Diaphorina citri psyllid: psy11398

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330------

MCTEISTLSKRSGNELDSWISQLEKKIKLPESKVKHLCKKAVELLGQEKNVIVVSTPVTACGDIHGQFEDLMYLFKKGGRIGQEKYLFLGDYVDRGEYSVECISLLFAYKIKYPNYVFLLRGNHECRSTSQVYGFYDECMRKYGGVTVWKNFTDAFDYLPLCALIDNRILCMHGGLSVKCLDIGEINMIDRVKACGSMEEILCMHGGLSVKCLDIGEINMIDRVKEVPYRGLMTDLLWSDPDDETENWKASNRGAGIIFGPAITSLYTHFNNLAYICRAHQVVKEGYGPTQAVDEVEAVFVLLDLRKDINDEGIQSSLLYSRNPRSRNRDNGLDND

cccccccccccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccccEEEcccEEEEccccccHHHHHHHHHHcccccccccEEccccccccccHHHHHHHHHHHHHcccccEEEEccccccccccccccHHHHHHHHcccHHHHHHHHHHcccccccEEEcccEEEECcccccccccccccccHHHHcccccccccEEEccccccccccHHHHHccccccccccccccccccccccccccccccccccccCEEEcHHHHHHHHHHccccEEEHHHHHHccccccccccccEEEEEEccccccccccccccEEEEEcccccccccccccccc

*****************SWISQLEKKIKLPESKVKHLCKKAVELLGQEKNVIVVSTPVTACGDIHGQFEDLMYLFKKGGRIGQEKYLFLGDYVDRGEYSVECISLLFAYKIKYPNYVFLLRGNHECRSTSQVYGFYDECMRKYGGVTVWKNFTDAFDYLPLCALIDNRILCMHGGLSVKCLDIGEINMIDRVKACGSMEEILCMHGGLSVKCLDIGEINMIDRVKEVPYRGLMTDLLWSDPDDETENWKASNRGAGIIFGPAITSLYTHFNNLAYICRAHQVVKEGYGPTQAVDEVEAVFVLLDLRKDINDEGIQSS*******************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Serine/threonine-protein phosphatase PP-X isozyme 2		confident	P48528
Serine/threonine-protein phosphatase PP2A-4 catalytic subunit		confident	A3C4N5
Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform	PP2A can modulate the activity of phosphorylase B kinase casein kinase 2, mitogen-stimulated S6 kinase, and MAP-2 kinase. Cooperates with SGOL2 to protect centromeric cohesin from separase-mediated cleavage in oocytes specifically during meiosis I. Activates RAF1 by dephosphorylating it at 'Ser-259'.	confident	P67777

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0000159 [CC]	protein phosphatase type 2A complex	probable	GO:0043234, GO:0008287, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0030289 [CC]	protein phosphatase 4 complex	probable	GO:0043234, GO:0008287, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0006470 [BP]	protein dephosphorylation	probable	GO:0071704, GO:0044267, GO:0044260, GO:0044238, GO:0016311, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0019538, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0051656 [BP]	establishment of organelle localization	probable	GO:0009987, GO:0044763, GO:0044699, GO:0008150, GO:0051234, GO:0051179, GO:0051640, GO:0051641
GO:0000164 [CC]	protein phosphatase type 1 complex	probable	GO:0005737, GO:0043234, GO:0008287, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0009894 [BP]	regulation of catabolic process	probable	GO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0009893 [BP]	positive regulation of metabolic process	probable	GO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0019953 [BP]	sexual reproduction	probable	GO:0008150, GO:0000003
GO:0043025 [CC]	neuronal cell body	probable	GO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0009888 [BP]	tissue development	probable	GO:0032502, GO:0048856, GO:0008150
GO:0007051 [BP]	spindle organization	probable	GO:0006996, GO:0007017, GO:0007010, GO:0071822, GO:0043933, GO:0071840, GO:0009987, GO:0016043, GO:0008150, GO:0000226, GO:0022402, GO:0044699, GO:0044763, GO:0007049
GO:0000235 [CC]	astral microtubule	probable	GO:0043229, GO:0043228, GO:0005874, GO:0043226, GO:0005876, GO:0005737, GO:0044446, GO:0005818, GO:0005819, GO:0044430, GO:0005856, GO:0015630, GO:0005881, GO:0043234, GO:0032991, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044422
GO:0007059 [BP]	chromosome segregation	probable	GO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0051129 [BP]	negative regulation of cellular component organization	probable	GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0048523, GO:0048519, GO:0051128, GO:0050789, GO:0044699
GO:1901991 [BP]	negative regulation of mitotic cell cycle phase transition	probable	GO:1901988, GO:0007346, GO:0051726, GO:0010564, GO:0050794, GO:0008150, GO:1901987, GO:0010948, GO:0065007, GO:1901990, GO:0048519, GO:0050789, GO:0048523
GO:0007126 [BP]	meiosis	probable	GO:0048610, GO:0051321, GO:0000003, GO:0009987, GO:0008150, GO:0022402, GO:0044699, GO:0044763, GO:0007049
GO:0010721 [BP]	negative regulation of cell development	probable	GO:0051093, GO:0050793, GO:0060284, GO:0050794, GO:0008150, GO:0045596, GO:0045595, GO:0065007, GO:0048519, GO:0050789, GO:0048523
GO:0006974 [BP]	response to DNA damage stimulus	probable	GO:0051716, GO:0050896, GO:0009987, GO:0006950, GO:0044763, GO:0033554, GO:0008150, GO:0044699
GO:0001932 [BP]	regulation of protein phosphorylation	probable	GO:0042325, GO:0032268, GO:0019220, GO:0080090, GO:0019222, GO:0060255, GO:0031323, GO:0051246, GO:0050794, GO:0051174, GO:0065007, GO:0031399, GO:0008150, GO:0050789
GO:0031034 [BP]	myosin filament assembly	probable	GO:0006996, GO:0022607, GO:0031033, GO:0030029, GO:0071822, GO:0070271, GO:0043933, GO:0071840, GO:0006461, GO:0030036, GO:0065003, GO:0044085, GO:0044763, GO:0016043, GO:0008150, GO:0034622, GO:0007010, GO:0009987, GO:0043623, GO:0044699
GO:0051301 [BP]	cell division	probable	GO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0006468 [BP]	protein phosphorylation	probable	GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0044765 [BP]	single-organism transport	probable	GO:0051234, GO:0006810, GO:0008150, GO:0051179, GO:0044699
GO:2000026 [BP]	regulation of multicellular organismal development	probable	GO:0050793, GO:0008150, GO:0065007, GO:0050789, GO:0051239
GO:0006417 [BP]	regulation of translation	probable	GO:0032268, GO:0009889, GO:0080090, GO:0019222, GO:0051246, GO:0060255, GO:0010608, GO:0031323, GO:2000112, GO:0050794, GO:0050789, GO:0010556, GO:0065007, GO:0031326, GO:0008150, GO:0010468
GO:0048522 [BP]	positive regulation of cellular process	probable	GO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0008104 [BP]	protein localization	probable	GO:0033036, GO:0008150, GO:0051179
GO:0000082 [BP]	G1/S transition of mitotic cell cycle	probable	GO:0051325, GO:0044699, GO:0000278, GO:0008150, GO:0009987, GO:0051329, GO:0044770, GO:0044772, GO:0022402, GO:0022403, GO:0044763, GO:0007049
GO:0007166 [BP]	cell surface receptor signaling pathway	probable	GO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0045786 [BP]	negative regulation of cell cycle	probable	GO:0051726, GO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0050789, GO:0048523
GO:0046983 [MF]	protein dimerization activity	probable	GO:0003674, GO:0005488, GO:0005515
GO:0044295 [CC]	axonal growth cone	probable	GO:0044464, GO:0044463, GO:0030427, GO:0030426, GO:0005623, GO:0030424, GO:0005575, GO:0097458, GO:0043005, GO:0033267, GO:0042995
GO:2001020 [BP]	regulation of response to DNA damage stimulus	probable	GO:0080134, GO:0080135, GO:0048583, GO:0050794, GO:0065007, GO:0008150, GO:0050789
GO:0017018 [MF]	myosin phosphatase activity	probable	GO:0016787, GO:0016791, GO:0004722, GO:0004721, GO:0042578, GO:0003824, GO:0003674, GO:0016788
GO:0002119 [BP]	nematode larval development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0019899 [MF]	enzyme binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0070887 [BP]	cellular response to chemical stimulus	probable	GO:0051716, GO:0050896, GO:0009987, GO:0008150, GO:0044763, GO:0042221, GO:0044699
GO:0009653 [BP]	anatomical structure morphogenesis	probable	GO:0032502, GO:0048856, GO:0008150
GO:0005814 [CC]	centriole	probable	GO:0005737, GO:0005856, GO:0015630, GO:0043228, GO:0005575, GO:0043232, GO:0005813, GO:0044464, GO:0044444, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0044430, GO:0044450, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0030182 [BP]	neuron differentiation	probable	GO:0032502, GO:0048699, GO:0009987, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0022008, GO:0007275, GO:0044699, GO:0048856
GO:0072357 [CC]	PTW/PP1 phosphatase complex	probable	GO:0043234, GO:0008287, GO:0032991, GO:0044464, GO:0005623, GO:0005575
GO:0048513 [BP]	organ development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0044702 [BP]	single organism reproductive process	probable	GO:0022414, GO:0008150, GO:0000003, GO:0044699
GO:0000780 [CC]	condensed nuclear chromosome, centromeric region	probable	GO:0031974, GO:0043229, GO:0043228, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0000793, GO:0000794, GO:0000775, GO:0043231, GO:0043232, GO:0000779, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0005938 [CC]	cell cortex	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0044424
GO:0005935 [CC]	cellular bud neck	probable	GO:0005575, GO:0044464, GO:0030427, GO:0005623, GO:0005933
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0070688 [CC]	MLL5-L complex	probable	GO:0031974, GO:0043229, GO:0005623, GO:0043227, GO:0043226, GO:0034708, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0035097, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0051171 [BP]	regulation of nitrogen compound metabolic process	probable	GO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0046580 [BP]	negative regulation of Ras protein signal transduction	probable	GO:0051056, GO:0009968, GO:0050794, GO:0009966, GO:0048583, GO:0048585, GO:0046578, GO:0051058, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0023051, GO:0048519, GO:0010646, GO:0050789, GO:0048523
GO:0051649 [BP]	establishment of localization in cell	probable	GO:0009987, GO:0008150, GO:0044763, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0000075 [BP]	cell cycle checkpoint	probable	GO:0051726, GO:0010564, GO:0050794, GO:0008150, GO:1901987, GO:0010948, GO:0065007, GO:1901988, GO:0048519, GO:0050789, GO:0048523
GO:0030425 [CC]	dendrite	probable	GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0031965 [CC]	nuclear membrane	probable	GO:0005575, GO:0005635, GO:0031090, GO:0005634, GO:0016020, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0018991 [BP]	oviposition	probable	GO:0032501, GO:0048609, GO:0032504, GO:0019098, GO:0050896, GO:0044706, GO:0007610, GO:0022414, GO:0008150, GO:0033057, GO:0000003, GO:0051704
GO:0065009 [BP]	regulation of molecular function	probable	GO:0008150, GO:0065007
GO:0009792 [BP]	embryo development ending in birth or egg hatching	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0019208 [MF]	phosphatase regulator activity	probable	GO:0030234, GO:0003674
GO:0007067 [BP]	mitosis	probable	GO:0006996, GO:0044699, GO:0000278, GO:0071840, GO:0009987, GO:0000280, GO:0016043, GO:0008150, GO:0022402, GO:0048285, GO:0044763, GO:0007049
GO:0040007 [BP]	growth	probable	GO:0008150
GO:0007015 [BP]	actin filament organization	probable	GO:0006996, GO:0007010, GO:0071822, GO:0030029, GO:0043933, GO:0071840, GO:0009987, GO:0030036, GO:0044763, GO:0016043, GO:0008150, GO:0044699
GO:0022604 [BP]	regulation of cell morphogenesis	probable	GO:0022603, GO:0050793, GO:0050794, GO:0065007, GO:0008150, GO:0051128, GO:0050789

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
3.-.-.-	Hydrolases.	probable
3.1.-.-	Acting on ester bonds.	probable
3.1.3.-	Phosphoric monoester hydrolases.	probable
3.1.3.16	Phosphoprotein phosphatase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1FJM, chain A
Confidence level:very confident
Coverage over the Query: 14-188,215-324
View the alignment between query and template
View the model in PyMOL

Template: 3N5U, chain A
Confidence level:very confident
Coverage over the Query: 6-166,199-287
View the alignment between query and template
View the model in PyMOL