BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy1140
         (142 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3SWN|C Chain C, Structure Of The Lsm657 Complex: An Assembly Intermediate
           Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|F Chain F, Structure Of The Lsm657 Complex: An Assembly Intermediate
           Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|O Chain O, Structure Of The Lsm657 Complex: An Assembly Intermediate
           Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|R Chain R, Structure Of The Lsm657 Complex: An Assembly Intermediate
           Of The Lsm1 7 And Lsm2 8 Rings
          Length = 117

 Score = 38.9 bits (89), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 33/61 (54%), Gaps = 3/61 (4%)

Query: 14  GTLKGFDQTINIILDDSHERVYSPTAGVEQVV---LGLHIIRGDNIKIPTKISSSTRSPV 70
           G LKGFDQ +N++LDD  E++ +P  G        LGL ++RG  + +   +  S   P 
Sbjct: 52  GILKGFDQLMNLVLDDVEEQLRNPEDGKLTGAIRKLGLVVVRGTTLVLIAPMDGSEEIPN 111

Query: 71  P 71
           P
Sbjct: 112 P 112


>pdb|3CW1|E Chain E, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|W Chain W, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|X Chain X, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|Y Chain Y, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3PGW|E Chain E, Crystal Structure Of Human U1 Snrnp
 pdb|3PGW|H Chain H, Crystal Structure Of Human U1 Snrnp
 pdb|2Y9A|E Chain E, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|L Chain L, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|S Chain S, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|E Chain E, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|L Chain L, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|S Chain S, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|E Chain E, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|L Chain L, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|S Chain S, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|E Chain E, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|L Chain L, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|S Chain S, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|3S6N|E Chain E, Crystal Structure Of The Gemin2-Binding Domain Of Smn,
          Gemin2 In Complex With Smd1D2FEG FROM HUMAN
 pdb|4F7U|E Chain E, Macromolecular Machine 6
 pdb|4F7U|H Chain H, Macromolecular Machine 6
 pdb|1VU2|C Chain C, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|K Chain K, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|S Chain S, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|AA Chain a, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|II Chain i, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|QQ Chain q, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|YY Chain y, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|C Chain C, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|K Chain K, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|S Chain S, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|AA Chain a, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|II Chain i, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|QQ Chain q, The 8s Snrnp Assembly Intermediate
 pdb|4F77|K Chain K, The 8s Snrnp Assembly Intermediate
 pdb|4F77|C Chain C, The 8s Snrnp Assembly Intermediate
 pdb|4F77|S Chain S, The 8s Snrnp Assembly Intermediate
 pdb|4F77|AA Chain a, The 8s Snrnp Assembly Intermediate
 pdb|4F77|II Chain i, The 8s Snrnp Assembly Intermediate
 pdb|4F77|QQ Chain q, The 8s Snrnp Assembly Intermediate
 pdb|4F77|YY Chain y, The 8s Snrnp Assembly Intermediate
          Length = 92

 Score = 38.5 bits (88), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 35/52 (67%), Gaps = 3/52 (5%)

Query: 13 QGTLKGFDQTINIILDDSHERVYSPTAGVEQVVLGLHIIRGDNIKIPTKISS 64
          +G + GFD+ +N++LDD+ E ++S T   +Q  LG  +++GDNI +   +S+
Sbjct: 44 EGCIIGFDEYMNLVLDDAEE-IHSKTKSRKQ--LGRIMLKGDNITLLQSVSN 92


>pdb|4EMK|C Chain C, Crystal Structure Of Splsm567
          Length = 113

 Score = 36.6 bits (83), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 31/61 (50%), Gaps = 3/61 (4%)

Query: 14  GTLKGFDQTINIILDDSHERVYSPTAGVEQVV---LGLHIIRGDNIKIPTKISSSTRSPV 70
           G LKGFDQ  N++LDD  E++ +P  G        LGL ++RG  + +      S   P 
Sbjct: 48  GILKGFDQLXNLVLDDVEEQLRNPEDGKLTGAIRKLGLVVVRGTTLVLIAPXDGSEEIPN 107

Query: 71  P 71
           P
Sbjct: 108 P 108


>pdb|1D3B|B Chain B, Crystal Structure Of The D3b Subcomplex Of The Human
          Core Snrnp Domain At 2.0a Resolution
 pdb|1D3B|D Chain D, Crystal Structure Of The D3b Subcomplex Of The Human
          Core Snrnp Domain At 2.0a Resolution
 pdb|1D3B|F Chain F, Crystal Structure Of The D3b Subcomplex Of The Human
          Core Snrnp Domain At 2.0a Resolution
 pdb|1D3B|H Chain H, Crystal Structure Of The D3b Subcomplex Of The Human
          Core Snrnp Domain At 2.0a Resolution
 pdb|1D3B|J Chain J, Crystal Structure Of The D3b Subcomplex Of The Human
          Core Snrnp Domain At 2.0a Resolution
 pdb|1D3B|L Chain L, Crystal Structure Of The D3b Subcomplex Of The Human
          Core Snrnp Domain At 2.0a Resolution
          Length = 91

 Score = 35.4 bits (80), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 34/66 (51%), Gaps = 11/66 (16%)

Query: 12 FQGTLKGFDQTINIILDDSHE-RVYSPTAGV-----EQVVLGLHIIRGDNIKIPTKISSS 65
          F GT K FD+ +N+IL D  E R   P         E+ VLGL ++RG+N+     +S +
Sbjct: 27 FIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENL-----VSMT 81

Query: 66 TRSPVP 71
             P P
Sbjct: 82 VEGPPP 87


>pdb|2Y9A|A Chain A, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|H Chain H, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|O Chain O, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|A Chain A, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|H Chain H, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|O Chain O, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|A Chain A, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|H Chain H, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|O Chain O, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|A Chain A, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|H Chain H, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|O Chain O, Structure Of The Spliceosomal U4 Snrnp Core Domain
          Length = 95

 Score = 35.4 bits (80), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 34/66 (51%), Gaps = 11/66 (16%)

Query: 12 FQGTLKGFDQTINIILDDSHE-RVYSPTAGV-----EQVVLGLHIIRGDNIKIPTKISSS 65
          F GT K FD+ +N+IL D  E R   P         E+ VLGL ++RG+N+     +S +
Sbjct: 27 FIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENL-----VSMT 81

Query: 66 TRSPVP 71
             P P
Sbjct: 82 VEGPPP 87


>pdb|1TH7|A Chain A, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|B Chain B, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|C Chain C, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|D Chain D, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|E Chain E, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|F Chain F, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|G Chain G, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|H Chain H, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|I Chain I, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|J Chain J, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|K Chain K, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|L Chain L, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|M Chain M, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|N Chain N, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
          Length = 81

 Score = 35.0 bits (79), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 29/44 (65%), Gaps = 4/44 (9%)

Query: 13 QGTLKGFDQTINIILDDSHERVYSPTAGVEQVVLGLHIIRGDNI 56
          +G L+ +DQ +N++L DS E + S  +G +   LG  +IRGDN+
Sbjct: 33 RGMLRSYDQHMNLVLSDS-EEIQSDGSGKK---LGTIVIRGDNV 72


>pdb|3PGW|B Chain B, Crystal Structure Of Human U1 Snrnp
 pdb|3PGW|Q Chain Q, Crystal Structure Of Human U1 Snrnp
          Length = 231

 Score = 34.7 bits (78), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 34/67 (50%), Gaps = 11/67 (16%)

Query: 11 FFQGTLKGFDQTINIILDDSHE-RVYSPTAGV-----EQVVLGLHIIRGDNIKIPTKISS 64
           F GT K FD+ +N+IL D  E R   P         E+ VLGL ++RG+N+     +S 
Sbjct: 26 IFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENL-----VSM 80

Query: 65 STRSPVP 71
          +   P P
Sbjct: 81 TVEGPPP 87


>pdb|3CW1|A Chain A, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|H Chain H, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|I Chain I, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|J Chain J, Crystal Structure Of Human Spliceosomal U1 Snrnp
          Length = 174

 Score = 34.3 bits (77), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 34/67 (50%), Gaps = 11/67 (16%)

Query: 11 FFQGTLKGFDQTINIILDDSHE-RVYSPTAGV-----EQVVLGLHIIRGDNIKIPTKISS 64
           F GT K FD+ +N+IL D  E R   P         E+ VLGL ++RG+N+     +S 
Sbjct: 26 IFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENL-----VSM 80

Query: 65 STRSPVP 71
          +   P P
Sbjct: 81 TVEGPPP 87


>pdb|1LOJ|A Chain A, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|B Chain B, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|C Chain C, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|D Chain D, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|E Chain E, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|F Chain F, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|G Chain G, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|H Chain H, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|I Chain I, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|J Chain J, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|K Chain K, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|L Chain L, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|M Chain M, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|N Chain N, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
          Length = 87

 Score = 32.7 bits (73), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 26/45 (57%), Gaps = 4/45 (8%)

Query: 12 FQGTLKGFDQTINIILDDSHERVYSPTAGVEQVVLGLHIIRGDNI 56
          F+G LK FD  +N++L+D+ E       G     LG  +IRGDNI
Sbjct: 36 FRGVLKSFDLHMNLVLNDAEE----LEDGEVTRRLGTVLIRGDNI 76


>pdb|1JBM|A Chain A, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|B Chain B, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|C Chain C, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|D Chain D, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|E Chain E, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|F Chain F, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|G Chain G, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
          Length = 86

 Score = 32.7 bits (73), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 26/45 (57%), Gaps = 4/45 (8%)

Query: 12 FQGTLKGFDQTINIILDDSHERVYSPTAGVEQVVLGLHIIRGDNI 56
          F+G LK FD  +N++L+D+ E       G     LG  +IRGDNI
Sbjct: 36 FRGVLKSFDLHMNLVLNDAEE----LEDGEVTRRLGTVLIRGDNI 76


>pdb|1JRI|A Chain A, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|B Chain B, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|C Chain C, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|D Chain D, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|E Chain E, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|F Chain F, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|G Chain G, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|H Chain H, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|I Chain I, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|J Chain J, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|K Chain K, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|L Chain L, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|M Chain M, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|N Chain N, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit
          Length = 85

 Score = 32.7 bits (73), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 26/45 (57%), Gaps = 4/45 (8%)

Query: 12 FQGTLKGFDQTINIILDDSHERVYSPTAGVEQVVLGLHIIRGDNI 56
          F+G LK FD  +N++L+D+ E       G     LG  +IRGDNI
Sbjct: 36 FRGVLKSFDLHMNLVLNDAEE----LEDGEVTRRLGTVLIRGDNI 76


>pdb|1I81|A Chain A, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|B Chain B, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|C Chain C, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|D Chain D, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|E Chain E, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|F Chain F, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|G Chain G, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|A Chain A, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|B Chain B, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|C Chain C, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|D Chain D, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|E Chain E, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|F Chain F, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|G Chain G, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
          Length = 83

 Score = 32.3 bits (72), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 26/45 (57%), Gaps = 4/45 (8%)

Query: 12 FQGTLKGFDQTINIILDDSHERVYSPTAGVEQVVLGLHIIRGDNI 56
          F+G LK FD  +N++L+D+ E       G     LG  +IRGDNI
Sbjct: 38 FRGVLKSFDLHMNLVLNDAEE----LEDGEVTRRLGTVLIRGDNI 78


>pdb|3CW1|G Chain G, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|3 Chain 3, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|4 Chain 4, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|5 Chain 5, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3PGW|G Chain G, Crystal Structure Of Human U1 Snrnp
 pdb|3PGW|J Chain J, Crystal Structure Of Human U1 Snrnp
 pdb|2Y9A|G Chain G, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|N Chain N, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|U Chain U, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|G Chain G, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|N Chain N, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|U Chain U, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|G Chain G, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|N Chain N, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|U Chain U, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|G Chain G, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|N Chain N, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|U Chain U, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|3S6N|G Chain G, Crystal Structure Of The Gemin2-Binding Domain Of Smn,
          Gemin2 In Complex With Smd1D2FEG FROM HUMAN
 pdb|4F7U|G Chain G, Macromolecular Machine 6
 pdb|4F7U|J Chain J, Macromolecular Machine 6
 pdb|1VU2|H Chain H, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|P Chain P, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|X Chain X, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|FF Chain f, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|NN Chain n, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|VV Chain v, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|4 Chain 4, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|H Chain H, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|P Chain P, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|X Chain X, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|FF Chain f, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|NN Chain n, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|VV Chain v, The 8s Snrnp Assembly Intermediate
 pdb|4F77|P Chain P, The 8s Snrnp Assembly Intermediate
 pdb|4F77|H Chain H, The 8s Snrnp Assembly Intermediate
 pdb|4F77|X Chain X, The 8s Snrnp Assembly Intermediate
 pdb|4F77|FF Chain f, The 8s Snrnp Assembly Intermediate
 pdb|4F77|NN Chain n, The 8s Snrnp Assembly Intermediate
 pdb|4F77|VV Chain v, The 8s Snrnp Assembly Intermediate
 pdb|4F77|4 Chain 4, The 8s Snrnp Assembly Intermediate
          Length = 76

 Score = 32.0 bits (71), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 30/44 (68%), Gaps = 4/44 (9%)

Query: 13 QGTLKGFDQTINIILDDSHERVYSPTAGVEQVVLGLHIIRGDNI 56
          QG L+GFD  +N+++D   E V   T+G +Q  +G+ +IRG++I
Sbjct: 28 QGILRGFDPFMNLVID---ECVEMATSG-QQNNIGMVVIRGNSI 67


>pdb|2FWK|A Chain A, Crystal Structure Of Cryptosporidium Parvum U6 Snrna-
          Associated Sm-Like Protein Lsm5
 pdb|2FWK|B Chain B, Crystal Structure Of Cryptosporidium Parvum U6 Snrna-
          Associated Sm-Like Protein Lsm5
 pdb|3PGG|A Chain A, Crystal Structure Of Cryptosporidium Parvum U6
          Snrna-Associated Sm- Like Protein Lsm5
 pdb|3PGG|B Chain B, Crystal Structure Of Cryptosporidium Parvum U6
          Snrna-Associated Sm- Like Protein Lsm5
          Length = 121

 Score = 31.6 bits (70), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 21/36 (58%), Gaps = 2/36 (5%)

Query: 12 FQGTLKGFDQTINIILDDSHERVYSPTAGVEQVVLG 47
          F G L+GFD+ +N++LDD  E  Y   A  E +  G
Sbjct: 51 FSGVLRGFDEYVNMVLDDVQE--YGFKADEEDISGG 84


>pdb|3SWN|A Chain A, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|D Chain D, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|P Chain P, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|S Chain S, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
          Length = 82

 Score = 30.0 bits (66), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 18/32 (56%), Gaps = 2/32 (6%)

Query: 12 FQGTLKGFDQTINIILDDSHERVYSPTAGVEQ 43
          F GTL GFD  +NI+L D  E  Y    GV +
Sbjct: 31 FAGTLVGFDDYVNIVLKDVTE--YDTVTGVTE 60


>pdb|1I8F|A Chain A, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|B Chain B, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|C Chain C, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|D Chain D, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|E Chain E, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|F Chain F, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|G Chain G, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1LNX|A Chain A, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|B Chain B, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|C Chain C, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|D Chain D, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|E Chain E, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|F Chain F, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|G Chain G, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
          Length = 81

 Score = 29.3 bits (64), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 13/48 (27%)

Query: 13 QGTLKGFDQTINIILDDSHE----RVYSPTAGVEQVVLGLHIIRGDNI 56
          +G L+ FDQ +N++L+D+ E     VY           G  ++RG+N+
Sbjct: 35 RGILRSFDQHVNLLLEDAEEIIDGNVYKR---------GTMVVRGENV 73


>pdb|4EMK|A Chain A, Crystal Structure Of Splsm567
          Length = 94

 Score = 28.9 bits (63), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 18/32 (56%), Gaps = 2/32 (6%)

Query: 12 FQGTLKGFDQTINIILDDSHERVYSPTAGVEQ 43
          F GTL GFD  +NI+L D  E  Y    GV +
Sbjct: 43 FAGTLVGFDDYVNIVLKDVTE--YDTVTGVTE 72


>pdb|3BW1|A Chain A, Crystal Structure Of Homomeric Yeast Lsm3 Exhibiting
          Novel Octameric Ring Organisation
 pdb|3BW1|B Chain B, Crystal Structure Of Homomeric Yeast Lsm3 Exhibiting
          Novel Octameric Ring Organisation
          Length = 96

 Score = 27.7 bits (60), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 15/22 (68%)

Query: 14 GTLKGFDQTINIILDDSHERVY 35
          GTL+ FD   NI+L D+ E +Y
Sbjct: 35 GTLQAFDSHCNIVLSDAVETIY 56


>pdb|1I5L|A Chain A, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|B Chain B, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|C Chain C, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|D Chain D, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|E Chain E, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|F Chain F, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|G Chain G, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|H Chain H, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|I Chain I, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|J Chain J, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|K Chain K, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|L Chain L, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|M Chain M, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|N Chain N, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I4K|A Chain A, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|B Chain B, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|C Chain C, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|D Chain D, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|E Chain E, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|F Chain F, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|G Chain G, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|H Chain H, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|I Chain I, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|J Chain J, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|K Chain K, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|L Chain L, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|M Chain M, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|N Chain N, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|O Chain O, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|P Chain P, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|Q Chain Q, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|R Chain R, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|S Chain S, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|T Chain T, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|U Chain U, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|V Chain V, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|W Chain W, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|X Chain X, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|Y Chain Y, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|Z Chain Z, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|1 Chain 1, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|2 Chain 2, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
          Length = 77

 Score = 26.9 bits (58), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 4/45 (8%)

Query: 12 FQGTLKGFDQTINIILDDSHERVYSPTAGVEQVVLGLHIIRGDNI 56
          F+GTL G+D  +N++L D+ E        V +V  G  +IRGD +
Sbjct: 27 FRGTLDGYDIHMNLVLLDAEEIQNGEV--VRKV--GSVVIRGDTV 67


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.325    0.140    0.424 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,985,663
Number of Sequences: 62578
Number of extensions: 148295
Number of successful extensions: 345
Number of sequences better than 100.0: 21
Number of HSP's better than 100.0 without gapping: 17
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 323
Number of HSP's gapped (non-prelim): 21
length of query: 142
length of database: 14,973,337
effective HSP length: 89
effective length of query: 53
effective length of database: 9,403,895
effective search space: 498406435
effective search space used: 498406435
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 46 (22.3 bits)