43.19  E-value=18  Score=26.66  Aligned_cols=49  Identities=16%  Similarity=0.219  Sum_probs=33.7

Q ss_pred             ceeeeeCCCCeEEEEEceEEeeecCCCCCCCcCCCCCCCCCCCCCCCeEEEeccceeeeCCCCce
Q psy11391         40 KHDLFMDPGDKIKFRVTSELFTETSPISCPDIHDGAPGSEVDTPKIPYSYGYYSLAVLRTQLLSP  104 (112)
Q Consensus        40 ~~~l~~d~ge~IRFRV~~~~F~d~~P~~p~~~e~~~~~~~~~~~~~Py~I~~~~~gs~~~~GLGp  104 (112)
                      ..++||-.|+.||.-+....|++..=..               ....=.|+|.+-++ ..+=+||
T Consensus        86 qA~YyYtTG~~VRiYy~~nVWt~p~F~~---------------afS~naLvg~ssCs-~s~C~GP  134 (135)
T PRK15266         86 QARYFYSTGQSVRIHVQKNIWTYPLFVN---------------TFSANALVGLSSCS-ATQCFGP  134 (135)
T ss_pred             hhheeEecCceEEEEEcCCcccCchhhh---------------hccccceeEEEeec-cceecCC
Confidence            3689999999999999999998863111               11223355666666 6666666


No 39 
>PRK15265 subtilase cytotoxin subunit B-like protein; Provisional
Probab=43.14  E-value=14  Score=27.23  Aligned_cols=23  Identities=13%  Similarity=0.405  Sum_probs=21.5

Q ss_pred             eeeeeCCCCeEEEEEceEEeeec
Q psy11391         41 HDLFMDPGDKIKFRVTSELFTET   63 (112)
Q Consensus        41 ~~l~~d~ge~IRFRV~~~~F~d~   63 (112)
                      .+.|+-.|+.||.+|+...|+|.
T Consensus        83 A~yyYtTg~~vRiy~~~nVWTdp  105 (134)
T PRK15265         83 AMYYYTTGKRIRVYYAPDVWTNN  105 (134)
T ss_pred             hhheeecCCcEEEEEcCCcccCc
Confidence            57899999999999999999986


No 40 
>cd00164 S1_like S1_like: Ribosomal protein S1-like RNA-binding domain. Found in a wide variety of RNA-associated proteins. Originally identified in S1 ribosomal protein. This superfamily also contains the Cold Shock Domain (CSD), which is a homolog of the S1 domain. Both domains are members of the Oligonucleotide/oligosaccharide Binding (OB) fold.
Probab=42.49  E-value=31  Score=19.55  Aligned_cols=17  Identities=18%  Similarity=0.268  Sum_probs=15.0

Q ss_pred             eeeCCCCeEEEEEceEE
Q psy11391         43 LFMDPGDKIKFRVTSEL   59 (112)
Q Consensus        43 l~~d~ge~IRFRV~~~~   59 (112)
                      -++..|+.|++||.++.
T Consensus        40 ~~~~~G~~v~~~v~~~d   56 (65)
T cd00164          40 EVFKVGDEVEVKVLEVD   56 (65)
T ss_pred             hEeCCCCEEEEEEEEEc
Confidence            46899999999999875


No 41 
>smart00316 S1 Ribosomal protein S1-like RNA-binding domain.
Probab=41.47  E-value=34  Score=19.69  Aligned_cols=17  Identities=29%  Similarity=0.370  Sum_probs=15.0

Q ss_pred             eeeCCCCeEEEEEceEE
Q psy11391         43 LFMDPGDKIKFRVTSEL   59 (112)
Q Consensus        43 l~~d~ge~IRFRV~~~~   59 (112)
                      -.|..|+.|++||.++.
T Consensus        45 ~~~~~G~~v~~~V~~~~   61 (72)
T smart00316       45 EVLKVGDEVKVKVLSVD   61 (72)
T ss_pred             HeecCCCEEEEEEEEEe
Confidence            35799999999999987


No 42 
>cd04471 S1_RNase_R S1_RNase_R: RNase R C-terminal S1 domain. RNase R is a processive 3' to 5' exoribonuclease, which is a homolog of RNase II. RNase R degrades RNA with secondary structure having a 3' overhang of at least 7 nucleotides. RNase R and PNPase play an important role in the degradation of RNA with extensive secondary structure, such as rRNA, tRNA, and certain mRNA which contains repetitive extragenic palindromic sequences. The C-terminal S1 domain binds ssRNA.
Probab=41.08  E-value=52  Score=20.24  Aligned_cols=43  Identities=30%  Similarity=0.331  Sum_probs=26.0

Q ss_pred             eeCCCCCCCC-CCCCcccceEEEeccCCCCceeeeeCCCCeEEEEEceEE
Q psy11391         11 LIPPEGLQQP-SRFDEKEQVWVWEFDNEGDKHDLFMDPGDKIKFRVTSEL   59 (112)
Q Consensus        11 ~IP~~~L~~p-s~fd~~e~~W~W~~~~ed~~~~l~~d~ge~IRFRV~~~~   59 (112)
                      +|+.+.|... -.||+.........      ..-.|..|+.||.||.++.
T Consensus        29 ~v~~~~l~~~~~~~d~~~~~~~~~~------~~~~~~~gd~v~v~v~~vd   72 (83)
T cd04471          29 LVHVSTLGDDYYEFDEENHALVGER------TGKVFRLGDKVKVRVVRVD   72 (83)
T ss_pred             EEEEEecCCCcEEEcccceEEEecc------CCCEEcCCCEEEEEEEEec
Confidence            5566666533 23444433332221      2357899999999999887


No 43 
>PRK04163 exosome complex RNA-binding protein Rrp4; Provisional
Probab=37.17  E-value=57  Score=25.37  Aligned_cols=18  Identities=28%  Similarity=0.320  Sum_probs=14.3

Q ss_pred             eeeeCCCCeEEEEEceEE
Q psy11391         42 DLFMDPGDKIKFRVTSEL   59 (112)
Q Consensus        42 ~l~~d~ge~IRFRV~~~~   59 (112)
                      +-+|+.|+.|+-||.+..
T Consensus       109 ~~~~~~GDlV~akV~~i~  126 (235)
T PRK04163        109 RKYLDIGDYIIAKVKDVD  126 (235)
T ss_pred             HhhCCCCCEEEEEEEEEC
Confidence            346789999999998765


No 44 
>PF00975 Thioesterase:  Thioesterase domain;  InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics []. Thioesterases are required for the addition of the last amino acid to the peptide antibiotic, thereby forming a cyclic antibiotic. Next to the operons encoding these enzymes, in almost all cases, are genes that encode proteins that have similarity to the type II fatty acid thioesterases of vertebrates.; GO: 0016788 hydrolase activity, acting on ester bonds, 0009058 biosynthetic process; PDB: 2RON_A 2K2Q_B 3LCR_B 2HFJ_B 1MNQ_A 1MN6_B 1MNA_B 2HFK_B 2H7Y_B 2H7X_A ....
Probab=36.55  E-value=12  Score=27.05  Aligned_cols=13  Identities=23%  Similarity=0.378  Sum_probs=11.4

Q ss_pred             CCeEEEeccceee
Q psy11391         85 IPYSYGYYSLAVL   97 (112)
Q Consensus        85 ~Py~I~~~~~gs~   97 (112)
                      -||.|.|||+|++
T Consensus        66 gp~~L~G~S~Gg~   78 (229)
T PF00975_consen   66 GPYVLAGWSFGGI   78 (229)
T ss_dssp             SSEEEEEETHHHH
T ss_pred             CCeeehccCccHH
Confidence            3999999999975


No 45 
>cd05789 S1_Rrp4 S1_Rrp4: Rrp4 S1-like RNA-binding domain. S1-like RNA-binding domains are found in a wide variety of RNA-associated proteins. Rrp4 protein is a subunit of the exosome complex. The exosome plays a central role in 3' to 5' RNA processing and degradation in eukarytes and archaea. Its functions include the removal of incorrectly processed RNA and the maintenance of proper levels of mRNA, rRNA and a number of small RNA species. In Saccharomyces cerevisiae, the exosome includes nine core components, six of which are homologous to bacterial RNase PH. These form a hexameric ring structure. The other three subunits (RrP4, Rrp40, and Csl4) contain an S1 RNA binding domain and are part of the "S1 pore structure".
Probab=34.19  E-value=59  Score=20.54  Aligned_cols=16  Identities=38%  Similarity=0.447  Sum_probs=13.7

Q ss_pred             eeCCCCeEEEEEceEE
Q psy11391         44 FMDPGDKIKFRVTSEL   59 (112)
Q Consensus        44 ~~d~ge~IRFRV~~~~   59 (112)
                      ++..|+.|++||.+..
T Consensus        54 ~l~vGd~i~~~V~~~~   69 (86)
T cd05789          54 YLDEGDLIVAEVQSVD   69 (86)
T ss_pred             hCCCCCEEEEEEEEEC
Confidence            5789999999998864


No 46 
>cd05691 S1_RPS1_repeat_ec6 S1_RPS1_repeat_ec6: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture consists of 4-6 tandem S1 domains. In some bacteria, the tandem S1 array is located C-terminal to a 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (HMBPP reductase) domain. While RPS1 is found primarily in bacteria, proteins with tandem RPS1-like domains have been identified in plants and humans, however these lack the N-terminal HMBPP reductase domain. This CD includes S1 repeat 6 (ec6) of the Escherichia coli RPS1. Autoantibodies to double-stranded DNA from patients with systemic lupus erythematosus cross-react with the human RPS1 homolog.
Probab=33.78  E-value=47  Score=19.94  Aligned_cols=17  Identities=18%  Similarity=0.231  Sum_probs=14.8

Q ss_pred             eeCCCCeEEEEEceEEe
Q psy11391         44 FMDPGDKIKFRVTSELF   60 (112)
Q Consensus        44 ~~d~ge~IRFRV~~~~F   60 (112)
                      +|..|+.|++||.+...
T Consensus        44 ~~~~Gd~v~~~v~~~d~   60 (73)
T cd05691          44 RFKVGDEVEAKITNVDR   60 (73)
T ss_pred             ccCCCCEEEEEEEEEeC
Confidence            56899999999999873


No 47 
>cd05708 S1_Rrp5_repeat_sc12 S1_Rrp5_repeat_sc12: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions.  Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes S. cerevisiae S1 repeat 12 (sc12). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.
Probab=32.46  E-value=57  Score=19.71  Aligned_cols=17  Identities=24%  Similarity=0.307  Sum_probs=14.8

Q ss_pred             eeeCCCCeEEEEEceEE
Q psy11391         43 LFMDPGDKIKFRVTSEL   59 (112)
Q Consensus        43 l~~d~ge~IRFRV~~~~   59 (112)
                      -.|.+|+.|+.||.++.
T Consensus        46 ~~~~~Gd~v~v~i~~vd   62 (77)
T cd05708          46 KLFRVGDKVRAKVLKID   62 (77)
T ss_pred             HeecCCCEEEEEEEEEe
Confidence            36799999999999877


No 48 
>cd04452 S1_IF2_alpha S1_IF2_alpha: The alpha subunit of translation Initiation Factor 2, S1-like RNA-binding domain. S1-like RNA-binding domains are found in a wide variety of RNA-associated proteins. Eukaryotic and archaeal Initiation Factor 2 (e- and aIF2, respectively) are heterotrimeric proteins with three subunits (alpha, beta, and gamma). IF2 plays a crucial role in the process of translation initiation. The IF2 gamma subunit contains a GTP-binding site. The IF2 beta and gamma subunits together are thought to be responsible for binding methionyl-initiator tRNA. The ternary complex consisting of IF2, GTP, and the methionyl-initiator tRNA binds to the small subunit of the ribosome, as part of a pre-initiation complex that scans the mRNA to find the AUG start codon. The IF2-bound GTP is hydrolyzed to GDP when the methionyl-initiator tRNA binds the AUG start codon, at which time the IF2 is released with its bound GDP. The large ribosomal subunit then joins with the small subunit to c
Probab=31.91  E-value=58  Score=19.80  Aligned_cols=16  Identities=19%  Similarity=0.146  Sum_probs=14.3

Q ss_pred             eeCCCCeEEEEEceEE
Q psy11391         44 FMDPGDKIKFRVTSEL   59 (112)
Q Consensus        44 ~~d~ge~IRFRV~~~~   59 (112)
                      +|..|+.|+.||.++.
T Consensus        49 ~~~~Gd~v~vkv~~~d   64 (76)
T cd04452          49 LVKVGRKEVVKVIRVD   64 (76)
T ss_pred             eeCCCCEEEEEEEEEE
Confidence            4799999999999877


No 49 
>cd05705 S1_Rrp5_repeat_hs14 S1_Rrp5_repeat_hs14: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes H. sapiens S1 repeat 14 (hs14). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.
Probab=29.61  E-value=59  Score=20.54  Aligned_cols=17  Identities=18%  Similarity=0.243  Sum_probs=15.3

Q ss_pred             eeeCCCCeEEEEEceEE
Q psy11391         43 LFMDPGDKIKFRVTSEL   59 (112)
Q Consensus        43 l~~d~ge~IRFRV~~~~   59 (112)
                      =+|..|+.|+++|.++.
T Consensus        49 ~~~~~G~~v~~kVl~id   65 (74)
T cd05705          49 KYLPEGKLLTAKVLSVN   65 (74)
T ss_pred             cccCCCCEEEEEEEEEE
Confidence            37899999999999987


No 50 
>PRK09521 exosome complex RNA-binding protein Csl4; Provisional
Probab=29.51  E-value=1.1e+02  Score=22.72  Aligned_cols=16  Identities=25%  Similarity=0.285  Sum_probs=12.7

Q ss_pred             eeCCCCeEEEEEceEE
Q psy11391         44 FMDPGDKIKFRVTSEL   59 (112)
Q Consensus        44 ~~d~ge~IRFRV~~~~   59 (112)
                      +|..|+.|+.||.+..
T Consensus       118 ~~~~GD~V~akV~~i~  133 (189)
T PRK09521        118 AFKIGDIVRAKVISYT  133 (189)
T ss_pred             ccCCCCEEEEEEEecC
Confidence            4688888888888775


No 51 
>PF14326 DUF4384:  Domain of unknown function (DUF4384)
Probab=29.39  E-value=45  Score=21.49  Aligned_cols=14  Identities=43%  Similarity=0.861  Sum_probs=10.9

Q ss_pred             eCCCCeEEEEEceE
Q psy11391         45 MDPGDKIKFRVTSE   58 (112)
Q Consensus        45 ~d~ge~IRFRV~~~   58 (112)
                      |..||.|||+|...
T Consensus         3 ~~~Ge~v~~~~~~~   16 (83)
T PF14326_consen    3 YRVGERVRFRVTSN   16 (83)
T ss_pred             ccCCCEEEEEEEeC
Confidence            46788999988773


No 52 
>PF00575 S1:  S1 RNA binding domain;  InterPro: IPR003029 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. The S1 domain was originally identified in ribosomal protein S1 but is found in a large number of RNA-associated proteins. The structure of the S1 RNA-binding domain from the Escherichia coli polynucleotide phosphorylase has been determined using NMR methods and consists of a five-stranded antiparallel beta barrel. Conserved residues on one face of the barrel and adjacent loops form the putative RNA-binding site [].  The structure of the S1 domain is very similar to that of cold shock proteins. This suggests that they may both be derived from an ancient nucleic acid-binding protein []. More information about these proteins can be found at Protein of the Month: RNA Exosomes []. This entry does not include translation initiation factor IF-1 S1 domains.; GO: 0003723 RNA binding; PDB: 3L7Z_F 2JE6_I 2JEA_I 2JEB_I 1E3P_A 2Y0S_E 1WI5_A 2BH8_A 2CQO_A 2EQS_A ....
Probab=28.80  E-value=58  Score=19.75  Aligned_cols=18  Identities=11%  Similarity=0.163  Sum_probs=15.8

Q ss_pred             eeeeCCCCeEEEEEceEE
Q psy11391         42 DLFMDPGDKIKFRVTSEL   59 (112)
Q Consensus        42 ~l~~d~ge~IRFRV~~~~   59 (112)
                      .-.+..|+.|++||.++.
T Consensus        46 ~~~~~~G~~v~v~v~~vd   63 (74)
T PF00575_consen   46 SEVYKIGQTVRVKVIKVD   63 (74)
T ss_dssp             HGTCETTCEEEEEEEEEE
T ss_pred             ccccCCCCEEEEEEEEEE
Confidence            457889999999999987


No 53 
>cd05687 S1_RPS1_repeat_ec1_hs1 S1_RPS1_repeat_ec1_hs1: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture consists of 4-6 tandem S1 domains. In some bacteria, the tandem S1 array is located C-terminal to a 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (HMBPP reductase) domain. While RPS1 is found primarily in bacteria, proteins with tandem RPS1-like domains have been identified in plants and humans, however these lack the N-terminal HMBPP reductase domain. This CD includes S1 repeat 1 of the Escherichia coli and Homo sapiens RPS1 (ec1 and hs1, respectively). Autoantibodies to double-stranded DNA from patients with systemic lupus erythematosus cross-react with the human RPS1 homolog.
Probab=28.46  E-value=64  Score=19.41  Aligned_cols=16  Identities=19%  Similarity=0.183  Sum_probs=14.0

Q ss_pred             eeCCCCeEEEEEceEE
Q psy11391         44 FMDPGDKIKFRVTSEL   59 (112)
Q Consensus        44 ~~d~ge~IRFRV~~~~   59 (112)
                      ++..|+.|+++|.+..
T Consensus        44 ~~~~Gd~i~~~i~~~~   59 (70)
T cd05687          44 EVKVGDEVEVYVLRVE   59 (70)
T ss_pred             cCCCCCEEEEEEEEEE
Confidence            4689999999998876


No 54 
>KOG3400|consensus
Probab=28.33  E-value=1.3e+02  Score=22.36  Aligned_cols=57  Identities=18%  Similarity=0.332  Sum_probs=42.0

Q ss_pred             CcceeeeCCCCCCCCCCCCcccceEE----------EeccCCCCceeeeeCCCCeEEEEEceEEeeecCCC
Q psy11391          6 FFEDILIPPEGLQQPSRFDEKEQVWV----------WEFDNEGDKHDLFMDPGDKIKFRVTSELFTETSPI   66 (112)
Q Consensus         6 FFdDI~IP~~~L~~ps~fd~~e~~W~----------W~~~~ed~~~~l~~d~ge~IRFRV~~~~F~d~~P~   66 (112)
                      -|||||--.+.-|++..||.-.++-.          -.++    .+-..++.|+..|.++-+---.|-+|.
T Consensus         5 lfdDiF~V~~vDpeGkkydrVsR~~~~S~~~~m~l~LDiN----t~lyPl~~gdkf~l~iastL~eDgtpd   71 (143)
T KOG3400|consen    5 LFDDIFKVSDVDPEGKKYDRVSRIEAKSESFKMDLILDIN----TQLYPLATGDKFTLVIASTLNEDGTPD   71 (143)
T ss_pred             hhhhceeeeecCcccchhhheEeEEeeCCCceEEEEEecc----cEEEeeccCCEEEEEEecccccCCCcc
Confidence            59999999999999999987666422          2222    234568888999988887776666665


No 55 
>COG3319 Thioesterase domains of type I polyketide synthases or non-ribosomal peptide synthetases [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=27.84  E-value=37  Score=27.10  Aligned_cols=16  Identities=31%  Similarity=0.347  Sum_probs=12.9

Q ss_pred             CCCCCeEEEeccceee
Q psy11391         82 TPKIPYSYGYYSLAVL   97 (112)
Q Consensus        82 ~~~~Py~I~~~~~gs~   97 (112)
                      .+.-||.+.|||+|..
T Consensus        62 QP~GPy~L~G~S~GG~   77 (257)
T COG3319          62 QPEGPYVLLGWSLGGA   77 (257)
T ss_pred             CCCCCEEEEeeccccH
Confidence            3456999999999963


No 56 
>cd05692 S1_RPS1_repeat_hs4 S1_RPS1_repeat_hs4: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture consists of 4-6 tandem S1 domains. In some bacteria, the tandem S1 array is located C-terminal to a 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (HMBPP reductase) domain. While RPS1 is found primarily in bacteria, proteins with tandem RPS1-like domains have been identified in plants and humans, however these lack the N-terminal HMBPP reductase domain. This CD includes S1 repeat 4 (hs4) of the H. sapiens RPS1 homolog. Autoantibodies to double-stranded DNA from patients with systemic lupus erythematosus cross-react with the human RPS1 homolog.
Probab=27.82  E-value=63  Score=18.73  Aligned_cols=16  Identities=38%  Similarity=0.503  Sum_probs=13.9

Q ss_pred             eeCCCCeEEEEEceEE
Q psy11391         44 FMDPGDKIKFRVTSEL   59 (112)
Q Consensus        44 ~~d~ge~IRFRV~~~~   59 (112)
                      .+..|+.|+.||.++.
T Consensus        44 ~~~~Gd~v~v~v~~~~   59 (69)
T cd05692          44 VLKEGDKVKVKVLSID   59 (69)
T ss_pred             ccCCCCEEEEEEEEEC
Confidence            5789999999998875


No 57 
>PF08206 OB_RNB:  Ribonuclease B OB domain;  InterPro: IPR013223 This domain includes the N-terminal OB domain found in ribonuclease B proteins in one or two copies.; PDB: 2ID0_D 2IX1_A 2IX0_A.
Probab=27.71  E-value=9.1  Score=23.46  Aligned_cols=14  Identities=50%  Similarity=0.683  Sum_probs=9.2

Q ss_pred             cCcceeeeCCCCCC
Q psy11391          5 GFFEDILIPPEGLQ   18 (112)
Q Consensus         5 gFFdDI~IP~~~L~   18 (112)
                      ++-+|||||+..|.
T Consensus        17 ~~~~DifIp~~~l~   30 (58)
T PF08206_consen   17 DGGEDIFIPPRNLN   30 (58)
T ss_dssp             T-TEEEEE-HHHHT
T ss_pred             CCCCCEEECHHHHC
Confidence            45689999988773


No 58 
>cd05698 S1_Rrp5_repeat_hs6_sc5 S1_Rrp5_repeat_hs6_sc5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes H. sapiens S1 repeat 6 (hs6) and S. cerevisiae S1 repeat 5 (sc5). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.
Probab=27.30  E-value=61  Score=19.48  Aligned_cols=16  Identities=25%  Similarity=0.243  Sum_probs=14.0

Q ss_pred             eeCCCCeEEEEEceEE
Q psy11391         44 FMDPGDKIKFRVTSEL   59 (112)
Q Consensus        44 ~~d~ge~IRFRV~~~~   59 (112)
                      .+..|+.|++||.++.
T Consensus        44 ~~~~G~~i~v~v~~~d   59 (70)
T cd05698          44 HFRVGQVVKVKVLSCD   59 (70)
T ss_pred             cccCCCEEEEEEEEEc
Confidence            4678999999999876


No 59 
>cd05697 S1_Rrp5_repeat_hs5 S1_Rrp5_repeat_hs5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes H. sapiens S1 repeat 5 (hs5) and S. cerevisiae S1 repeat 5 (sc5). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.
Probab=26.55  E-value=74  Score=19.19  Aligned_cols=17  Identities=41%  Similarity=0.391  Sum_probs=15.0

Q ss_pred             eeeCCCCeEEEEEceEE
Q psy11391         43 LFMDPGDKIKFRVTSEL   59 (112)
Q Consensus        43 l~~d~ge~IRFRV~~~~   59 (112)
                      -.|..|+.|++||.++.
T Consensus        43 ~~~~~Gd~i~~~V~~id   59 (69)
T cd05697          43 KKFKPGLKVKCRVLSVE   59 (69)
T ss_pred             HcCCCCCEEEEEEEEEE
Confidence            36889999999999886


No 60 
>cd05686 S1_pNO40 S1_pNO40: pNO40 , S1-like RNA-binding domain. pNO40 is a nucleolar protein of unknown function with an N-terminal S1 RNA binding domain, a CCHC type zinc finger, and clusters of basic amino acids representing a potential nucleolar targeting signal.  pNO40 was identified through a yeast two-hybrid interaction screen of a human kidney cDNA library using the pinin (pnn) protein as bait. pNO40 is thought to play a role in ribosome maturation and/or biogenesis.
Probab=25.09  E-value=83  Score=19.44  Aligned_cols=17  Identities=24%  Similarity=0.345  Sum_probs=14.7

Q ss_pred             eeeCCCCeEEEEEceEE
Q psy11391         43 LFMDPGDKIKFRVTSEL   59 (112)
Q Consensus        43 l~~d~ge~IRFRV~~~~   59 (112)
                      -++..|++|+.||.+..
T Consensus        47 ~~~~~Gd~v~vkv~~vd   63 (73)
T cd05686          47 EVVDVGEKVWVKVIGRE   63 (73)
T ss_pred             hEECCCCEEEEEEEEEC
Confidence            35899999999998876


No 61 
>cd05706 S1_Rrp5_repeat_sc10 S1_Rrp5_repeat_sc10: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes S. cerevisiae S1 repeat 10 (sc10). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.
Probab=24.55  E-value=83  Score=19.07  Aligned_cols=16  Identities=19%  Similarity=0.021  Sum_probs=14.2

Q ss_pred             eeCCCCeEEEEEceEE
Q psy11391         44 FMDPGDKIKFRVTSEL   59 (112)
Q Consensus        44 ~~d~ge~IRFRV~~~~   59 (112)
                      .|..|+.|+++|.+..
T Consensus        47 ~~~~Gd~v~~~V~~~d   62 (73)
T cd05706          47 KFKKNDIVRACVLSVD   62 (73)
T ss_pred             ccCCCCEEEEEEEEEe
Confidence            5689999999999876


No 62 
>cd04472 S1_PNPase S1_PNPase: Polynucleotide phosphorylase (PNPase), ), S1-like RNA-binding domain. PNPase  is a polyribonucleotide nucleotidyl transferase that degrades mRNA. It is a trimeric multidomain protein. The C-terminus contains the S1 domain which binds ssRNA. This family is classified based on the S1 domain. PNPase nonspecifically removes the 3' nucleotides from mRNA, but is stalled by double-stranded RNA structures such as a stem-loop. Evidence shows that a minimum of 7-10 unpaired nucleotides at the 3' end, is required for PNPase degradation. It is suggested that PNPase also dephosphorylates the RNA 5' end. This additional activity may regulate the 5'-dependent activity of RNaseE in vivo.
Probab=24.23  E-value=81  Score=18.43  Aligned_cols=16  Identities=25%  Similarity=0.424  Sum_probs=14.1

Q ss_pred             eeCCCCeEEEEEceEE
Q psy11391         44 FMDPGDKIKFRVTSEL   59 (112)
Q Consensus        44 ~~d~ge~IRFRV~~~~   59 (112)
                      .|..|+.|+.+|.++.
T Consensus        44 ~~~~Gd~v~v~v~~~d   59 (68)
T cd04472          44 VLKVGDEVKVKVIEVD   59 (68)
T ss_pred             ccCCCCEEEEEEEEEC
Confidence            5799999999998876


No 63 
>PF01835 A2M_N:  MG2 domain;  InterPro: IPR002890 The proteinase-binding alpha-macroglobulins (A2M) [] are large glycoproteins found in the plasma of vertebrates, in the hemolymph of some invertebrates and in reptilian and avian egg white. A2M-like proteins are able to inhibit all four classes of proteinases by a 'trapping' mechanism. They have a peptide stretch, called the 'bait region', which contains specific cleavage sites for different proteinases. When a proteinase cleaves the bait region, a conformational change is induced in the protein, thus trapping the proteinase. The entrapped enzyme remains active against low molecular weight substrates, whilst its activity toward larger substrates is greatly reduced, due to steric hindrance. Following cleavage in the bait region, a thiol ester bond, formed between the side chains of a cysteine and a glutamine, is cleaved and mediates the covalent binding of the A2M-like protein to the proteinase. This family includes the N-terminal region of the alpha-2-macroglobulin family. The inhibitor domains belong to MEROPS inhibitor family I39.; GO: 0004866 endopeptidase inhibitor activity; PDB: 2B39_B 3KLS_B 3PRX_C 3KM9_B 3PVM_C 3CU7_A 4E0S_A 4A5W_A 4ACQ_C 2P9R_B ....
Probab=23.83  E-value=63  Score=20.85  Aligned_cols=18  Identities=22%  Similarity=0.468  Sum_probs=13.3

Q ss_pred             eeeeCCCCeEEEEEceEE
Q psy11391         42 DLFMDPGDKIKFRVTSEL   59 (112)
Q Consensus        42 ~l~~d~ge~IRFRV~~~~   59 (112)
                      +=-|..||+|+||+.-..
T Consensus         8 r~iYrPGetV~~~~~~~~   25 (99)
T PF01835_consen    8 RPIYRPGETVHFRAIVRD   25 (99)
T ss_dssp             SSEE-TTSEEEEEEEEEE
T ss_pred             ccCcCCCCEEEEEEEEec
Confidence            445789999999998444


No 64 
>PRK15458 tagatose 6-phosphate aldolase subunit KbaZ; Provisional
Probab=23.72  E-value=35  Score=29.52  Aligned_cols=23  Identities=22%  Similarity=0.151  Sum_probs=19.0

Q ss_pred             CCCCCeEEEeccceeeeCCCCceeeeeee
Q psy11391         82 TPKIPYSYGYYSLAVLRTQLLSPVRFQHV  110 (112)
Q Consensus        82 ~~~~Py~I~~~~~gs~~~~GLGpv~W~~~  110 (112)
                      ..++.-+|+      +.++=|||..|||.
T Consensus        78 ~gf~~~~ii------LGGDHLGPn~Wq~l  100 (426)
T PRK15458         78 LNFPQEALI------LGGDHLGPNRWQNL  100 (426)
T ss_pred             cCCChhhEE------eecCCCCCccccCC
Confidence            446666788      88999999999985


No 65 
>TIGR03834 EAGR_box EAGR box. The EAGR box (Enriched in Aromatic and Glycine Residues) is found in three different proteins of the Mycoplasma genitalium terminal organelle, which acts in both cytadherence and gliding motility. The presence of this domain in a genome predicts the Mycoplasma-type terminal organelle structure, gliding motility, and cytadherence. The EAGR box may occur from one to nine times in a protein.
Probab=23.10  E-value=59  Score=17.87  Aligned_cols=11  Identities=27%  Similarity=1.208  Sum_probs=7.5

Q ss_pred             CCCcccceEEEe
Q psy11391         22 RFDEKEQVWVWE   33 (112)
Q Consensus        22 ~fd~~e~~W~W~   33 (112)
                      +|| +.+.|+|.
T Consensus         8 ~yd-~~~~WiW~   18 (28)
T TIGR03834         8 YYD-ENGEWIWK   18 (28)
T ss_pred             cCc-CCCcEEEe
Confidence            356 45679995


No 66 
>cd05685 S1_Tex S1_Tex: The C-terminal S1 domain of a transcription accessory factor called Tex, which has been characterized in Bordetella pertussis and Pseudomonas aeruginosa. The tex gene is essential in Bortella pertusis and is named for its role in toxin expression. Tex has two functional domains, an N-terminal domain homologous to the Escherichia coli maltose repression protein, which is a poorly defined transcriptional factor, and a C-terminal S1 RNA-binding domain. Tex is found in prokaryotes, eukaryotes, and archaea.
Probab=22.85  E-value=92  Score=17.99  Aligned_cols=17  Identities=24%  Similarity=0.217  Sum_probs=14.7

Q ss_pred             eeeCCCCeEEEEEceEE
Q psy11391         43 LFMDPGDKIKFRVTSEL   59 (112)
Q Consensus        43 l~~d~ge~IRFRV~~~~   59 (112)
                      -.+..|+.|+.||.++.
T Consensus        43 ~~~~~Gd~v~v~i~~vd   59 (68)
T cd05685          43 DVVSVGDIVEVKVISID   59 (68)
T ss_pred             HhcCCCCEEEEEEEEEE
Confidence            35799999999998887


No 67 
>cd05690 S1_RPS1_repeat_ec5 S1_RPS1_repeat_ec5: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture consists of 4-6 tandem S1 domains. In some bacteria, the tandem S1 array is located C-terminal to a 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (HMBPP reductase) domain. While RPS1 is found primarily in bacteria, proteins with tandem RPS1-like domains have been identified in plants and humans, however these lack the N-terminal HMBPP reductase domain. This CD includes S1 repeat 5 (ec5) of the Escherichia coli RPS1. Autoantibodies to double-stranded DNA from patients with systemic lupus erythematosus cross-react with the human RPS1 homolog.
Probab=22.71  E-value=1.1e+02  Score=18.06  Aligned_cols=17  Identities=12%  Similarity=0.059  Sum_probs=14.8

Q ss_pred             eeeCCCCeEEEEEceEE
Q psy11391         43 LFMDPGDKIKFRVTSEL   59 (112)
Q Consensus        43 l~~d~ge~IRFRV~~~~   59 (112)
                      -.|..|+.|+.+|.++.
T Consensus        44 ~~~~~G~~v~v~v~~id   60 (69)
T cd05690          44 EIYKKGQEVEAVVLNID   60 (69)
T ss_pred             hEECCCCEEEEEEEEEE
Confidence            35799999999999887


No 68 
>PRK15267 subtilase cytotoxin subunit B-like protein; Provisional
Probab=22.34  E-value=53  Score=24.37  Aligned_cols=24  Identities=4%  Similarity=0.350  Sum_probs=21.9

Q ss_pred             ceeeeeCCCCeEEEEEceEEeeec
Q psy11391         40 KHDLFMDPGDKIKFRVTSELFTET   63 (112)
Q Consensus        40 ~~~l~~d~ge~IRFRV~~~~F~d~   63 (112)
                      ..++||-.|+.||.-+..-.|++.
T Consensus        88 qA~YyYtTG~~VRIYy~~nVWt~p  111 (141)
T PRK15267         88 TAKYYYTTGGDVRIYYKENVWRDP  111 (141)
T ss_pred             hhheeeecCceEEEEEcCCcccCc
Confidence            368999999999999999999986


No 69 
>cd05707 S1_Rrp5_repeat_sc11 S1_Rrp5_repeat_sc11: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes S. cerevisiae S1 repeat 11 (sc11). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.
Probab=22.15  E-value=97  Score=18.59  Aligned_cols=17  Identities=18%  Similarity=0.057  Sum_probs=14.3

Q ss_pred             eeeCCCCeEEEEEceEE
Q psy11391         43 LFMDPGDKIKFRVTSEL   59 (112)
Q Consensus        43 l~~d~ge~IRFRV~~~~   59 (112)
                      -.|..|+.|++||.+..
T Consensus        43 ~~~~~Gd~v~~~v~~~d   59 (68)
T cd05707          43 KRFKVGQLVKGKIVSID   59 (68)
T ss_pred             hccCCCCEEEEEEEEEe
Confidence            34689999999998876


No 70 
>TIGR02810 agaZ_gatZ D-tagatose-bisphosphate aldolase, class II, non-catalytic subunit. Aldolases specific for D-tagatose-bisphosphate occur in distinct pathways in Escherichia coli and other bacteria, one for the degradation of galactitol (formerly dulcitol) and one for degradation of N-acetyl-galactosamine and D-galactosamine. This family represents a protein of both systems that behaves as a non-catalytic subunit of D-tagatose-bisphosphate aldolase, required both for full activity and for good stability of the aldolase. Note that members of this protein family appear in public databases annotated as putative tagatose 6-phosphate kinases, possibly in error.
Probab=22.01  E-value=43  Score=28.98  Aligned_cols=23  Identities=22%  Similarity=0.109  Sum_probs=18.8

Q ss_pred             CCCCCeEEEeccceeeeCCCCceeeeeee
Q psy11391         82 TPKIPYSYGYYSLAVLRTQLLSPVRFQHV  110 (112)
Q Consensus        82 ~~~~Py~I~~~~~gs~~~~GLGpv~W~~~  110 (112)
                      ..++.-+|+      +.++=|||..|||.
T Consensus        74 ~gf~~~~ii------LggDHlGPn~Wq~l   96 (420)
T TIGR02810        74 IGFPRDRLI------LGGDHLGPNPWQHL   96 (420)
T ss_pred             cCCChhcEE------eecCCCCCccccCC
Confidence            446666788      88999999999985


No 71 
>KOG3409|consensus
Probab=21.86  E-value=1.7e+02  Score=22.78  Aligned_cols=13  Identities=38%  Similarity=0.629  Sum_probs=10.5

Q ss_pred             eCCCCeEEEEEce
Q psy11391         45 MDPGDKIKFRVTS   57 (112)
Q Consensus        45 ~d~ge~IRFRV~~   57 (112)
                      |.+|+.||=||.+
T Consensus       123 FrPgDiVlAkVis  135 (193)
T KOG3409|consen  123 FRPGDIVLAKVIS  135 (193)
T ss_pred             cCCCcEEEEEEee
Confidence            5588888888877


No 72 
>PF12306 PixA:  Inclusion body protein;  InterPro: IPR021087  This entry represents bacterial proteins that are typically between 173 and 191 amino acids in length. PixA is thought to be specifically produced in Xenorhabdus nematophila. It is an inclusion body protein []. This signature also identifies AidA. 
Probab=21.63  E-value=1.3e+02  Score=22.37  Aligned_cols=18  Identities=33%  Similarity=0.486  Sum_probs=15.5

Q ss_pred             eeeeeCCCCeEEEEEceE
Q psy11391         41 HDLFMDPGDKIKFRVTSE   58 (112)
Q Consensus        41 ~~l~~d~ge~IRFRV~~~   58 (112)
                      -.+-..+|+.||+|+.+.
T Consensus        58 L~i~a~~GD~Irwr~tSl   75 (172)
T PF12306_consen   58 LSIKANVGDTIRWRATSL   75 (172)
T ss_pred             eEEeccCCCEEEEEEEee
Confidence            457778999999999987


No 73 
>cd05704 S1_Rrp5_repeat_hs13 S1_Rrp5_repeat_hs13: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits.  Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions.  Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes H. sapiens S1 repeat 13 (hs13). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.
Probab=21.26  E-value=86  Score=19.48  Aligned_cols=16  Identities=19%  Similarity=0.322  Sum_probs=13.7

Q ss_pred             eeCCCCeEEEEEceEE
Q psy11391         44 FMDPGDKIKFRVTSEL   59 (112)
Q Consensus        44 ~~d~ge~IRFRV~~~~   59 (112)
                      +|..|+.||.+|.+..
T Consensus        48 ~~~~Gd~v~~kV~~~~   63 (72)
T cd05704          48 GFKPGKIVRCCILSKK   63 (72)
T ss_pred             hCCCCCEEEEEEEEec
Confidence            5689999999998874


No 74 
>cd04461 S1_Rrp5_repeat_hs8_sc7 S1_Rrp5_repeat_hs8_sc7: Rrp5 Homo sapiens S1 repeat 8 (hs8) and Saccharomyces cerevisiae S1 repeat 7 (sc7)-like domains. Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits.  Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in S. cerevisiae Rrp5 and 14 S1 repeats in H. sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes H. sapiens S1 repeat 8 and S. cerevisiae S1 repeat 7. Rrp5 is found in eukaryotes but not in prokaryotes or archaea.
Probab=21.03  E-value=96  Score=19.51  Aligned_cols=17  Identities=24%  Similarity=0.231  Sum_probs=15.1

Q ss_pred             eeeCCCCeEEEEEceEE
Q psy11391         43 LFMDPGDKIKFRVTSEL   59 (112)
Q Consensus        43 l~~d~ge~IRFRV~~~~   59 (112)
                      -.|..|++|++||.+..
T Consensus        57 ~~~~~Gd~v~vkV~~id   73 (83)
T cd04461          57 FGFKKGQSVTAKVTSVD   73 (83)
T ss_pred             HhcCCCCEEEEEEEEEc
Confidence            56889999999999876


Done!