Query         psy11495
Match_columns 81
No_of_seqs    49 out of 51
Neff          3.4 
Searched_HMMs 46136
Date          Fri Aug 16 19:51:59 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy11495.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/11495hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0891|consensus               97.7 2.3E-05   5E-10   74.0   3.4   47    6-61    211-257 (2341)
  2 TIGR03761 ICE_PFL4669 integrat  48.2      14 0.00029   28.1   1.9   40   10-67    155-194 (216)
  3 PF07903 PaRep2a:  PaRep2a prot  46.6     9.8 0.00021   27.2   0.9   12   10-21      5-16  (122)
  4 PF07079 DUF1347:  Protein of u  40.9      20 0.00043   31.0   2.0   32   13-46    507-538 (549)
  5 TIGR03706 exo_poly_only exopol  33.0      90   0.002   23.5   4.3   28   29-56    251-280 (300)
  6 PF10211 Ax_dynein_light:  Axon  30.7      38 0.00082   24.6   1.8   13   10-22     61-73  (189)
  7 KOG3612|consensus               27.9      36 0.00078   29.8   1.5   21    2-22    519-539 (588)
  8 TIGR03486 cas_csx13_C CRISPR-a  27.5 1.4E+02  0.0031   21.8   4.4   60    9-70     49-113 (152)
  9 PF13041 PPR_2:  PPR repeat fam  26.6      82  0.0018   17.0   2.4   25   17-43     19-43  (50)
 10 PF00763 THF_DHG_CYH:  Tetrahyd  26.4     9.1  0.0002   25.5  -1.8   16   30-45     78-93  (117)
 11 PF09403 FadA:  Adhesion protei  25.7      50  0.0011   23.1   1.7   28    2-29     76-103 (126)
 12 PF01707 Peptidase_C9:  Peptida  24.2      42 0.00092   25.7   1.2   15   36-50     79-93  (202)
 13 PF10274 ParcG:  Parkin co-regu  22.7 1.3E+02  0.0027   22.4   3.4   38   34-71     90-128 (183)
 14 PRK09547 nhaB sodium/proton an  22.5      41  0.0009   28.6   0.9   12    7-18     15-26  (513)
 15 KOG4001|consensus               22.4      55  0.0012   25.8   1.5   23   11-34    127-149 (259)
 16 PF07527 Hairy_orange:  Hairy O  21.2      75  0.0016   17.7   1.6   15   13-27      7-21  (43)
 17 PRK11031 guanosine pentaphosph  21.2 1.8E+02   0.004   23.8   4.4   45   12-56    235-281 (496)
 18 PRK01919 tatB sec-independent   21.0      43 0.00093   24.9   0.6   12    4-15    128-139 (169)

No 1  
>KOG0891|consensus
Probab=97.73  E-value=2.3e-05  Score=73.98  Aligned_cols=47  Identities=43%  Similarity=0.538  Sum_probs=42.0

Q ss_pred             hhchhHHHHHHHHHHHhchhhhhhhhccCccchhhhhHHHHHHHHHhccChHHHHH
Q psy11495          6 EKSAYATYRLCFEEAMSGLDEVFSREKGVNREDRIHGSLLVLNELLRVSNVTWERT   61 (81)
Q Consensus         6 e~qk~qWY~~Cy~EA~~~f~e~~~keKglnRDDRiHG~LLILNELLR~sn~~~Er~   61 (81)
                      .+.+++||++||++|.-+|.....+         +||++|++|||+|+++.-+++.
T Consensus       211 ~~~~~~~~~rcvd~~~~~l~~~~~~---------~~~~~~~~~e~~~~~~~~~~~~  257 (2341)
T KOG0891|consen  211 AKLKPQWYQRCVDEARHGLSSDGVK---------IHASLLVYNELLRISDPFLEKY  257 (2341)
T ss_pred             chhhhHHHHHHHHhccccccchHHH---------hhhHHHHHHHHHHHHHHHHHhh
Confidence            3679999999999999999887664         9999999999999999998653


No 2  
>TIGR03761 ICE_PFL4669 integrating conjugative element protein, PFL_4669 family. Members of this protein family, such as PFL4669, are found in integrating conjugative elements (ICE) of the PFGI-1 class as in Pseudomonas fluorescens.
Probab=48.24  E-value=14  Score=28.06  Aligned_cols=40  Identities=25%  Similarity=0.217  Sum_probs=28.7

Q ss_pred             hHHHHHHHHHHHhchhhhhhhhccCccchhhhhHHHHHHHHHhccChHHHHHHHHHHh
Q psy11495         10 YATYRLCFEEAMSGLDEVFSREKGVNREDRIHGSLLVLNELLRVSNVTWERTYEDLMN   67 (81)
Q Consensus        10 ~qWY~~Cy~EA~~~f~e~~~keKglnRDDRiHG~LLILNELLR~sn~~~Er~r~el~~   67 (81)
                      ..|.+++|..+.+.      +--|+||||..++            |+.|.+..+.|.+
T Consensus       155 ~~~vR~vf~~~~~y------r~~gvtR~D~~~~------------n~~a~~Aie~~G~  194 (216)
T TIGR03761       155 AHLIRRLFGLAQRY------RHSGVTRDDFAAN------------NARARKAIERFGE  194 (216)
T ss_pred             HHHHHHHHHHHHhh------hcCCCCHHHHHhC------------CHHHHHHHHHcCC
Confidence            46788899999887      5678999998654            5556655555543


No 3  
>PF07903 PaRep2a:  PaRep2a protein;  InterPro: IPR012490 This is a family of proteins expressed by the crenarchaeon Pyrobaculum aerophilum. The members are highly variable in length and level of conservation. The presence of numerous frameshifts and internal stop codons in multiple alignments are thought to indicate that most family members are no longer functional []. 
Probab=46.62  E-value=9.8  Score=27.16  Aligned_cols=12  Identities=33%  Similarity=0.592  Sum_probs=10.2

Q ss_pred             hHHHHHHHHHHH
Q psy11495         10 YATYRLCFEEAM   21 (81)
Q Consensus        10 ~qWY~~Cy~EA~   21 (81)
                      .+||+|||.+..
T Consensus         5 ~~w~~~cf~~~~   16 (122)
T PF07903_consen    5 AQWYRQCFGRTP   16 (122)
T ss_pred             HHHHHHHcCCCC
Confidence            489999998874


No 4  
>PF07079 DUF1347:  Protein of unknown function (DUF1347);  InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length. Members of this family are highly conserved and seem to be specific to Chlamydia species. The function of this family is unknown.
Probab=40.87  E-value=20  Score=31.02  Aligned_cols=32  Identities=19%  Similarity=0.311  Sum_probs=26.3

Q ss_pred             HHHHHHHHHhchhhhhhhhccCccchhhhhHHHH
Q psy11495         13 YRLCFEEAMSGLDEVFSREKGVNREDRIHGSLLV   46 (81)
Q Consensus        13 Y~~Cy~EA~~~f~e~~~keKglnRDDRiHG~LLI   46 (81)
                      |..||+||...|.+.+..++  .||-.||-+|++
T Consensus       507 e~k~Y~eA~~~l~~LP~n~~--~~dskvqKAl~l  538 (549)
T PF07079_consen  507 ENKRYQEAWEYLQKLPPNER--MRDSKVQKALAL  538 (549)
T ss_pred             HHhhHHHHHHHHHhCCCchh--hHHHHHHHHHHH
Confidence            45699999999999887554  688899998876


No 5  
>TIGR03706 exo_poly_only exopolyphosphatase. It appears that a single enzyme may act as both exopolyphosphatase (Ppx) and guanosine pentaphosphate phosphohydrolase (GppA) in a number of species. Members of the seed alignment use to define this exception-level model are encoded adjacent to a polyphosphate kinase 1 gene, and the trusted cutoff is set high enough (425) that no genome has a second hit. Therefore all members may be presumed to at least share exopolyphospatase activity, and may lack GppA activity. GppA acts in the stringent response.
Probab=32.98  E-value=90  Score=23.47  Aligned_cols=28  Identities=29%  Similarity=0.532  Sum_probs=22.6

Q ss_pred             hhhccCccc--hhhhhHHHHHHHHHhccCh
Q psy11495         29 SREKGVNRE--DRIHGSLLVLNELLRVSNV   56 (81)
Q Consensus        29 ~keKglnRD--DRiHG~LLILNELLR~sn~   56 (81)
                      .+..|+..|  |-+.++++|+++++...+.
T Consensus       251 ~~~~gl~~~Rad~i~~g~~i~~~l~~~~~~  280 (300)
T TIGR03706       251 LKLPGLSKDRADILPGGAAVLEELFRALGI  280 (300)
T ss_pred             HhCCCCCHHHHHHHHHHHHHHHHHHHhcCC
Confidence            355677655  9999999999999998765


No 6  
>PF10211 Ax_dynein_light:  Axonemal dynein light chain;  InterPro: IPR019347  Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility. Eukaryotic cilia and flagella are complex organelles consisting of a core structure, the axoneme, which is composed of nine microtubule doublets forming a cylinder that surrounds a pair of central singlet microtubules. This ultra-structural arrangement seems to be one of the most stable micro-tubular assemblies known and is responsible for the flagellar and ciliary movement of a large number of organisms ranging from protozoan to mammals. This light chain interacts directly with the N-terminal half of the heavy chains []. 
Probab=30.68  E-value=38  Score=24.61  Aligned_cols=13  Identities=31%  Similarity=0.715  Sum_probs=11.4

Q ss_pred             hHHHHHHHHHHHh
Q psy11495         10 YATYRLCFEEAMS   22 (81)
Q Consensus        10 ~qWY~~Cy~EA~~   22 (81)
                      -++|.+||+|-++
T Consensus        61 ~~ly~~~F~ELIR   73 (189)
T PF10211_consen   61 EELYSQCFDELIR   73 (189)
T ss_pred             HHHHHHHHHHHHH
Confidence            3699999999987


No 7  
>KOG3612|consensus
Probab=27.90  E-value=36  Score=29.76  Aligned_cols=21  Identities=29%  Similarity=0.376  Sum_probs=18.8

Q ss_pred             hhHhhhchhHHHHHHHHHHHh
Q psy11495          2 KALREKSAYATYRLCFEEAMS   22 (81)
Q Consensus         2 ~~~ke~qk~qWY~~Cy~EA~~   22 (81)
                      .+|-|.-|-||-.+|-+||+-
T Consensus       519 r~l~etKkKQWC~nC~~EAiy  539 (588)
T KOG3612|consen  519 RALAETKKKQWCYNCLDEAIY  539 (588)
T ss_pred             HHHHHHHHHHHHHhhhHHHHH
Confidence            578888999999999999984


No 8  
>TIGR03486 cas_csx13_C CRISPR-associated protein, Cas_csx13 family, C-terminal region. Members of this family are found among cas (CRISPR-Associated) genes close to CRISPR repeats in Leptospira interrogans (a spirochete), Myxococcus xanthus (a delta-proteobacterium), and Lyngbya sp. PCC 8106 (a cyanobacterium). It is found with other cas genes in Anabaena variabilis ATCC 29413. In Lyngbya sp., the protein is split into two tandem genes. This model corresponds to the C-terminal region or upstream gene; the N-terminal region is modelled by TIGR03485. CRISPR/cas systems are associated with prokaryotic acquired resistance to phage and other exogenous DNA.
Probab=27.50  E-value=1.4e+02  Score=21.84  Aligned_cols=60  Identities=15%  Similarity=0.165  Sum_probs=36.7

Q ss_pred             hhHHHHHHHHHHHhch-hhhhh--hhcc-Cccch-hhhhHHHHHHHHHhccChHHHHHHHHHHhhhc
Q psy11495          9 AYATYRLCFEEAMSGL-DEVFS--REKG-VNRED-RIHGSLLVLNELLRVSNVTWERTYEDLMNRLQ   70 (81)
Q Consensus         9 k~qWY~~Cy~EA~~~f-~e~~~--keKg-lnRDD-RiHG~LLILNELLR~sn~~~Er~r~el~~~~~   70 (81)
                      .-||+-+.|.||++.+ .-+.+  +++| .++-+ .-+=.==|.|+|+||+.++  ..+.-+-++..
T Consensus        49 ~eq~fiqa~HeAlr~~~~qI~~~tk~~g~~~~~~~~e~e~erir~~l~r~kt~~--~fr~~i~df~s  113 (152)
T TIGR03486        49 AEQWFVQSFHEALRRIYAKIASHTKRRGSETLGDRWKRENERIYSSLARAKTSE--QFRTFIADLWA  113 (152)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhhhhcccchhHHHHHHHHHHHHHHhccCCHH--HHHHHHHHHHH
Confidence            4789999999999765 33333  4444 33332 2233445889999998875  34444444443


No 9  
>PF13041 PPR_2:  PPR repeat family 
Probab=26.64  E-value=82  Score=17.03  Aligned_cols=25  Identities=24%  Similarity=0.404  Sum_probs=12.9

Q ss_pred             HHHHHhchhhhhhhhccCccchhhhhH
Q psy11495         17 FEEAMSGLDEVFSREKGVNREDRIHGS   43 (81)
Q Consensus        17 y~EA~~~f~e~~~keKglnRDDRiHG~   43 (81)
                      +++|.+.|++..  ++|+.-|-.....
T Consensus        19 ~~~a~~l~~~M~--~~g~~P~~~Ty~~   43 (50)
T PF13041_consen   19 FEEALKLFKEMK--KRGIKPDSYTYNI   43 (50)
T ss_pred             HHHHHHHHHHHH--HcCCCCCHHHHHH
Confidence            456666666653  3455555444433


No 10 
>PF00763 THF_DHG_CYH:  Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain;  InterPro: IPR020630 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF). Various reactions generate one-carbon derivatives of THF, which can be interconverted between different oxidation states by methylene-THF dehydrogenase (1.5.1.5 from EC), methenyl-THF cyclohydrolase (3.5.4.9 from EC) and formyl-THF synthetase (6.3.4.3 from EC) [, ]. The dehydrogenase and cyclohydrolase activities are expressed by a variety of multifunctional enzymes, including the tri-functional eukaryotic C1-tetrahydrofolate synthase []; a bifunctional eukaryotic mitochondrial protein; and the bifunctional Escherichia coli folD protein [, ]. Methylene-tetrahydrofolate dehydrogenase and methenyltetrahydrofolate cyclo-hydrolase share an overlapping active site [], and as such are usually located together in proteins, acting in tandem on the carbon-nitrogen bonds of substrates other than peptide bonds. This entry represents the N-terminal catalytic domain of these enzymes. ; GO: 0003824 catalytic activity, 0004488 methylenetetrahydrofolate dehydrogenase (NADP+) activity, 0009396 folic acid-containing compound biosynthetic process, 0055114 oxidation-reduction process; PDB: 2C2X_B 2C2Y_A 1EDZ_A 1EE9_A 4A26_B 3NGL_C 3NGX_A 1B0A_A 1DIA_A 1A4I_B ....
Probab=26.45  E-value=9.1  Score=25.51  Aligned_cols=16  Identities=25%  Similarity=0.474  Sum_probs=10.7

Q ss_pred             hhccCccchhhhhHHH
Q psy11495         30 REKGVNREDRIHGSLL   45 (81)
Q Consensus        30 keKglnRDDRiHG~LL   45 (81)
                      .-+.+|.|+.|||-|+
T Consensus        78 ~i~~lN~D~~V~GIlv   93 (117)
T PF00763_consen   78 LIEKLNEDPSVHGILV   93 (117)
T ss_dssp             HHHHHHH-TT-SEEEE
T ss_pred             HHHHHhCCCCCCEEEE
Confidence            3455899999999775


No 11 
>PF09403 FadA:  Adhesion protein FadA;  InterPro: IPR018543  FadA (Fusobacterium adhesin A) is an adhesin which forms two alpha helices. ; PDB: 3ETZ_B 3ETY_A 2GL2_B 3ETX_C 3ETW_A.
Probab=25.69  E-value=50  Score=23.12  Aligned_cols=28  Identities=14%  Similarity=0.337  Sum_probs=24.1

Q ss_pred             hhHhhhchhHHHHHHHHHHHhchhhhhh
Q psy11495          2 KALREKSAYATYRLCFEEAMSGLDEVFS   29 (81)
Q Consensus         2 ~~~ke~qk~qWY~~Cy~EA~~~f~e~~~   29 (81)
                      ..+++..+.-||+.-|.+-.+-|.+...
T Consensus        76 ~kl~~~~~~r~yk~eYk~llk~y~~~~~  103 (126)
T PF09403_consen   76 EKLKQDSKVRWYKDEYKELLKKYKDLLN  103 (126)
T ss_dssp             HHHHHHGGGSTTHHHHHHHHHHHHHHHH
T ss_pred             HHHHHhcchhHHHHHHHHHHHHHHHHHH
Confidence            4678899999999999999998888654


No 12 
>PF01707 Peptidase_C9:  Peptidase family C9;  InterPro: IPR002620 The family of alphaviruses includes 26 known members. They infect a variety of hosts including mosquitoes, birds, rodents and other mammals with worldwide distribution. Alphaviruses also pose a potential threat to human health in many area. For example, Venezuelan Equine Encephalitis Virus (VEEV) causes encephalitis in humans as well as livestock in Central and South America, and some variants of Sinbis Virus (SIN) and Semliki Forest Virus (SFV) have been found to cause fever and arthritis in humans []. Alphaviruses possess a single-stranded RNA genome of approximately 12 kb. The genomic RNA of alphaviruses is translated into two polyproteins that, respectively, encode structural proteins and nonstructural proteins. The nonstructural proteins may be translated as one or two polyproteins, nsp123 or nsp1234, depending on the virus. These polyproteins are cleaved to generate nsp1, nsp2, nsp3 and nsp4 by a protease activity that resides within nsp2 []. The nsp2 protein of alphaviruses has multiple enzymatic acivities. Its N-terminal domain has been shown to possess ATPase and GTPase activity, RNA helicase activity and RNA 5'-triphosphatase activity []. The C-terminal nsp2pro domain of nsp2 is responsible for the regulation of 26S subgenome RNA synthesis, switching between negative- and positive-strand RNA synthesis, targeting nsp2 for nuclear transport and proteolytic processing of the nonstructural polyprotein [, ]. The nsp2pro domain is a member of peptidase family C9 of clan CA. The nsp2pro domain consists of two distinct subdomains. The nsp2pro N-terminal subdomain is largely alpha-helical and contains the catalytic dyad cysteine and histidine residues organised in a protein fold that differs significantly from any known cysteine protease or protein folds. The nsp2pro C-terminal subdomain displays structural similarity to S-adenosyl- L-methionine-dependent RNA methyltransferases and provides essential elements that contribute to substrate recognition and may also regulate the structure of the substrate binding cleft []. This entry represents the nsp2pro domain.; PDB: 3TRK_A 2HWK_A.
Probab=24.23  E-value=42  Score=25.75  Aligned_cols=15  Identities=33%  Similarity=0.552  Sum_probs=10.1

Q ss_pred             cchhhhhHHHHHHHH
Q psy11495         36 REDRIHGSLLVLNEL   50 (81)
Q Consensus        36 RDDRiHG~LLILNEL   50 (81)
                      ++|+.|+....||++
T Consensus        79 ~~Dka~S~e~ALn~i   93 (202)
T PF01707_consen   79 KEDKAYSPEVALNEI   93 (202)
T ss_dssp             HTT----HHHHHHHH
T ss_pred             hcCcccCHHHHHHHH
Confidence            679999999999997


No 13 
>PF10274 ParcG:  Parkin co-regulated protein;  InterPro: IPR019399  This family of proteins is transcribed anti-sense along the DNA to the Parkin gene product and the two appear to be transcribed under the same promoter. The protein has predicted alpha-helical and beta-sheet domains which suggest its function is in the ubiquitin/proteasome system []. Mutations in parkin are the genetic cause of early-onset and autosomal recessive juvenile parkinsonism. 
Probab=22.70  E-value=1.3e+02  Score=22.40  Aligned_cols=38  Identities=21%  Similarity=0.216  Sum_probs=30.4

Q ss_pred             Cccc-hhhhhHHHHHHHHHhccChHHHHHHHHHHhhhcc
Q psy11495         34 VNRE-DRIHGSLLVLNELLRVSNVTWERTYEDLMNRLQV   71 (81)
Q Consensus        34 lnRD-DRiHG~LLILNELLR~sn~~~Er~r~el~~~~~~   71 (81)
                      .+|| +-+.-+|-+|+-|+.++..-+|-+.--+.+++++
T Consensus        90 ~tr~~~V~~~~L~~Lq~Lv~~~~~vG~aLvPyyrqLLp~  128 (183)
T PF10274_consen   90 NTRDPEVFCATLKALQQLVTSSDMVGEALVPYYRQLLPV  128 (183)
T ss_pred             hCCCHHHHHHHHHHHHHHHHhhhhhhHHHHHHHHHHHHH
Confidence            4588 8889999999999999999999885555555543


No 14 
>PRK09547 nhaB sodium/proton antiporter; Reviewed
Probab=22.53  E-value=41  Score=28.61  Aligned_cols=12  Identities=17%  Similarity=0.185  Sum_probs=8.9

Q ss_pred             hchhHHHHHHHH
Q psy11495          7 KSAYATYRLCFE   18 (81)
Q Consensus         7 ~qk~qWY~~Cy~   18 (81)
                      .+.|.|||.|.-
T Consensus        15 ~~~~~~~~~~~~   26 (513)
T PRK09547         15 GQSPDWYKLAII   26 (513)
T ss_pred             CCCchHHHHHHH
Confidence            368999998753


No 15 
>KOG4001|consensus
Probab=22.40  E-value=55  Score=25.83  Aligned_cols=23  Identities=26%  Similarity=0.580  Sum_probs=15.6

Q ss_pred             HHHHHHHHHHHhchhhhhhhhccC
Q psy11495         11 ATYRLCFEEAMSGLDEVFSREKGV   34 (81)
Q Consensus        11 qWY~~Cy~EA~~~f~e~~~keKgl   34 (81)
                      +-|.|||||.++--.- ...++|+
T Consensus       127 eLYsQcFDElIRqvs~-scveRGl  149 (259)
T KOG4001|consen  127 ELYSQCFDELIRQVSV-SCVERGL  149 (259)
T ss_pred             HHHHHHHHHHHHHcch-hHHhcce
Confidence            5799999999974322 2346663


No 16 
>PF07527 Hairy_orange:  Hairy Orange;  InterPro: IPR003650 This domain confers specificity among members of the Hairy/E(SPL) family. HES-2 (hairy and enhancer of split 2) is a transcription factor, and the hairy protein is a pair-rule protein that regulates embryonic segmentation and adult bristle patterning. These proteins are transcriptional repressors of genes that require the BHLH protein for their transcription.; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2DB7_A.
Probab=21.23  E-value=75  Score=17.68  Aligned_cols=15  Identities=33%  Similarity=0.538  Sum_probs=12.4

Q ss_pred             HHHHHHHHHhchhhh
Q psy11495         13 YRLCFEEAMSGLDEV   27 (81)
Q Consensus        13 Y~~Cy~EA~~~f~e~   27 (81)
                      |.+|..|+.+.+...
T Consensus         7 y~~C~~Ev~~fL~~~   21 (43)
T PF07527_consen    7 YSECLNEVSRFLSSV   21 (43)
T ss_dssp             HHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHhcC
Confidence            789999999987553


No 17 
>PRK11031 guanosine pentaphosphate phosphohydrolase; Provisional
Probab=21.16  E-value=1.8e+02  Score=23.77  Aligned_cols=45  Identities=13%  Similarity=0.033  Sum_probs=29.0

Q ss_pred             HHHHHHHHHHhchhhhhhhhccCccc--hhhhhHHHHHHHHHhccCh
Q psy11495         12 TYRLCFEEAMSGLDEVFSREKGVNRE--DRIHGSLLVLNELLRVSNV   56 (81)
Q Consensus        12 WY~~Cy~EA~~~f~e~~~keKglnRD--DRiHG~LLILNELLR~sn~   56 (81)
                      -.+.-|++....-.+-..+-.|++.|  |-+=++++||+++++..+.
T Consensus       235 ~l~~l~~~l~~~~~~~~~~~~gl~~~Radii~~g~~Il~~i~~~~~~  281 (496)
T PRK11031        235 KLQQLKQRAIQCGRLEELEIEGLTLERALVFPSGLAILIAIFEELNI  281 (496)
T ss_pred             HHHHHHHHHhcCCHHHHhcCCCCCccHHHHHHHHHHHHHHHHHHcCc
Confidence            34444444443322222355688766  9999999999999998664


No 18 
>PRK01919 tatB sec-independent translocase; Provisional
Probab=20.95  E-value=43  Score=24.93  Aligned_cols=12  Identities=8%  Similarity=0.252  Sum_probs=10.3

Q ss_pred             HhhhchhHHHHH
Q psy11495          4 LREKSAYATYRL   15 (81)
Q Consensus         4 ~ke~qk~qWY~~   15 (81)
                      +|+.--|+||++
T Consensus       128 ~k~~a~p~wyk~  139 (169)
T PRK01919        128 VKQAATPQWYKR  139 (169)
T ss_pred             ccCCCCcHHHHH
Confidence            678888999986


Done!