BLAST Results

Query Summary

Your job contains 1 sequence.

Parameters
Threshold: 0.001
Maximum number of alignments shown: 100
BLAST filter: on

Query Sequence

>psy11495
MKALREKSAYATYRLCFEEAMSGLDEVFSREKGVNREDRIHGSLLVLNELLRVSNVTWER
TYEDLMNRLQVSTCDDSEIPR

High Scoring Gene Products

Symbol, full name Information P value
MTOR
Serine/threonine-protein kinase mTOR
protein from Homo sapiens 2.2e-10
Mtor
mechanistic target of rapamycin (serine/threonine kinase)
protein from Mus musculus 2.2e-10
Mtor
mechanistic target of rapamycin (serine/threonine kinase)
gene from Rattus norvegicus 2.2e-10
MTOR
Uncharacterized protein
protein from Canis lupus familiaris 2.2e-10
MTOR
Uncharacterized protein
protein from Bos taurus 2.2e-10
MTOR
Uncharacterized protein
protein from Sus scrofa 2.2e-10
MTOR
Uncharacterized protein
protein from Gallus gallus 4.3e-10
mtor
mechanistic target of rapamycin (serine/threonine kinase)
gene_product from Danio rerio 9.4e-10
Tor
Target of rapamycin
protein from Drosophila melanogaster 2.8e-08

Back to top

Raw Blast Data

BLASTP 2.0MP-WashU [04-May-2006] [linux26-i686-ILP32F64 2006-05-09T11:47:08]

Copyright (C) 1996-2006 Washington University, Saint Louis, Missouri USA.
All Rights Reserved.

Reference:  Gish, W. (1996-2006) http://blast.wustl.edu

Query=  psy11495
        (81 letters)

Database:  go_20130330-seqdb.fasta
           368,745 sequences; 169,044,731 total letters.
Searching....10....20....30....40....50....60....70....80....90....100% done

                                                                     Smallest
                                                                       Sum
                                                              High  Probability
Sequences producing High-scoring Segment Pairs:              Score  P(N)      N

UNIPROTKB|P42345 - symbol:MTOR "Serine/threonine-protein ...   164  2.2e-10   1
MGI|MGI:1928394 - symbol:Mtor "mechanistic target of rapa...   164  2.2e-10   1
RGD|68371 - symbol:Mtor "mechanistic target of rapamycin ...   164  2.2e-10   1
UNIPROTKB|E2R2L2 - symbol:MTOR "Uncharacterized protein" ...   164  2.2e-10   1
UNIPROTKB|E1BFB4 - symbol:MTOR "Uncharacterized protein" ...   164  2.2e-10   1
UNIPROTKB|F1RHR8 - symbol:MTOR "Uncharacterized protein" ...   164  2.2e-10   1
UNIPROTKB|F1NUX4 - symbol:MTOR "Uncharacterized protein" ...   161  4.3e-10   1
ZFIN|ZDB-GENE-030131-2974 - symbol:mtor "mechanistic targ...   158  9.4e-10   1
FB|FBgn0021796 - symbol:Tor "Target of rapamycin" species...   144  2.8e-08   1


>UNIPROTKB|P42345 [details] [associations]
            symbol:MTOR "Serine/threonine-protein kinase mTOR"
            species:9606 "Homo sapiens" [GO:0008144 "drug binding"
            evidence=IEA] [GO:0005524 "ATP binding" evidence=IEA] [GO:0001938
            "positive regulation of endothelial cell proliferation"
            evidence=IEA] [GO:0005979 "regulation of glycogen biosynthetic
            process" evidence=IEA] [GO:0007281 "germ cell development"
            evidence=IEA] [GO:0010592 "positive regulation of lamellipodium
            assembly" evidence=IEA] [GO:0010831 "positive regulation of myotube
            differentiation" evidence=IEA] [GO:0016242 "negative regulation of
            macroautophagy" evidence=IEA] [GO:0018107 "peptidyl-threonine
            phosphorylation" evidence=IEA] [GO:0019904 "protein domain specific
            binding" evidence=IEA] [GO:0030838 "positive regulation of actin
            filament polymerization" evidence=IEA] [GO:0031529 "ruffle
            organization" evidence=IEA] [GO:0031998 "regulation of fatty acid
            beta-oxidation" evidence=IEA] [GO:0032095 "regulation of response
            to food" evidence=IEA] [GO:0032314 "regulation of Rac GTPase
            activity" evidence=IEA] [GO:0043022 "ribosome binding"
            evidence=IEA] [GO:0043610 "regulation of carbohydrate utilization"
            evidence=IEA] [GO:0045792 "negative regulation of cell size"
            evidence=IEA] [GO:0045859 "regulation of protein kinase activity"
            evidence=IEA] [GO:0050731 "positive regulation of peptidyl-tyrosine
            phosphorylation" evidence=IEA] [GO:0051496 "positive regulation of
            stress fiber assembly" evidence=IEA] [GO:0051534 "negative
            regulation of NFAT protein import into nucleus" evidence=IEA]
            [GO:0051897 "positive regulation of protein kinase B signaling
            cascade" evidence=IEA] [GO:0070438 "mTOR-FKBP12-rapamycin complex"
            evidence=IEA] [GO:0000139 "Golgi membrane" evidence=IEA]
            [GO:0005741 "mitochondrial outer membrane" evidence=IEA]
            [GO:0005789 "endoplasmic reticulum membrane" evidence=IEA]
            [GO:0005737 "cytoplasm" evidence=IDA] [GO:0016020 "membrane"
            evidence=IDA] [GO:0016301 "kinase activity" evidence=IDA;TAS]
            [GO:0051219 "phosphoprotein binding" evidence=IPI] [GO:0016049
            "cell growth" evidence=IDA;TAS] [GO:0030163 "protein catabolic
            process" evidence=TAS] [GO:0016310 "phosphorylation" evidence=IDA]
            [GO:0007584 "response to nutrient" evidence=NAS] [GO:0007165
            "signal transduction" evidence=NAS] [GO:0005942
            "phosphatidylinositol 3-kinase complex" evidence=NAS] [GO:0005515
            "protein binding" evidence=IPI] [GO:0040007 "growth" evidence=NAS]
            [GO:0005764 "lysosome" evidence=IDA] [GO:0071456 "cellular response
            to hypoxia" evidence=ISS] [GO:0016605 "PML body" evidence=ISS]
            [GO:0031931 "TORC1 complex" evidence=IDA;IMP] [GO:0018105
            "peptidyl-serine phosphorylation" evidence=IMP] [GO:0043200
            "response to amino acid stimulus" evidence=IDA] [GO:0012505
            "endomembrane system" evidence=IDA] [GO:0031932 "TORC2 complex"
            evidence=IDA] [GO:0006468 "protein phosphorylation"
            evidence=IMP;IDA] [GO:0004674 "protein serine/threonine kinase
            activity" evidence=IDA;TAS] [GO:0031929 "TOR signaling cascade"
            evidence=IMP] [GO:0032956 "regulation of actin cytoskeleton
            organization" evidence=IMP] [GO:0001156 "TFIIIC-class transcription
            factor binding" evidence=IDA] [GO:0031669 "cellular response to
            nutrient levels" evidence=ISS] [GO:0010507 "negative regulation of
            autophagy" evidence=ISS] [GO:0045945 "positive regulation of
            transcription from RNA polymerase III promoter" evidence=IMP]
            [GO:0001934 "positive regulation of protein phosphorylation"
            evidence=IDA] [GO:0001030 "RNA polymerase III type 1 promoter DNA
            binding" evidence=IDA] [GO:0001031 "RNA polymerase III type 2
            promoter DNA binding" evidence=IDA] [GO:0001032 "RNA polymerase III
            type 3 promoter DNA binding" evidence=IDA] [GO:0046889 "positive
            regulation of lipid biosynthetic process" evidence=IMP] [GO:0045727
            "positive regulation of translation" evidence=IDA] [GO:0006950
            "response to stress" evidence=IMP] [GO:0010628 "positive regulation
            of gene expression" evidence=IMP] [GO:0046777 "protein
            autophosphorylation" evidence=IDA] [GO:0005829 "cytosol"
            evidence=TAS] [GO:0007173 "epidermal growth factor receptor
            signaling pathway" evidence=TAS] [GO:0008286 "insulin receptor
            signaling pathway" evidence=TAS] [GO:0008543 "fibroblast growth
            factor receptor signaling pathway" evidence=TAS] [GO:0031295 "T
            cell costimulation" evidence=TAS] [GO:0048011 "neurotrophin TRK
            receptor signaling pathway" evidence=TAS] [GO:0048015
            "phosphatidylinositol-mediated signaling" evidence=TAS]
            InterPro:IPR000403 InterPro:IPR003151 InterPro:IPR003152
            InterPro:IPR009076 InterPro:IPR011009 InterPro:IPR011990
            InterPro:IPR016024 InterPro:IPR018936 Pfam:PF00454 Pfam:PF02259
            Pfam:PF02260 Pfam:PF08771 PROSITE:PS00915 PROSITE:PS00916
            PROSITE:PS50290 PROSITE:PS51190 SMART:SM00146 GO:GO:0005524
            Pathway_Interaction_DB:pi3kciaktpathway Reactome:REACT_111102
            Reactome:REACT_116125 Reactome:REACT_6900 GO:GO:0007173
            GO:GO:0008543 GO:GO:0008286 GO:GO:0048011
            Pathway_Interaction_DB:telomerasepathway GO:GO:0000139
            Pathway_Interaction_DB:il12_2pathway SUPFAM:SSF48371
            Pathway_Interaction_DB:mtor_4pathway Gene3D:1.25.10.10
            InterPro:IPR011989 PROSITE:PS50077 GO:GO:0016020 GO:GO:0005741
            GO:GO:0031295 GO:GO:0005789 GO:GO:0031929 GO:GO:0016605
            GO:GO:0016049 GO:GO:0008144 GO:GO:0010507 GO:GO:0001938
            GO:GO:0043025 GO:GO:0030425 GO:GO:0046889 SUPFAM:SSF56112
            GO:GO:0004674 GO:GO:0051496 GO:GO:0007584 GO:GO:0071456
            GO:GO:0012505 GO:GO:0046777 GO:GO:0018105 GO:GO:0005764
            GO:GO:0043022 GO:GO:0050731 Gene3D:1.25.40.10 GO:GO:0018107
            GO:GO:0007281 GO:GO:0030163 GO:GO:0051897
            Pathway_Interaction_DB:endothelinpathway GO:GO:0030838
            eggNOG:COG5032 GO:GO:0048015 Gene3D:1.10.1070.11 GO:GO:0005942
            GO:GO:0032314 GO:GO:0001934 Pathway_Interaction_DB:il4_2pathway
            GO:GO:0032956 GO:GO:0051534 Pathway_Interaction_DB:ifngpathway
            Pathway_Interaction_DB:il2_pi3kpathway GO:GO:0045792 GO:GO:0031931
            GO:GO:0043200 GO:GO:0045727 GO:GO:0045945 EMBL:AJ300188
            EMBL:AL049653 EMBL:AL391561 GO:GO:0010592 GO:GO:0031529
            PROSITE:PS51189 InterPro:IPR014009 GO:GO:0031932 GO:GO:0045859
            GO:GO:0016242 GO:GO:0031998 EMBL:AL109811 PDB:1FAP PDB:1NSG
            PDB:2FAP PDB:2RSE PDB:3FAP PDB:4FAP PDBsum:1FAP PDBsum:1NSG
            PDBsum:2FAP PDBsum:2RSE PDBsum:3FAP PDBsum:4FAP GO:GO:0031669
            GO:GO:0032095 GO:GO:0001030 GO:GO:0001031 GO:GO:0001032 EMBL:L34075
            EMBL:U88966 EMBL:AB209995 EMBL:BC117166 EMBL:L35478 IPI:IPI00031410
            PIR:S45340 RefSeq:NP_004949.1 UniGene:Hs.338207 PDB:1AUE PDB:2GAQ
            PDB:2NPU PDBsum:1AUE PDBsum:2GAQ PDBsum:2NPU
            ProteinModelPortal:P42345 SMR:P42345 DIP:DIP-790N IntAct:P42345
            MINT:MINT-121301 STRING:P42345 PhosphoSite:P42345 DMDM:1169735
            PaxDb:P42345 PRIDE:P42345 Ensembl:ENST00000361445 GeneID:2475
            KEGG:hsa:2475 UCSC:uc001asd.3 CTD:2475 GeneCards:GC01M011166
            HGNC:HGNC:3942 HPA:CAB005057 MIM:601231 neXtProt:NX_P42345
            PharmGKB:PA28360 HOGENOM:HOG000163215 HOVERGEN:HBG005744
            InParanoid:P42345 KO:K07203 OMA:DPYKHKM OrthoDB:EOG41RPT0
            BindingDB:P42345 ChEMBL:CHEMBL2842 ChiTaRS:MTOR
            EvolutionaryTrace:P42345 GenomeRNAi:2475 NextBio:9805
            ArrayExpress:P42345 Bgee:P42345 CleanEx:HS_FRAP1
            Genevestigator:P42345 GermOnline:ENSG00000198793 GO:GO:0070438
            GO:GO:0001156 GO:GO:0043610 GO:GO:0005979 InterPro:IPR024585
            InterPro:IPR026683 PANTHER:PTHR11139:SF9 Pfam:PF11865
            SUPFAM:SSF47212 Uniprot:P42345
        Length = 2549

 Score = 164 (62.8 bits), Expect = 2.2e-10, P = 2.2e-10
 Identities = 30/53 (56%), Positives = 42/53 (79%)

Query:    13 YRLCFEEAMSGLDEVFSREKGVNREDRIHGSLLVLNELLRVSNVTWERTYEDL 65
             YR  FEEA  G DE  ++EKG+NR+DRIHG+LL+LNEL+R+S++  ER  E++
Sbjct:   234 YRHTFEEAEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEM 286


>MGI|MGI:1928394 [details] [associations]
            symbol:Mtor "mechanistic target of rapamycin
            (serine/threonine kinase)" species:10090 "Mus musculus" [GO:0000166
            "nucleotide binding" evidence=IEA] [GO:0001030 "RNA polymerase III
            type 1 promoter DNA binding" evidence=ISO] [GO:0001031 "RNA
            polymerase III type 2 promoter DNA binding" evidence=ISO]
            [GO:0001032 "RNA polymerase III type 3 promoter DNA binding"
            evidence=ISO] [GO:0001156 "TFIIIC-class transcription factor
            binding" evidence=ISO] [GO:0001934 "positive regulation of protein
            phosphorylation" evidence=ISO] [GO:0001938 "positive regulation of
            endothelial cell proliferation" evidence=ISO] [GO:0004674 "protein
            serine/threonine kinase activity" evidence=ISO;IDA] [GO:0005515
            "protein binding" evidence=IPI] [GO:0005524 "ATP binding"
            evidence=IEA] [GO:0005634 "nucleus" evidence=ISO;IDA] [GO:0005737
            "cytoplasm" evidence=ISO] [GO:0005739 "mitochondrion" evidence=IEA]
            [GO:0005741 "mitochondrial outer membrane" evidence=IEA]
            [GO:0005764 "lysosome" evidence=ISO] [GO:0005783 "endoplasmic
            reticulum" evidence=IEA] [GO:0005794 "Golgi apparatus"
            evidence=IEA] [GO:0005829 "cytosol" evidence=ISO;IDA] [GO:0005979
            "regulation of glycogen biosynthetic process" evidence=ISO]
            [GO:0006109 "regulation of carbohydrate metabolic process"
            evidence=ISO] [GO:0006468 "protein phosphorylation" evidence=ISO]
            [GO:0006950 "response to stress" evidence=ISO] [GO:0007281 "germ
            cell development" evidence=IDA] [GO:0008144 "drug binding"
            evidence=IEA] [GO:0010507 "negative regulation of autophagy"
            evidence=IMP] [GO:0010592 "positive regulation of lamellipodium
            assembly" evidence=IDA] [GO:0010628 "positive regulation of gene
            expression" evidence=ISO] [GO:0010831 "positive regulation of
            myotube differentiation" evidence=IGI] [GO:0012505 "endomembrane
            system" evidence=ISO] [GO:0016020 "membrane" evidence=ISO]
            [GO:0016049 "cell growth" evidence=ISO] [GO:0016242 "negative
            regulation of macroautophagy" evidence=IMP] [GO:0016301 "kinase
            activity" evidence=ISO] [GO:0016310 "phosphorylation" evidence=ISO]
            [GO:0016605 "PML body" evidence=IDA] [GO:0016740 "transferase
            activity" evidence=IEA] [GO:0016772 "transferase activity,
            transferring phosphorus-containing groups" evidence=IEA]
            [GO:0016773 "phosphotransferase activity, alcohol group as
            acceptor" evidence=IEA] [GO:0018105 "peptidyl-serine
            phosphorylation" evidence=ISO;IMP] [GO:0018107 "peptidyl-threonine
            phosphorylation" evidence=IDA] [GO:0019904 "protein domain specific
            binding" evidence=ISO] [GO:0030030 "cell projection organization"
            evidence=ISO;IMP] [GO:0030425 "dendrite" evidence=ISO] [GO:0030838
            "positive regulation of actin filament polymerization"
            evidence=IMP;IDA] [GO:0031529 "ruffle organization" evidence=IDA]
            [GO:0031669 "cellular response to nutrient levels" evidence=IDA]
            [GO:0031929 "TOR signaling cascade" evidence=ISO] [GO:0031931
            "TORC1 complex" evidence=ISO] [GO:0031932 "TORC2 complex"
            evidence=ISO] [GO:0031998 "regulation of fatty acid beta-oxidation"
            evidence=ISO] [GO:0032095 "regulation of response to food"
            evidence=ISO] [GO:0032314 "regulation of Rac GTPase activity"
            evidence=IMP] [GO:0032868 "response to insulin stimulus"
            evidence=IDA] [GO:0032956 "regulation of actin cytoskeleton
            organization" evidence=ISO] [GO:0043022 "ribosome binding"
            evidence=IDA] [GO:0043025 "neuronal cell body" evidence=ISO]
            [GO:0043200 "response to amino acid stimulus" evidence=ISO;IDA]
            [GO:0043610 "regulation of carbohydrate utilization" evidence=ISO]
            [GO:0045727 "positive regulation of translation" evidence=ISO]
            [GO:0045792 "negative regulation of cell size" evidence=ISO;IGI]
            [GO:0045859 "regulation of protein kinase activity" evidence=IGI]
            [GO:0045945 "positive regulation of transcription from RNA
            polymerase III promoter" evidence=ISO] [GO:0046777 "protein
            autophosphorylation" evidence=ISO] [GO:0046889 "positive regulation
            of lipid biosynthetic process" evidence=ISO] [GO:0050731 "positive
            regulation of peptidyl-tyrosine phosphorylation" evidence=IMP]
            [GO:0051219 "phosphoprotein binding" evidence=ISO] [GO:0051496
            "positive regulation of stress fiber assembly" evidence=IDA]
            [GO:0051534 "negative regulation of NFAT protein import into
            nucleus" evidence=IMP] [GO:0051897 "positive regulation of protein
            kinase B signaling cascade" evidence=ISO] [GO:0070438
            "mTOR-FKBP12-rapamycin complex" evidence=ISO] [GO:0071456 "cellular
            response to hypoxia" evidence=IDA] InterPro:IPR000403
            InterPro:IPR003151 InterPro:IPR003152 InterPro:IPR009076
            InterPro:IPR011009 InterPro:IPR011990 InterPro:IPR016024
            InterPro:IPR018936 Pfam:PF00454 Pfam:PF02259 Pfam:PF02260
            Pfam:PF08771 PROSITE:PS00915 PROSITE:PS00916 PROSITE:PS50290
            PROSITE:PS51190 SMART:SM00146 MGI:MGI:1928394 GO:GO:0005829
            GO:GO:0005524 GO:GO:0005634 GO:GO:0000139 SUPFAM:SSF48371
            Gene3D:1.25.10.10 InterPro:IPR011989 PROSITE:PS50077 GO:GO:0005741
            GO:GO:0005789 GO:GO:0031929 GO:GO:0016605 GO:GO:0008144
            GO:GO:0001938 GO:GO:0043025 GO:GO:0030425 GO:GO:0046889
            SUPFAM:SSF56112 GO:GO:0004674 GO:GO:0051496 GO:GO:0071456
            GO:GO:0046777 GO:GO:0018105 GO:GO:0005764 GO:GO:0032868
            GO:GO:0043022 GO:GO:0050731 Gene3D:1.25.40.10 GO:GO:0018107
            GO:GO:0007281 GO:GO:0051897 GO:GO:0030838 eggNOG:COG5032
            Gene3D:1.10.1070.11 GO:GO:0032314 GO:GO:0051534 GO:GO:0045792
            GO:GO:0031931 GO:GO:0043200 GO:GO:0045727 GO:GO:0045945
            GO:GO:0010592 GO:GO:0031529 PROSITE:PS51189 InterPro:IPR014009
            GO:GO:0031932 GO:GO:0010831 GO:GO:0045859 GO:GO:0016242
            GO:GO:0031998 EMBL:AL713995 GO:GO:0031669 GO:GO:0032095
            GO:GO:0001030 GO:GO:0001031 GO:GO:0001032 CTD:2475
            HOGENOM:HOG000163215 HOVERGEN:HBG005744 KO:K07203 OMA:DPYKHKM
            OrthoDB:EOG41RPT0 ChiTaRS:MTOR GO:GO:0070438 GO:GO:0043610
            GO:GO:0005979 InterPro:IPR024585 InterPro:IPR026683
            PANTHER:PTHR11139:SF9 Pfam:PF11865 SUPFAM:SSF47212 EMBL:AF152838
            EMBL:AL731654 EMBL:CU210865 EMBL:BC043920 EMBL:BC112904
            EMBL:AK012031 IPI:IPI00268673 IPI:IPI00457494 RefSeq:NP_064393.2
            UniGene:Mm.21158 ProteinModelPortal:Q9JLN9 SMR:Q9JLN9
            DIP:DIP-40570N IntAct:Q9JLN9 MINT:MINT-1899010 STRING:Q9JLN9
            PhosphoSite:Q9JLN9 PaxDb:Q9JLN9 PRIDE:Q9JLN9
            Ensembl:ENSMUST00000057580 Ensembl:ENSMUST00000103221 GeneID:56717
            KEGG:mmu:56717 UCSC:uc008vur.2 GeneTree:ENSGT00700000104444
            InParanoid:Q2KHT0 BindingDB:Q9JLN9 ChEMBL:CHEMBL1255165
            NextBio:313190 Bgee:Q9JLN9 Genevestigator:Q9JLN9
            GermOnline:ENSMUSG00000028991 Uniprot:Q9JLN9
        Length = 2549

 Score = 164 (62.8 bits), Expect = 2.2e-10, P = 2.2e-10
 Identities = 30/53 (56%), Positives = 42/53 (79%)

Query:    13 YRLCFEEAMSGLDEVFSREKGVNREDRIHGSLLVLNELLRVSNVTWERTYEDL 65
             YR  FEEA  G DE  ++EKG+NR+DRIHG+LL+LNEL+R+S++  ER  E++
Sbjct:   234 YRHTFEEAEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEM 286


>RGD|68371 [details] [associations]
            symbol:Mtor "mechanistic target of rapamycin (serine/threonine
           kinase)" species:10116 "Rattus norvegicus" [GO:0000082 "G1/S
           transition of mitotic cell cycle" evidence=TAS] [GO:0000139 "Golgi
           membrane" evidence=IEA] [GO:0001030 "RNA polymerase III type 1
           promoter DNA binding" evidence=IEA;ISO] [GO:0001031 "RNA polymerase
           III type 2 promoter DNA binding" evidence=IEA;ISO] [GO:0001032 "RNA
           polymerase III type 3 promoter DNA binding" evidence=IEA;ISO]
           [GO:0001156 "TFIIIC-class transcription factor binding"
           evidence=IEA;ISO] [GO:0001934 "positive regulation of protein
           phosphorylation" evidence=ISO] [GO:0001938 "positive regulation of
           endothelial cell proliferation" evidence=IMP] [GO:0004674 "protein
           serine/threonine kinase activity" evidence=ISO;IMP;IDA] [GO:0005515
           "protein binding" evidence=IPI] [GO:0005524 "ATP binding"
           evidence=IEA] [GO:0005634 "nucleus" evidence=ISO;IDA] [GO:0005737
           "cytoplasm" evidence=ISO] [GO:0005741 "mitochondrial outer membrane"
           evidence=IEA] [GO:0005764 "lysosome" evidence=ISO;ISS] [GO:0005789
           "endoplasmic reticulum membrane" evidence=IEA] [GO:0005829 "cytosol"
           evidence=ISO;IDA] [GO:0005979 "regulation of glycogen biosynthetic
           process" evidence=IMP;IDA] [GO:0006109 "regulation of carbohydrate
           metabolic process" evidence=IMP;IDA] [GO:0006468 "protein
           phosphorylation" evidence=ISO;IMP;IDA] [GO:0006950 "response to
           stress" evidence=ISO] [GO:0007281 "germ cell development"
           evidence=IEA;ISO] [GO:0008144 "drug binding" evidence=IEA]
           [GO:0010507 "negative regulation of autophagy" evidence=ISO;ISS]
           [GO:0010592 "positive regulation of lamellipodium assembly"
           evidence=IEA;ISO] [GO:0010628 "positive regulation of gene
           expression" evidence=ISO] [GO:0010831 "positive regulation of
           myotube differentiation" evidence=IEA;ISO] [GO:0012505 "endomembrane
           system" evidence=ISO] [GO:0016020 "membrane" evidence=ISO]
           [GO:0016049 "cell growth" evidence=ISO] [GO:0016242 "negative
           regulation of macroautophagy" evidence=IEA;ISO] [GO:0016301 "kinase
           activity" evidence=ISO] [GO:0016310 "phosphorylation" evidence=ISO]
           [GO:0016605 "PML body" evidence=ISO;ISS] [GO:0018105
           "peptidyl-serine phosphorylation" evidence=IEA;ISO] [GO:0018107
           "peptidyl-threonine phosphorylation" evidence=IEA;ISO] [GO:0019904
           "protein domain specific binding" evidence=IPI] [GO:0030030 "cell
           projection organization" evidence=ISO;IGI] [GO:0030838 "positive
           regulation of actin filament polymerization" evidence=IEA;ISO]
           [GO:0031529 "ruffle organization" evidence=IEA;ISO] [GO:0031669
           "cellular response to nutrient levels" evidence=ISO;ISS] [GO:0031929
           "TOR signaling cascade" evidence=IEA;ISO] [GO:0031931 "TORC1
           complex" evidence=ISO;IDA] [GO:0031932 "TORC2 complex" evidence=ISO]
           [GO:0031998 "regulation of fatty acid beta-oxidation"
           evidence=IMP;IDA] [GO:0032095 "regulation of response to food"
           evidence=IMP;IDA] [GO:0032314 "regulation of Rac GTPase activity"
           evidence=IEA;ISO] [GO:0032868 "response to insulin stimulus"
           evidence=IEA;ISO] [GO:0032956 "regulation of actin cytoskeleton
           organization" evidence=ISO] [GO:0043022 "ribosome binding"
           evidence=IEA;ISO] [GO:0043200 "response to amino acid stimulus"
           evidence=IEA;ISO] [GO:0043610 "regulation of carbohydrate
           utilization" evidence=IMP;IDA] [GO:0045727 "positive regulation of
           translation" evidence=ISO;IMP] [GO:0045792 "negative regulation of
           cell size" evidence=ISO;IMP] [GO:0045859 "regulation of protein
           kinase activity" evidence=IEA;ISO] [GO:0045945 "positive regulation
           of transcription from RNA polymerase III promoter" evidence=IEA;ISO]
           [GO:0046777 "protein autophosphorylation" evidence=ISO;IMP]
           [GO:0046889 "positive regulation of lipid biosynthetic process"
           evidence=ISO;ISS] [GO:0050731 "positive regulation of
           peptidyl-tyrosine phosphorylation" evidence=IEA;ISO] [GO:0051219
           "phosphoprotein binding" evidence=IEA;ISO] [GO:0051496 "positive
           regulation of stress fiber assembly" evidence=IEA;ISO] [GO:0051534
           "negative regulation of NFAT protein import into nucleus"
           evidence=IEA;ISO] [GO:0051897 "positive regulation of protein kinase
           B signaling cascade" evidence=IMP] [GO:0070438
           "mTOR-FKBP12-rapamycin complex" evidence=IDA] [GO:0071456 "cellular
           response to hypoxia" evidence=ISO;ISS] [GO:0030425 "dendrite"
           evidence=IDA] [GO:0043025 "neuronal cell body" evidence=IDA]
           InterPro:IPR000403 InterPro:IPR003151 InterPro:IPR003152
           InterPro:IPR009076 InterPro:IPR011009 InterPro:IPR011990
           InterPro:IPR016024 InterPro:IPR018936 Pfam:PF00454 Pfam:PF02259
           Pfam:PF02260 Pfam:PF08771 PROSITE:PS00915 PROSITE:PS00916
           PROSITE:PS50290 PROSITE:PS51190 SMART:SM00146 RGD:68371
           GO:GO:0005829 GO:GO:0005524 GO:GO:0005634 GO:GO:0000139
           SUPFAM:SSF48371 Gene3D:1.25.10.10 InterPro:IPR011989 PROSITE:PS50077
           GO:GO:0005741 GO:GO:0005789 GO:GO:0000082 GO:GO:0031929
           GO:GO:0016605 GO:GO:0008144 GO:GO:0010507 GO:GO:0001938
           GO:GO:0046889 SUPFAM:SSF56112 GO:GO:0004674 GO:GO:0051496
           GO:GO:0071456 GO:GO:0046777 GO:GO:0018105 GO:GO:0005764
           GO:GO:0032868 GO:GO:0043022 GO:GO:0050731 Gene3D:1.25.40.10
           GO:GO:0018107 GO:GO:0007281 GO:GO:0051897 GO:GO:0030838
           eggNOG:COG5032 Gene3D:1.10.1070.11 GO:GO:0032314 GO:GO:0051534
           GO:GO:0030030 GO:GO:0045792 GO:GO:0031931 GO:GO:0043200
           GO:GO:0045727 GO:GO:0045945 GO:GO:0010592 GO:GO:0031529
           PROSITE:PS51189 InterPro:IPR014009 GO:GO:0045859 GO:GO:0016242
           GO:GO:0031998 GO:GO:0031669 GO:GO:0032095 GO:GO:0001030
           GO:GO:0001031 GO:GO:0001032 CTD:2475 HOVERGEN:HBG005744 KO:K07203
           OrthoDB:EOG41RPT0 GO:GO:0070438 GO:GO:0043610 GO:GO:0005979
           InterPro:IPR024585 InterPro:IPR026683 PANTHER:PTHR11139:SF9
           Pfam:PF11865 SUPFAM:SSF47212 GeneTree:ENSGT00700000104444
           EMBL:L37085 EMBL:U11681 IPI:IPI00339164 PIR:A54837
           RefSeq:NP_063971.1 UniGene:Rn.11008 ProteinModelPortal:P42346
           SMR:P42346 DIP:DIP-261N IntAct:P42346 MINT:MINT-87926 STRING:P42346
           PhosphoSite:P42346 PRIDE:P42346 Ensembl:ENSRNOT00000014167
           GeneID:56718 KEGG:rno:56718 UCSC:RGD:68371 InParanoid:P42346
           BindingDB:P42346 ChEMBL:CHEMBL1075134 NextBio:611130
           Genevestigator:P42346 Uniprot:P42346
        Length = 2549

 Score = 164 (62.8 bits), Expect = 2.2e-10, P = 2.2e-10
 Identities = 30/53 (56%), Positives = 42/53 (79%)

Query:    13 YRLCFEEAMSGLDEVFSREKGVNREDRIHGSLLVLNELLRVSNVTWERTYEDL 65
             YR  FEEA  G DE  ++EKG+NR+DRIHG+LL+LNEL+R+S++  ER  E++
Sbjct:   234 YRHTFEEAEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEM 286


>UNIPROTKB|E2R2L2 [details] [associations]
            symbol:MTOR "Uncharacterized protein" species:9615 "Canis
            lupus familiaris" [GO:0071456 "cellular response to hypoxia"
            evidence=IEA] [GO:0051534 "negative regulation of NFAT protein
            import into nucleus" evidence=IEA] [GO:0051496 "positive regulation
            of stress fiber assembly" evidence=IEA] [GO:0051219 "phosphoprotein
            binding" evidence=IEA] [GO:0050731 "positive regulation of
            peptidyl-tyrosine phosphorylation" evidence=IEA] [GO:0046889
            "positive regulation of lipid biosynthetic process" evidence=IEA]
            [GO:0045945 "positive regulation of transcription from RNA
            polymerase III promoter" evidence=IEA] [GO:0045859 "regulation of
            protein kinase activity" evidence=IEA] [GO:0045792 "negative
            regulation of cell size" evidence=IEA] [GO:0043200 "response to
            amino acid stimulus" evidence=IEA] [GO:0043022 "ribosome binding"
            evidence=IEA] [GO:0032868 "response to insulin stimulus"
            evidence=IEA] [GO:0032314 "regulation of Rac GTPase activity"
            evidence=IEA] [GO:0031929 "TOR signaling cascade" evidence=IEA]
            [GO:0031669 "cellular response to nutrient levels" evidence=IEA]
            [GO:0031529 "ruffle organization" evidence=IEA] [GO:0030838
            "positive regulation of actin filament polymerization"
            evidence=IEA] [GO:0018107 "peptidyl-threonine phosphorylation"
            evidence=IEA] [GO:0018105 "peptidyl-serine phosphorylation"
            evidence=IEA] [GO:0016605 "PML body" evidence=IEA] [GO:0016242
            "negative regulation of macroautophagy" evidence=IEA] [GO:0016020
            "membrane" evidence=IEA] [GO:0012505 "endomembrane system"
            evidence=IEA] [GO:0010831 "positive regulation of myotube
            differentiation" evidence=IEA] [GO:0010592 "positive regulation of
            lamellipodium assembly" evidence=IEA] [GO:0007281 "germ cell
            development" evidence=IEA] [GO:0005829 "cytosol" evidence=IEA]
            [GO:0005764 "lysosome" evidence=IEA] [GO:0004674 "protein
            serine/threonine kinase activity" evidence=IEA] [GO:0001156
            "TFIIIC-class transcription factor binding" evidence=IEA]
            [GO:0001032 "RNA polymerase III type 3 promoter DNA binding"
            evidence=IEA] [GO:0001031 "RNA polymerase III type 2 promoter DNA
            binding" evidence=IEA] [GO:0001030 "RNA polymerase III type 1
            promoter DNA binding" evidence=IEA] [GO:0005524 "ATP binding"
            evidence=IEA] [GO:0008144 "drug binding" evidence=IEA]
            InterPro:IPR000403 InterPro:IPR003151 InterPro:IPR003152
            InterPro:IPR009076 InterPro:IPR011009 InterPro:IPR011990
            InterPro:IPR016024 InterPro:IPR018936 Pfam:PF00454 Pfam:PF02259
            Pfam:PF02260 Pfam:PF08771 PROSITE:PS00915 PROSITE:PS00916
            PROSITE:PS50290 PROSITE:PS51190 SMART:SM00146 GO:GO:0005829
            GO:GO:0005524 SUPFAM:SSF48371 Gene3D:1.25.10.10 InterPro:IPR011989
            GO:GO:0016020 GO:GO:0031929 GO:GO:0016605 GO:GO:0008144
            GO:GO:0046889 SUPFAM:SSF56112 GO:GO:0004674 GO:GO:0051496
            GO:GO:0071456 GO:GO:0012505 GO:GO:0018105 GO:GO:0005764
            GO:GO:0032868 GO:GO:0043022 GO:GO:0050731 Gene3D:1.25.40.10
            GO:GO:0018107 GO:GO:0007281 GO:GO:0030838 Gene3D:1.10.1070.11
            GO:GO:0032314 GO:GO:0051534 GO:GO:0045792 GO:GO:0043200
            GO:GO:0045945 GO:GO:0010592 GO:GO:0031529 PROSITE:PS51189
            InterPro:IPR014009 GO:GO:0045859 GO:GO:0016242 GO:GO:0031669
            GO:GO:0001030 GO:GO:0001031 GO:GO:0001032 OMA:DPYKHKM
            InterPro:IPR024585 InterPro:IPR026683 PANTHER:PTHR11139:SF9
            Pfam:PF11865 SUPFAM:SSF47212 GeneTree:ENSGT00700000104444
            EMBL:AAEX03001936 EMBL:AAEX03001937 Ensembl:ENSCAFT00000026412
            Uniprot:E2R2L2
        Length = 2550

 Score = 164 (62.8 bits), Expect = 2.2e-10, P = 2.2e-10
 Identities = 30/53 (56%), Positives = 42/53 (79%)

Query:    13 YRLCFEEAMSGLDEVFSREKGVNREDRIHGSLLVLNELLRVSNVTWERTYEDL 65
             YR  FEEA  G DE  ++EKG+NR+DRIHG+LL+LNEL+R+S++  ER  E++
Sbjct:   234 YRHTFEEAEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEM 286


>UNIPROTKB|E1BFB4 [details] [associations]
            symbol:MTOR "Uncharacterized protein" species:9913 "Bos
            taurus" [GO:0071456 "cellular response to hypoxia" evidence=IEA]
            [GO:0051534 "negative regulation of NFAT protein import into
            nucleus" evidence=IEA] [GO:0051496 "positive regulation of stress
            fiber assembly" evidence=IEA] [GO:0051219 "phosphoprotein binding"
            evidence=IEA] [GO:0050731 "positive regulation of peptidyl-tyrosine
            phosphorylation" evidence=IEA] [GO:0046889 "positive regulation of
            lipid biosynthetic process" evidence=IEA] [GO:0045945 "positive
            regulation of transcription from RNA polymerase III promoter"
            evidence=IEA] [GO:0045859 "regulation of protein kinase activity"
            evidence=IEA] [GO:0045792 "negative regulation of cell size"
            evidence=IEA] [GO:0043200 "response to amino acid stimulus"
            evidence=IEA] [GO:0043022 "ribosome binding" evidence=IEA]
            [GO:0032868 "response to insulin stimulus" evidence=IEA]
            [GO:0032314 "regulation of Rac GTPase activity" evidence=IEA]
            [GO:0031929 "TOR signaling cascade" evidence=IEA] [GO:0031669
            "cellular response to nutrient levels" evidence=IEA] [GO:0031529
            "ruffle organization" evidence=IEA] [GO:0030838 "positive
            regulation of actin filament polymerization" evidence=IEA]
            [GO:0018107 "peptidyl-threonine phosphorylation" evidence=IEA]
            [GO:0018105 "peptidyl-serine phosphorylation" evidence=IEA]
            [GO:0016605 "PML body" evidence=IEA] [GO:0016242 "negative
            regulation of macroautophagy" evidence=IEA] [GO:0016020 "membrane"
            evidence=IEA] [GO:0012505 "endomembrane system" evidence=IEA]
            [GO:0010831 "positive regulation of myotube differentiation"
            evidence=IEA] [GO:0010592 "positive regulation of lamellipodium
            assembly" evidence=IEA] [GO:0007281 "germ cell development"
            evidence=IEA] [GO:0005829 "cytosol" evidence=IEA] [GO:0005764
            "lysosome" evidence=IEA] [GO:0004674 "protein serine/threonine
            kinase activity" evidence=IEA] [GO:0001156 "TFIIIC-class
            transcription factor binding" evidence=IEA] [GO:0001032 "RNA
            polymerase III type 3 promoter DNA binding" evidence=IEA]
            [GO:0001031 "RNA polymerase III type 2 promoter DNA binding"
            evidence=IEA] [GO:0001030 "RNA polymerase III type 1 promoter DNA
            binding" evidence=IEA] [GO:0005524 "ATP binding" evidence=IEA]
            [GO:0008144 "drug binding" evidence=IEA] InterPro:IPR000403
            InterPro:IPR003151 InterPro:IPR003152 InterPro:IPR009076
            InterPro:IPR011009 InterPro:IPR016024 InterPro:IPR018936
            Pfam:PF00454 Pfam:PF02259 Pfam:PF02260 Pfam:PF08771 PROSITE:PS00915
            PROSITE:PS00916 PROSITE:PS50290 PROSITE:PS51190 SMART:SM00146
            GO:GO:0005829 GO:GO:0005524 SUPFAM:SSF48371 Gene3D:1.25.10.10
            InterPro:IPR011989 GO:GO:0016020 GO:GO:0031929 GO:GO:0016605
            GO:GO:0008144 GO:GO:0046889 SUPFAM:SSF56112 GO:GO:0004674
            GO:GO:0051496 GO:GO:0071456 GO:GO:0012505 GO:GO:0018105
            GO:GO:0005764 GO:GO:0032868 GO:GO:0043022 GO:GO:0050731
            GO:GO:0018107 GO:GO:0007281 GO:GO:0030838 Gene3D:1.10.1070.11
            GO:GO:0032314 GO:GO:0051534 GO:GO:0045792 GO:GO:0043200
            GO:GO:0045945 GO:GO:0010592 GO:GO:0031529 PROSITE:PS51189
            InterPro:IPR014009 GO:GO:0045859 GO:GO:0016242 GO:GO:0031669
            GO:GO:0001030 GO:GO:0001031 GO:GO:0001032 CTD:2475 KO:K07203
            OMA:DPYKHKM InterPro:IPR024585 InterPro:IPR026683
            PANTHER:PTHR11139:SF9 Pfam:PF11865 SUPFAM:SSF47212
            GeneTree:ENSGT00700000104444 EMBL:DAAA02042967 EMBL:DAAA02042966
            IPI:IPI00690309 RefSeq:XP_002694089.1 UniGene:Bt.10699
            Ensembl:ENSBTAT00000020386 GeneID:100139219 KEGG:bta:100139219
            NextBio:20790262 Uniprot:E1BFB4
        Length = 2551

 Score = 164 (62.8 bits), Expect = 2.2e-10, P = 2.2e-10
 Identities = 30/53 (56%), Positives = 42/53 (79%)

Query:    13 YRLCFEEAMSGLDEVFSREKGVNREDRIHGSLLVLNELLRVSNVTWERTYEDL 65
             YR  FEEA  G DE  ++EKG+NR+DRIHG+LL+LNEL+R+S++  ER  E++
Sbjct:   234 YRHTFEEAEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEM 286


>UNIPROTKB|F1RHR8 [details] [associations]
            symbol:MTOR "Uncharacterized protein" species:9823 "Sus
            scrofa" [GO:0071456 "cellular response to hypoxia" evidence=IEA]
            [GO:0051534 "negative regulation of NFAT protein import into
            nucleus" evidence=IEA] [GO:0051496 "positive regulation of stress
            fiber assembly" evidence=IEA] [GO:0051219 "phosphoprotein binding"
            evidence=IEA] [GO:0050731 "positive regulation of peptidyl-tyrosine
            phosphorylation" evidence=IEA] [GO:0046889 "positive regulation of
            lipid biosynthetic process" evidence=IEA] [GO:0045945 "positive
            regulation of transcription from RNA polymerase III promoter"
            evidence=IEA] [GO:0045859 "regulation of protein kinase activity"
            evidence=IEA] [GO:0045792 "negative regulation of cell size"
            evidence=IEA] [GO:0043200 "response to amino acid stimulus"
            evidence=IEA] [GO:0043022 "ribosome binding" evidence=IEA]
            [GO:0032868 "response to insulin stimulus" evidence=IEA]
            [GO:0032314 "regulation of Rac GTPase activity" evidence=IEA]
            [GO:0031929 "TOR signaling cascade" evidence=IEA] [GO:0031669
            "cellular response to nutrient levels" evidence=IEA] [GO:0031529
            "ruffle organization" evidence=IEA] [GO:0030838 "positive
            regulation of actin filament polymerization" evidence=IEA]
            [GO:0018107 "peptidyl-threonine phosphorylation" evidence=IEA]
            [GO:0018105 "peptidyl-serine phosphorylation" evidence=IEA]
            [GO:0016605 "PML body" evidence=IEA] [GO:0016242 "negative
            regulation of macroautophagy" evidence=IEA] [GO:0016020 "membrane"
            evidence=IEA] [GO:0012505 "endomembrane system" evidence=IEA]
            [GO:0010831 "positive regulation of myotube differentiation"
            evidence=IEA] [GO:0010592 "positive regulation of lamellipodium
            assembly" evidence=IEA] [GO:0007281 "germ cell development"
            evidence=IEA] [GO:0005829 "cytosol" evidence=IEA] [GO:0005764
            "lysosome" evidence=IEA] [GO:0004674 "protein serine/threonine
            kinase activity" evidence=IEA] [GO:0001156 "TFIIIC-class
            transcription factor binding" evidence=IEA] [GO:0001032 "RNA
            polymerase III type 3 promoter DNA binding" evidence=IEA]
            [GO:0001031 "RNA polymerase III type 2 promoter DNA binding"
            evidence=IEA] [GO:0001030 "RNA polymerase III type 1 promoter DNA
            binding" evidence=IEA] [GO:0005524 "ATP binding" evidence=IEA]
            [GO:0008144 "drug binding" evidence=IEA] InterPro:IPR000403
            InterPro:IPR003151 InterPro:IPR003152 InterPro:IPR009076
            InterPro:IPR011009 InterPro:IPR011990 InterPro:IPR016024
            InterPro:IPR018936 Pfam:PF00454 Pfam:PF02259 Pfam:PF02260
            Pfam:PF08771 PROSITE:PS00915 PROSITE:PS00916 PROSITE:PS50290
            PROSITE:PS51190 SMART:SM00146 GO:GO:0005829 GO:GO:0005524
            SUPFAM:SSF48371 Gene3D:1.25.10.10 InterPro:IPR011989 GO:GO:0016020
            GO:GO:0031929 GO:GO:0016605 GO:GO:0008144 GO:GO:0046889
            SUPFAM:SSF56112 GO:GO:0004674 GO:GO:0051496 GO:GO:0071456
            GO:GO:0012505 GO:GO:0018105 GO:GO:0005764 GO:GO:0032868
            GO:GO:0043022 GO:GO:0050731 Gene3D:1.25.40.10 GO:GO:0018107
            GO:GO:0007281 GO:GO:0030838 Gene3D:1.10.1070.11 GO:GO:0032314
            GO:GO:0051534 GO:GO:0045792 GO:GO:0043200 GO:GO:0045945
            GO:GO:0010592 GO:GO:0031529 PROSITE:PS51189 InterPro:IPR014009
            GO:GO:0045859 GO:GO:0016242 GO:GO:0031669 GO:GO:0001030
            GO:GO:0001031 GO:GO:0001032 OMA:DPYKHKM InterPro:IPR024585
            InterPro:IPR026683 PANTHER:PTHR11139:SF9 Pfam:PF11865
            SUPFAM:SSF47212 GeneTree:ENSGT00700000104444 EMBL:CU929865
            EMBL:CU694468 Ensembl:ENSSSCT00000003786 Uniprot:F1RHR8
        Length = 2551

 Score = 164 (62.8 bits), Expect = 2.2e-10, P = 2.2e-10
 Identities = 30/53 (56%), Positives = 42/53 (79%)

Query:    13 YRLCFEEAMSGLDEVFSREKGVNREDRIHGSLLVLNELLRVSNVTWERTYEDL 65
             YR  FEEA  G DE  ++EKG+NR+DRIHG+LL+LNEL+R+S++  ER  E++
Sbjct:   234 YRHTFEEAEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEM 286


>UNIPROTKB|F1NUX4 [details] [associations]
            symbol:MTOR "Uncharacterized protein" species:9031 "Gallus
            gallus" [GO:0008144 "drug binding" evidence=IEA] [GO:0005524 "ATP
            binding" evidence=IEA] [GO:0001030 "RNA polymerase III type 1
            promoter DNA binding" evidence=IEA] [GO:0001031 "RNA polymerase III
            type 2 promoter DNA binding" evidence=IEA] [GO:0001032 "RNA
            polymerase III type 3 promoter DNA binding" evidence=IEA]
            [GO:0001156 "TFIIIC-class transcription factor binding"
            evidence=IEA] [GO:0004674 "protein serine/threonine kinase
            activity" evidence=IEA] [GO:0005764 "lysosome" evidence=IEA]
            [GO:0005829 "cytosol" evidence=IEA] [GO:0007281 "germ cell
            development" evidence=IEA] [GO:0010592 "positive regulation of
            lamellipodium assembly" evidence=IEA] [GO:0010831 "positive
            regulation of myotube differentiation" evidence=IEA] [GO:0012505
            "endomembrane system" evidence=IEA] [GO:0016020 "membrane"
            evidence=IEA] [GO:0016242 "negative regulation of macroautophagy"
            evidence=IEA] [GO:0016605 "PML body" evidence=IEA] [GO:0018105
            "peptidyl-serine phosphorylation" evidence=IEA] [GO:0018107
            "peptidyl-threonine phosphorylation" evidence=IEA] [GO:0030838
            "positive regulation of actin filament polymerization"
            evidence=IEA] [GO:0031529 "ruffle organization" evidence=IEA]
            [GO:0031669 "cellular response to nutrient levels" evidence=IEA]
            [GO:0031929 "TOR signaling cascade" evidence=IEA] [GO:0032314
            "regulation of Rac GTPase activity" evidence=IEA] [GO:0032868
            "response to insulin stimulus" evidence=IEA] [GO:0043022 "ribosome
            binding" evidence=IEA] [GO:0043200 "response to amino acid
            stimulus" evidence=IEA] [GO:0045792 "negative regulation of cell
            size" evidence=IEA] [GO:0045859 "regulation of protein kinase
            activity" evidence=IEA] [GO:0045945 "positive regulation of
            transcription from RNA polymerase III promoter" evidence=IEA]
            [GO:0046889 "positive regulation of lipid biosynthetic process"
            evidence=IEA] [GO:0050731 "positive regulation of peptidyl-tyrosine
            phosphorylation" evidence=IEA] [GO:0051219 "phosphoprotein binding"
            evidence=IEA] [GO:0051496 "positive regulation of stress fiber
            assembly" evidence=IEA] [GO:0051534 "negative regulation of NFAT
            protein import into nucleus" evidence=IEA] [GO:0071456 "cellular
            response to hypoxia" evidence=IEA] InterPro:IPR000403
            InterPro:IPR003151 InterPro:IPR003152 InterPro:IPR009076
            InterPro:IPR011009 InterPro:IPR011990 InterPro:IPR016024
            InterPro:IPR018936 Pfam:PF00454 Pfam:PF02259 Pfam:PF02260
            Pfam:PF08771 PROSITE:PS00915 PROSITE:PS00916 PROSITE:PS50290
            PROSITE:PS51190 SMART:SM00146 GO:GO:0005829 GO:GO:0005524
            SUPFAM:SSF48371 Gene3D:1.25.10.10 InterPro:IPR011989 GO:GO:0016020
            GO:GO:0031929 GO:GO:0016605 GO:GO:0008144 GO:GO:0046889
            SUPFAM:SSF56112 GO:GO:0004674 GO:GO:0051496 GO:GO:0071456
            GO:GO:0012505 GO:GO:0018105 GO:GO:0005764 GO:GO:0032868
            GO:GO:0043022 GO:GO:0050731 Gene3D:1.25.40.10 GO:GO:0018107
            GO:GO:0030838 Gene3D:1.10.1070.11 GO:GO:0032314 GO:GO:0051534
            GO:GO:0045792 GO:GO:0043200 GO:GO:0045945 GO:GO:0010592
            GO:GO:0031529 PROSITE:PS51189 InterPro:IPR014009 GO:GO:0045859
            GO:GO:0016242 GO:GO:0031669 GO:GO:0001030 GO:GO:0001031
            GO:GO:0001032 OMA:DPYKHKM InterPro:IPR024585 InterPro:IPR026683
            PANTHER:PTHR11139:SF9 Pfam:PF11865 SUPFAM:SSF47212
            GeneTree:ENSGT00700000104444 EMBL:AADN02040751 IPI:IPI00593602
            Ensembl:ENSGALT00000005284 Uniprot:F1NUX4
        Length = 2455

 Score = 161 (61.7 bits), Expect = 4.3e-10, P = 4.3e-10
 Identities = 29/53 (54%), Positives = 42/53 (79%)

Query:    13 YRLCFEEAMSGLDEVFSREKGVNREDRIHGSLLVLNELLRVSNVTWERTYEDL 65
             YR  +EEA  G DE  ++EKG+NR+DRIHG+LL+LNEL+R+S++  ER  E++
Sbjct:   152 YRHTYEEAEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEM 204


>ZFIN|ZDB-GENE-030131-2974 [details] [associations]
            symbol:mtor "mechanistic target of rapamycin
            (serine/threonine kinase)" species:7955 "Danio rerio" [GO:0016773
            "phosphotransferase activity, alcohol group as acceptor"
            evidence=IEA] [GO:0016772 "transferase activity, transferring
            phosphorus-containing groups" evidence=IEA] [GO:0008144 "drug
            binding" evidence=IEA] [GO:0043588 "skin development" evidence=IGI]
            [GO:0016301 "kinase activity" evidence=IEA] [GO:0000166 "nucleotide
            binding" evidence=IEA] [GO:0016310 "phosphorylation" evidence=IEA]
            [GO:0005524 "ATP binding" evidence=IEA] [GO:0016740 "transferase
            activity" evidence=IEA] [GO:0048565 "digestive tract development"
            evidence=IMP] InterPro:IPR000403 InterPro:IPR003151
            InterPro:IPR003152 InterPro:IPR009076 InterPro:IPR011009
            InterPro:IPR011990 InterPro:IPR016024 InterPro:IPR018936
            Pfam:PF00454 Pfam:PF02259 Pfam:PF02260 Pfam:PF08771 PROSITE:PS00915
            PROSITE:PS00916 PROSITE:PS50290 PROSITE:PS51190 SMART:SM00146
            ZFIN:ZDB-GENE-030131-2974 GO:GO:0005524 GO:GO:0043588
            SUPFAM:SSF48371 Gene3D:1.25.10.10 InterPro:IPR011989 GO:GO:0008144
            SUPFAM:SSF56112 GO:GO:0016301 Gene3D:1.25.40.10 GO:GO:0016773
            Gene3D:1.10.1070.11 GO:GO:0048565 PROSITE:PS51189
            InterPro:IPR014009 EMBL:CR354402 HOVERGEN:HBG005744 OMA:DPYKHKM
            OrthoDB:EOG41RPT0 InterPro:IPR024585 InterPro:IPR026683
            PANTHER:PTHR11139:SF9 Pfam:PF11865 SUPFAM:SSF47212
            GeneTree:ENSGT00700000104444 EMBL:CR450703 EMBL:CR354389
            EMBL:CT025740 IPI:IPI00890553 UniGene:Dr.43038 SMR:B0UX67
            STRING:B0UX67 Ensembl:ENSDART00000122801 Uniprot:B0UX67
        Length = 2563

 Score = 158 (60.7 bits), Expect = 9.4e-10, P = 9.4e-10
 Identities = 27/53 (50%), Positives = 42/53 (79%)

Query:    13 YRLCFEEAMSGLDEVFSREKGVNREDRIHGSLLVLNELLRVSNVTWERTYEDL 65
             Y+  FEEA  G DE  ++EKG+N++DR+HG+LL+LNEL+R+S++  ER  E++
Sbjct:   220 YKQTFEEAEKGFDETLAKEKGMNKDDRVHGALLILNELVRISSMEGERMREEM 272


>FB|FBgn0021796 [details] [associations]
            symbol:Tor "Target of rapamycin" species:7227 "Drosophila
            melanogaster" [GO:0007584 "response to nutrient" evidence=TAS]
            [GO:0040007 "growth" evidence=TAS] [GO:0016310 "phosphorylation"
            evidence=NAS] [GO:0004672 "protein kinase activity" evidence=NAS]
            [GO:0009594 "detection of nutrient" evidence=TAS] [GO:0046622
            "positive regulation of organ growth" evidence=TAS] [GO:0045793
            "positive regulation of cell size" evidence=IGI;IMP;TAS]
            [GO:0030307 "positive regulation of cell growth" evidence=NAS;TAS]
            [GO:0040018 "positive regulation of multicellular organism growth"
            evidence=TAS] [GO:0008144 "drug binding" evidence=IEA] [GO:0016773
            "phosphotransferase activity, alcohol group as acceptor"
            evidence=IEA] [GO:0008340 "determination of adult lifespan"
            evidence=IMP] [GO:0016242 "negative regulation of macroautophagy"
            evidence=IMP] [GO:0035264 "multicellular organism growth"
            evidence=IMP] [GO:0008406 "gonad development" evidence=IMP]
            [GO:0043621 "protein self-association" evidence=IDA] [GO:0001558
            "regulation of cell growth" evidence=IDA] [GO:0032456 "endocytic
            recycling" evidence=IDA] [GO:0090070 "positive regulation of
            ribosome biogenesis" evidence=IMP] [GO:0006974 "response to DNA
            damage stimulus" evidence=IMP] [GO:0048813 "dendrite morphogenesis"
            evidence=IMP] [GO:0001934 "positive regulation of protein
            phosphorylation" evidence=IGI] [GO:2000377 "regulation of reactive
            oxygen species metabolic process" evidence=IGI] [GO:0007411 "axon
            guidance" evidence=IGI] [GO:0051124 "synaptic growth at
            neuromuscular junction" evidence=IGI] [GO:0042331 "phototaxis"
            evidence=IGI] InterPro:IPR000403 InterPro:IPR003151
            InterPro:IPR003152 InterPro:IPR009076 InterPro:IPR011009
            InterPro:IPR011990 InterPro:IPR013026 InterPro:IPR016024
            InterPro:IPR018936 InterPro:IPR019734 Pfam:PF00454 Pfam:PF02259
            Pfam:PF02260 Pfam:PF08771 PROSITE:PS00915 PROSITE:PS00916
            PROSITE:PS50005 PROSITE:PS50290 PROSITE:PS50293 PROSITE:PS51190
            SMART:SM00146 GO:GO:0005524 GO:GO:0008340 GO:GO:0007411
            GO:GO:0030307 SUPFAM:SSF48371 Gene3D:1.25.10.10 InterPro:IPR011989
            PROSITE:PS50077 GO:GO:0008406 EMBL:AE014134 GO:GO:0008144
            SUPFAM:SSF56112 GO:GO:0042331 GO:GO:0051124 GO:GO:0040018
            GO:GO:0006974 GO:GO:0043621 GO:GO:0007049 GO:GO:0004672
            GO:GO:0045793 GO:GO:0048813 Gene3D:1.25.40.10 GO:GO:0035264
            eggNOG:COG5032 Gene3D:1.10.1070.11 GO:GO:0001934 GO:GO:0046622
            GO:GO:0032456 PROSITE:PS51189 InterPro:IPR014009 GO:GO:2000377
            GO:GO:0016242 GO:GO:0009594 KO:K07203 OMA:DPYKHKM
            InterPro:IPR024585 InterPro:IPR026683 PANTHER:PTHR11139:SF9
            Pfam:PF11865 SUPFAM:SSF47212 GeneTree:ENSGT00700000104444
            GO:GO:0090070 HSSP:P42345 RefSeq:NP_524891.1 UniGene:Dm.1502
            ProteinModelPortal:Q9VK45 SMR:Q9VK45 IntAct:Q9VK45 STRING:Q9VK45
            PaxDb:Q9VK45 PRIDE:Q9VK45 EnsemblMetazoa:FBtr0080422 GeneID:47396
            KEGG:dme:Dmel_CG5092 UCSC:CG5092-RA FlyBase:FBgn0021796
            InParanoid:Q9VK45 OrthoDB:EOG4XWDCK PhylomeDB:Q9VK45
            GenomeRNAi:47396 NextBio:839022 Bgee:Q9VK45 Uniprot:Q9VK45
        Length = 2470

 Score = 144 (55.7 bits), Expect = 2.8e-08, P = 2.8e-08
 Identities = 29/67 (43%), Positives = 43/67 (64%)

Query:     2 KALREKSAYATYRLCFEEAMSGLD-EVFSR--EKGVNREDRIHGSLLVLNELLRVSNVTW 58
             ++ ++ S    YR+C++EA    + ++ S   +KGV R+DRIHG L+V NEL R +N TW
Sbjct:   211 ESTKQSSEPQWYRICYDEANGSFNADLGSSKDQKGVTRDDRIHGGLVVFNELFRCANATW 270

Query:    59 ERTYEDL 65
             ER Y  L
Sbjct:   271 ERRYTSL 277


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.318   0.132   0.377    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0       81        81   0.00091  102 3  11 22  0.41    29
                                                     29  0.42    30


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  9
  No. of states in DFA:  500 (53 KB)
  Total size of DFA:  98 KB (2071 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  9.14u 0.08s 9.22t   Elapsed:  00:00:04
  Total cpu time:  9.14u 0.08s 9.22t   Elapsed:  00:00:04
  Start:  Thu Aug 15 11:20:38 2013   End:  Thu Aug 15 11:20:42 2013

Back to top