Diaphorina citri psyllid: psy11497

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------7
MKCFSFQELTDVDVLNESEEGTESLLTALLDQQVCALLVQNLERLDETVKEESDGVHNTLGKLVTPLGK
cccccccccccHHHccccHHHHHHHHHHHHHcHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccc
*KCFSFQELTDVDVLNESEEGTESLLTALLDQQVCALLVQNLERLDE**KEESDGVHNTLGKLVTPLG*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKCFSFQELTDVDVLNESEEGTESLLTALLDQQVCALLVQNLERLDETVKEESDGVHNTLGKLVTPLGK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Beta-catenin-like protein 1 Induces apoptosis in CHO cells.confidentQ8WYA6
Beta-catenin-like protein 1 Induces apoptosis in CHO cells.confidentQ9CWL8
Beta-catenin-like protein 1 Induces apoptosis in CHO cells.confidentO62703

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0000974 [CC]Prp19 complexprobableGO:0043234, GO:0005575, GO:0032991
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005681 [CC]spliceosomal complexprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0016445 [BP]somatic diversification of immunoglobulinsprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0002376, GO:0002377, GO:0008150, GO:0002440, GO:0048731, GO:0002200, GO:0007275, GO:0044699, GO:0002520
GO:0019899 [MF]enzyme bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0008380 [BP]RNA splicingprobableGO:0016070, GO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0010467, GO:0006807, GO:0008150, GO:1901360, GO:0008152, GO:0006396, GO:0046483
GO:0006917 [BP]induction of apoptosisprobableGO:0050789, GO:0043067, GO:0050794, GO:0043065, GO:0048518, GO:0012502, GO:0065007, GO:0010942, GO:0008150, GO:0010941, GO:0042981, GO:0043068, GO:0048522
GO:0006915 [BP]apoptotic processprobableGO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699
GO:0006397 [BP]mRNA processingprobableGO:0016070, GO:0016071, GO:0044238, GO:0044260, GO:0006139, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0010467, GO:0006807, GO:0008150, GO:1901360, GO:0008152, GO:0006396, GO:0046483

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted