BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy11430
(181 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3ZZF|A Chain A, Crystal Structure Of The Amino Acid Kinase Domain From
Saccharomyces Cerevisiae Acetylglutamate Kinase
Complexed With Its Substrate N-Acetylglutamate
pdb|3ZZF|B Chain B, Crystal Structure Of The Amino Acid Kinase Domain From
Saccharomyces Cerevisiae Acetylglutamate Kinase
Complexed With Its Substrate N-Acetylglutamate
pdb|3ZZF|C Chain C, Crystal Structure Of The Amino Acid Kinase Domain From
Saccharomyces Cerevisiae Acetylglutamate Kinase
Complexed With Its Substrate N-Acetylglutamate
pdb|3ZZF|D Chain D, Crystal Structure Of The Amino Acid Kinase Domain From
Saccharomyces Cerevisiae Acetylglutamate Kinase
Complexed With Its Substrate N-Acetylglutamate
pdb|3ZZG|A Chain A, Crystal Structure Of The Amino Acid Kinase Domain From
Saccharomyces Cerevisiae Acetylglutamate Kinase Without
Ligands
pdb|3ZZG|B Chain B, Crystal Structure Of The Amino Acid Kinase Domain From
Saccharomyces Cerevisiae Acetylglutamate Kinase Without
Ligands
pdb|3ZZG|C Chain C, Crystal Structure Of The Amino Acid Kinase Domain From
Saccharomyces Cerevisiae Acetylglutamate Kinase Without
Ligands
pdb|3ZZG|D Chain D, Crystal Structure Of The Amino Acid Kinase Domain From
Saccharomyces Cerevisiae Acetylglutamate Kinase Without
Ligands
pdb|3ZZH|A Chain A, Crystal Structure Of The Amino Acid Kinase Domain From
Saccharomyces Cerevisiae Acetylglutamate Kinase In
Complex With Its Feed-Back Inhibitor L-Arginine
pdb|3ZZH|B Chain B, Crystal Structure Of The Amino Acid Kinase Domain From
Saccharomyces Cerevisiae Acetylglutamate Kinase In
Complex With Its Feed-Back Inhibitor L-Arginine
pdb|3ZZH|C Chain C, Crystal Structure Of The Amino Acid Kinase Domain From
Saccharomyces Cerevisiae Acetylglutamate Kinase In
Complex With Its Feed-Back Inhibitor L-Arginine
pdb|3ZZH|D Chain D, Crystal Structure Of The Amino Acid Kinase Domain From
Saccharomyces Cerevisiae Acetylglutamate Kinase In
Complex With Its Feed-Back Inhibitor L-Arginine
Length = 307
Score = 28.1 bits (61), Expect = 2.8, Method: Compositional matrix adjust.
Identities = 17/47 (36%), Positives = 24/47 (51%)
Query: 44 QILGDEKIKRIKSKAVWVCASVSQQDTAYMKKASAIRLDSTQEVTSC 90
Q+L + KR + + SVSQQ A +K AI D+ E+ SC
Sbjct: 24 QLLNNISTKREVEQYLKYFTSVSQQQFAVIKVGGAIISDNLHELASC 70
>pdb|1N3L|A Chain A, Crystal Structure Of A Human Aminoacyl-Trna Synthetase
Cytokine
pdb|1Q11|A Chain A, Crystal Structure Of An Active Fragment Of Human
Tyrosyl-Trna Synthetase With Tyrosinol
Length = 372
Score = 27.7 bits (60), Expect = 3.5, Method: Compositional matrix adjust.
Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 6/55 (10%)
Query: 40 KNMTQILGDEKIKRI----KSKAVWVCASVSQQDTAYMKKASAIR--LDSTQEVT 88
+N+ ++LG+EK+K I + K W A+ + AY S I L + EVT
Sbjct: 16 RNLQEVLGEEKLKEILKERELKIYWGTATTGKPHVAYFVPMSKIADFLKAGCEVT 70
>pdb|3ZZI|A Chain A, Crystal Structure Of A Tetrameric Acetylglutamate Kinase
From Saccharomyces Cerevisiae
pdb|3ZZI|B Chain B, Crystal Structure Of A Tetrameric Acetylglutamate Kinase
From Saccharomyces Cerevisiae
pdb|3ZZI|C Chain C, Crystal Structure Of A Tetrameric Acetylglutamate Kinase
From Saccharomyces Cerevisiae
pdb|3ZZI|D Chain D, Crystal Structure Of A Tetrameric Acetylglutamate Kinase
From Saccharomyces Cerevisiae
pdb|3ZZI|E Chain E, Crystal Structure Of A Tetrameric Acetylglutamate Kinase
From Saccharomyces Cerevisiae
pdb|3ZZI|F Chain F, Crystal Structure Of A Tetrameric Acetylglutamate Kinase
From Saccharomyces Cerevisiae
pdb|3ZZI|G Chain G, Crystal Structure Of A Tetrameric Acetylglutamate Kinase
From Saccharomyces Cerevisiae
pdb|3ZZI|H Chain H, Crystal Structure Of A Tetrameric Acetylglutamate Kinase
From Saccharomyces Cerevisiae
pdb|4AB7|A Chain A, Crystal Structure Of A Tetrameric Acetylglutamate Kinase
From Saccharomyces Cerevisiae Complexed With Its
Substrate N-Acetylglutamate
pdb|4AB7|B Chain B, Crystal Structure Of A Tetrameric Acetylglutamate Kinase
From Saccharomyces Cerevisiae Complexed With Its
Substrate N-Acetylglutamate
pdb|4AB7|C Chain C, Crystal Structure Of A Tetrameric Acetylglutamate Kinase
From Saccharomyces Cerevisiae Complexed With Its
Substrate N-Acetylglutamate
pdb|4AB7|D Chain D, Crystal Structure Of A Tetrameric Acetylglutamate Kinase
From Saccharomyces Cerevisiae Complexed With Its
Substrate N-Acetylglutamate
pdb|4AB7|E Chain E, Crystal Structure Of A Tetrameric Acetylglutamate Kinase
From Saccharomyces Cerevisiae Complexed With Its
Substrate N-Acetylglutamate
pdb|4AB7|F Chain F, Crystal Structure Of A Tetrameric Acetylglutamate Kinase
From Saccharomyces Cerevisiae Complexed With Its
Substrate N-Acetylglutamate
pdb|4AB7|G Chain G, Crystal Structure Of A Tetrameric Acetylglutamate Kinase
From Saccharomyces Cerevisiae Complexed With Its
Substrate N-Acetylglutamate
pdb|4AB7|H Chain H, Crystal Structure Of A Tetrameric Acetylglutamate Kinase
From Saccharomyces Cerevisiae Complexed With Its
Substrate N-Acetylglutamate
Length = 464
Score = 27.7 bits (60), Expect = 3.5, Method: Compositional matrix adjust.
Identities = 17/47 (36%), Positives = 24/47 (51%)
Query: 44 QILGDEKIKRIKSKAVWVCASVSQQDTAYMKKASAIRLDSTQEVTSC 90
Q+L + KR + + SVSQQ A +K AI D+ E+ SC
Sbjct: 24 QLLNNISTKREVEQYLKYFTSVSQQQFAVIKVGGAIISDNLHELASC 70
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.317 0.132 0.387
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,240,825
Number of Sequences: 62578
Number of extensions: 200533
Number of successful extensions: 546
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 543
Number of HSP's gapped (non-prelim): 6
length of query: 181
length of database: 14,973,337
effective HSP length: 93
effective length of query: 88
effective length of database: 9,153,583
effective search space: 805515304
effective search space used: 805515304
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 48 (23.1 bits)